F393385

General Info

Members Datasets Scaffolds Average Seq Length
296 183 592 340

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0000475|Ga0496115_0000475_9230_10405
Length 391
Sequence MSSRPAGSLTTPVATDAPPQDAVESTSGVVGYADGAVIDGSPSVDRDSDGQLNAQRDAPVGGQAVLEGVMMRGVSNWAVAVRKPSEEQLSEGELSPEEAALGEIEVSTFPLDSAMKRHRVLRLPIIRGIVALGGSLVIGFRALEVSANAQLPPEPKDEAQADANGVAEPSEPDEIPKAVWAGTVVVALVFAIVLFFLIPVGLTSLIKDQLGSSFLFWLIEGVVRTAIFLGYMLLLSRVRDLRRVFEYHGAEHKTISCFEAGLPLTPVNAQRFSRLHPRCGTSFLLVVMIVAIFVFAPIGLPAWYLLVATRILGVPLIAGISFELIKFAGRNRSRRWVRAVMWPGLKLQLLTTREPDLDQLAVAIAALEAVLERETPGALTAEDLVGVEVVA

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 20.61
Rhizosphere 76.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0000475 3300048918 Bacteria 31968
2 JGI25407J50210_10014790 3300003373 Bacteria 2013
3 Ga0070676_10287488 3300005328 Bacteria 1110
4 Ga0070683_100017677 3300005329 Bacteria 6300
5 Ga0070690_100019258 3300005330 Bacteria 4138
6 Ga0070666_10141359 3300005335 Bacteria 1677
7 Ga0070682_100005699 3300005337 Bacteria 6940
8 Ga0070682_100076876 3300005337 Bacteria 2150
9 Ga0068868_100022331 3300005338 Bacteria 4773
10 Ga0068868_100052517 3300005338 Bacteria 3209
11 Ga0070692_10039083 3300005345 Bacteria 2422
12 Ga0070674_100079905 3300005356 Bacteria 2334
13 Ga0070674_100213065 3300005356 Bacteria 1498
14 Ga0070674_100382146 3300005356 Bacteria 1146
15 Ga0070688_100164156 3300005365 Bacteria 1528
16 Ga0070703_10010885 3300005406 Bacteria 2567
17 Ga0070713_100125458 3300005436 Bacteria 2257
18 Ga0070713_100147773 3300005436 Bacteria 2088
19 Ga0070710_10197202 3300005437 Bacteria 1269
20 Ga0070701_10034841 3300005438 Bacteria 2524
21 Ga0070711_100015780 3300005439 Bacteria 4784
22 Ga0070711_100028325 3300005439 Bacteria 3686
23 Ga0070711_100192933 3300005439 Bacteria 1567
24 Ga0070700_100020637 3300005441 Bacteria 3820
25 Ga0070700_100028729 3300005441 Bacteria 3311
26 Ga0070663_100026969 3300005455 Bacteria 3896
27 Ga0070662_100048797 3300005457 Bacteria 3051
28 Ga0070662_100319020 3300005457 Bacteria 1267
29 Ga0068867_100031453 3300005459 Bacteria 3832
30 Ga0070685_10010153 3300005466 Bacteria 4888
31 Ga0070685_10045715 3300005466 Bacteria 2512
32 Ga0070706_100130488 3300005467 Bacteria 2345
33 Ga0070699_100250881 3300005518 Bacteria 1581
34 Ga0070684_100061090 3300005535 Bacteria 3297
35 Ga0070684_100202183 3300005535 Bacteria 1810
36 Ga0070686_100055620 3300005544 Bacteria 2535
37 Ga0070665_100530031 3300005548 Bacteria 1189
38 Ga0070704_100036252 3300005549 Bacteria 3359
39 Ga0070704_100114867 3300005549 Bacteria 2056
40 Ga0070664_100045850 3300005564 Bacteria 3692
41 Ga0068856_100045786 3300005614 Bacteria 4308
42 Ga0070702_100042763 3300005615 Bacteria 2549
43 Ga0068852_100064869 3300005616 Bacteria 3185
44 Ga0068864_100047397 3300005618 Bacteria 3691
45 Ga0068864_100106645 3300005618 Bacteria 2491
46 Ga0068864_100168334 3300005618 Bacteria 1996
47 Ga0068864_100169208 3300005618 Bacteria 1991
48 Ga0068861_100091143 3300005719 Bacteria 2406
49 Ga0068863_100489119 3300005841 Bacteria 1211
50 Ga0068860_100161090 3300005843 Bacteria 2163
51 Ga0081538_10031801 3300005981 Bacteria 3551
52 Ga0081538_10038340 3300005981 Bacteria 3093
53 Ga0081538_10066269 3300005981 Bacteria 2026
54 Ga0081540_1004948 3300005983 Bacteria 10017
55 Ga0081539_10015574 3300005985 Bacteria 5516
56 Ga0070717_10003877 3300006028 Bacteria 10753
57 Ga0070717_10033094 3300006028 Bacteria 4169
58 Ga0075364_10034161 3300006051 Bacteria 3279
59 Ga0070712_100026791 3300006175 Bacteria 3845
60 Ga0075430_100021958 3300006846 Bacteria 5424
61 Ga0075433_10144487 3300006852 Bacteria 2115
62 Ga0075434_100102307 3300006871 Bacteria 2872
63 Ga0068865_100011147 3300006881 Bacteria 5616
64 Ga0068865_100022933 3300006881 Bacteria 4080
65 Ga0068865_100100938 3300006881 Bacteria 2112
66 Ga0075436_100076768 3300006914 Bacteria 2313
67 Ga0075435_100036162 3300007076 Bacteria 3922
68 Ga0105240_10073648 3300009093 Bacteria 4217
69 Ga0111539_10024544 3300009094 Bacteria 7395
70 Ga0111539_10176392 3300009094 Bacteria 2496
71 Ga0105245_10061617 3300009098 Bacteria 3382
72 Ga0105245_10078431 3300009098 Bacteria 3014
73 Ga0105245_10150536 3300009098 Bacteria 2200
74 Ga0114129_10308368 3300009147 Bacteria 2108
75 Ga0114129_10471504 3300009147 Bacteria 1644
76 Ga0105243_10099431 3300009148 Bacteria 2411
77 Ga0105243_10438475 3300009148 Bacteria 1222
78 Ga0105248_10526848 3300009177 Bacteria 1333
79 Ga0105237_10004667 3300009545 Bacteria 15781
80 Ga0105237_10127764 3300009545 Bacteria 2536
81 Ga0105249_10072816 3300009553 Bacteria 3177
82 Ga0105249_10346099 3300009553 Bacteria 1505
83 Ga0105239_10067397 3300010375 Bacteria 3932
84 Ga0105239_10139248 3300010375 Bacteria 2703
85 Ga0105246_10020948 3300011119 Bacteria 4199
86 Ga0157371_10109048 3300013102 Bacteria 1965
87 Ga0157369_10255354 3300013105 Bacteria 1829
88 Ga0157374_10015900 3300013296 Bacteria 6611
89 Ga0163162_10179939 3300013306 Bacteria 2240
90 Ga0163162_10315243 3300013306 Bacteria 1697
91 Ga0157372_10208310 3300013307 Bacteria 2265
92 Ga0157372_10279726 3300013307 Bacteria 1940
93 Ga0157372_10532027 3300013307 Bacteria 1370
94 Ga0157375_10147115 3300013308 Bacteria 2487
95 Ga0157380_10125053 3300014326 Bacteria 2184
96 Ga0157380_10258509 3300014326 Bacteria 1580
97 Ga0157377_10002989 3300014745 Bacteria 7574
98 Ga0157379_10007974 3300014968 Bacteria 9189
99 Ga0157379_10105339 3300014968 Bacteria 2531
100 Ga0157379_10206625 3300014968 Bacteria 1776
101 Ga0157376_10143251 3300014969 Bacteria 2146
102 Ga0206352_10304464 3300020078 Bacteria 1694
103 Ga0213876_10008816 3300021384 Bacteria 5445
104 Ga0207656_10024200 3300025321 Bacteria 2453
105 Ga0207692_10089939 3300025898 Bacteria 1663
106 Ga0207692_10139929 3300025898 Bacteria 1376
107 Ga0207642_10035151 3300025899 Bacteria 2137
108 Ga0207642_10036221 3300025899 Bacteria 2116
109 Ga0207642_10094964 3300025899 Bacteria 1483
110 Ga0207688_10124086 3300025901 Bacteria 1509
111 Ga0207643_10007462 3300025908 Bacteria 5869
112 Ga0207654_10061172 3300025911 Bacteria 2202
113 Ga0207695_10020035 3300025913 Bacteria 7676
114 Ga0207695_10243681 3300025913 Bacteria 1698
115 Ga0207671_10002112 3300025914 Bacteria 21693
116 Ga0207693_10008120 3300025915 Bacteria 8604
117 Ga0207693_10032718 3300025915 Bacteria 4104
118 Ga0207663_10050232 3300025916 Bacteria 2591
119 Ga0207662_10050993 3300025918 Bacteria 2461
120 Ga0207662_10116212 3300025918 Bacteria 1673
121 Ga0207657_10082040 3300025919 Bacteria 2707
122 Ga0207657_10154645 3300025919 Bacteria 1866
123 Ga0207657_10292114 3300025919 Bacteria 1292
124 Ga0207681_10112062 3300025923 Bacteria 1986
125 Ga0207650_10190128 3300025925 Bacteria 1640
126 Ga0207687_10098982 3300025927 Bacteria 2142
127 Ga0207687_10300030 3300025927 Bacteria 1294
128 Ga0207700_10049223 3300025928 Bacteria 3134
129 Ga0207706_10099351 3300025933 Bacteria 2560
130 Ga0207706_10187544 3300025933 Bacteria 1816
131 Ga0207709_10061556 3300025935 Bacteria 2346
132 Ga0207669_10294688 3300025937 Bacteria 1230
133 Ga0207704_10018558 3300025938 Bacteria 3634
134 Ga0207704_10165476 3300025938 Bacteria 1579
135 Ga0207711_10096852 3300025941 Bacteria 2604
136 Ga0207711_10139887 3300025941 Bacteria 2177
137 Ga0207689_10132210 3300025942 Bacteria 2054
138 Ga0207679_10169448 3300025945 Bacteria 1796
139 Ga0207712_10035271 3300025961 Bacteria 3397
140 Ga0207668_10085006 3300025972 Bacteria 2307
141 Ga0207640_10040603 3300025981 Bacteria 2953
142 Ga0207677_10178480 3300026023 Bacteria 1668
143 Ga0207678_10033283 3300026067 Bacteria 4491
144 Ga0207708_10000206 3300026075 Bacteria 46672
145 Ga0207708_10051772 3300026075 Bacteria 3127
146 Ga0207641_10335145 3300026088 Bacteria 1438
147 Ga0207648_10041337 3300026089 Bacteria 4048
148 Ga0207676_10063225 3300026095 Bacteria 2939
149 Ga0207674_10095100 3300026116 Bacteria 2966
150 Ga0207674_10247244 3300026116 Bacteria 1730
151 Ga0207675_100169896 3300026118 Bacteria 2084
152 Ga0207675_100267775 3300026118 Bacteria 1657
153 Ga0207675_100364686 3300026118 Bacteria 1418
154 Ga0207683_10061617 3300026121 Bacteria 3302
155 Ga0207698_10196071 3300026142 Bacteria 1804
156 Ga0207698_10358745 3300026142 Bacteria 1380
157 Ga0207428_10025466 3300027907 Bacteria 4952
158 Ga0265337_1006945 3300028556 Bacteria 4293
159 Ga0265326_10000818 3300028558 Bacteria 11472
160 Ga0265319_1000670 3300028563 Bacteria 22456
161 Ga0265318_10002609 3300028577 Bacteria 9516
162 Ga0265336_10000002 3300028666 Bacteria 830172
163 Ga0265338_10000001 3300028800 Bacteria 1177449
164 Ga0265338_10027697 3300028800 Bacteria 5678
165 Ga0265324_10004220 3300029957 Bacteria 6572
166 Ga0265340_10000001 3300031247 Bacteria 1647668
167 Ga0265327_10002631 3300031251 Bacteria 18518
168 Ga0265316_10049704 3300031344 Bacteria 3302
169 Ga0307416_100086617 3300032002 Bacteria 2671
170 Ga0307416_100087185 3300032002 Bacteria 2664
171 Ga0373939_0082876 3300035114 Bacteria 1069
172 Ga0316574_0033240 3300035398 Bacteria 3139
173 Ga0395900_0108038 3300037418 Bacteria 2859
174 Ga0395898_0048469 3300037466 Bacteria 4166
175 Ga0395898_0052141 3300037466 Bacteria 3997
176 Ga0395898_0533867 3300037466 Bacteria 1115
177 Ga0436364_0501062 3300037853 Bacteria 33402
178 Ga0436364_1424608 3300037853 Bacteria 1525
179 Ga0395901_0028916 3300038443 Bacteria 5702
180 Ga0395901_0244195 3300038443 Bacteria 1872
181 Ga0395901_0465127 3300038443 Bacteria 1292
182 Ga0436365_0320762 3300039437 Bacteria 14465
183 Ga0466966_0084576 3300044684 Bacteria 1973
184 Ga0466963_0010553 3300044694 Bacteria 5596
185 Ga0466968_0052841 3300044735 Bacteria 1739
186 Ga0466960_0000134 3300044901 Bacteria 25178
187 Ga0466958_0142485 3300045836 Bacteria 1510
188 Ga0466967_0047866 3300045976 Bacteria 3730
189 Ga0466967_0091808 3300045976 Bacteria 2760
190 Ga0495653_0000334 3300046463 Bacteria 38586
191 Ga0495580_0174563 3300046472 Bacteria 1485
192 Ga0495664_0000007 3300046477 Bacteria 386710
193 Ga0495584_0024674 3300046491 Bacteria 3049
194 Ga0495618_0000760 3300046514 Bacteria 22554
195 Ga0495630_0001650 3300046517 Bacteria 15514
196 Ga0495642_0091844 3300046528 Bacteria 1286
197 Ga0495652_0140089 3300046529 Bacteria 1903
198 Ga0495645_0000055 3300046543 Bacteria 82861
199 Ga0495645_0001137 3300046543 Bacteria 18032
200 Ga0495588_0131046 3300046674 Bacteria 1323
201 Ga0495657_0000013 3300046675 Bacteria 195590
202 Ga0495600_0063817 3300046809 Bacteria 2407
203 Ga0495581_0100353 3300047315 Bacteria 1682
204 Ga0496100_0003717 3300048903 Bacteria 7994
205 Ga0496100_0004277 3300048903 Bacteria 7557
206 Ga0496100_0152491 3300048903 Bacteria 1650
207 Ga0496101_0012600 3300048904 Bacteria 5645
208 Ga0496101_0067590 3300048904 Bacteria 2610
209 Ga0496101_0196240 3300048904 Bacteria 1559
210 Ga0496102_0000002 3300048905 Bacteria 814588
211 Ga0496102_0064934 3300048905 Bacteria 3344
212 Ga0496102_0080716 3300048905 Bacteria 2997
213 Ga0496102_0158191 3300048905 Bacteria 2130
214 Ga0496102_0160939 3300048905 Bacteria 2112
215 Ga0496102_0232289 3300048905 Bacteria 1739
216 Ga0496103_0000017 3300048906 Bacteria 244768
217 Ga0496103_0045360 3300048906 Bacteria 2713
218 Ga0496103_0141814 3300048906 Bacteria 1537
219 Ga0496104_0000001 3300048907 Bacteria 711867
220 Ga0496104_0023983 3300048907 Bacteria 5612
221 Ga0496104_0042579 3300048907 Bacteria 4262
222 Ga0496104_0130665 3300048907 Bacteria 2412
223 Ga0496104_0355639 3300048907 Bacteria 1377
224 Ga0496105_0005467 3300048908 Bacteria 9640
225 Ga0496105_0079315 3300048908 Bacteria 2711
226 Ga0496105_0279686 3300048908 Bacteria 1346
227 Ga0496106_0012115 3300048909 Bacteria 6365
228 Ga0496106_0110031 3300048909 Bacteria 2144
229 Ga0496106_0194912 3300048909 Bacteria 1611
230 Ga0496106_0213004 3300048909 Bacteria 1539
231 Ga0496107_0044203 3300048910 Bacteria 3202
232 Ga0496107_0053496 3300048910 Bacteria 2912
233 Ga0496107_0257980 3300048910 Bacteria 1297
234 Ga0496108_0002835 3300048911 Bacteria 13912
235 Ga0496108_0059572 3300048911 Bacteria 3210
236 Ga0496108_0060166 3300048911 Bacteria 3195
237 Ga0496108_0288981 3300048911 Bacteria 1427
238 Ga0496109_0002835 3300048912 Bacteria 14522
239 Ga0496109_0095080 3300048912 Bacteria 2758
240 Ga0496109_0140272 3300048912 Bacteria 2260
241 Ga0496110_0000248 3300048913 Bacteria 35008
242 Ga0496110_0000684 3300048913 Bacteria 23345
243 Ga0496110_0091388 3300048913 Bacteria 2723
244 Ga0496111_0000021 3300048914 Bacteria 67813
245 Ga0496111_0006566 3300048914 Bacteria 7564
246 Ga0496111_0070979 3300048914 Bacteria 2534
247 Ga0496111_0079346 3300048914 Bacteria 2394
248 Ga0496111_0087306 3300048914 Bacteria 2283
249 Ga0496112_0000411 3300048915 Bacteria 28176
250 Ga0496112_0004469 3300048915 Bacteria 11856
251 Ga0496112_0090852 3300048915 Bacteria 3022
252 Ga0496113_0079078 3300048916 Bacteria 2516
253 Ga0496113_0159046 3300048916 Bacteria 1785
254 Ga0496113_0183959 3300048916 Bacteria 1657
255 Ga0496113_0268526 3300048916 Bacteria 1363
256 Ga0496114_0108466 3300048917 Bacteria 2376
257 Ga0496114_0112039 3300048917 Bacteria 2339
258 Ga0496114_0217489 3300048917 Bacteria 1677
259 Ga0496114_0461485 3300048917 Bacteria 1124
260 Ga0496115_0001207 3300048918 Bacteria 18531
261 Ga0496115_0067991 3300048918 Bacteria 2883
262 Ga0496115_0232229 3300048918 Bacteria 1521
263 Ga0496115_0234052 3300048918 Bacteria 1514
264 Ga0496121_0005914 3300048924 Bacteria 15480
265 Ga0496121_0049959 3300048924 Bacteria 3539
266 Ga0501036_0075229 3300049572 Bacteria 2856
267 Ga0501040_0049257 3300049576 Bacteria 2880
268 Ga0501042_0010955 3300049578 Bacteria 6104
269 Ga0501042_0015259 3300049578 Bacteria 5258
270 Ga0501046_0126817 3300049580 Bacteria 1938
271 Ga0501048_0180292 3300049582 Bacteria 1497
272 Ga0501072_0227701 3300049588 Bacteria 1485
273 Ga0501075_0052467 3300049591 Bacteria 3066
274 Ga0501075_0139226 3300049591 Bacteria 1849
275 Ga0501076_0024066 3300049592 Bacteria 4703
276 Ga0501076_0089539 3300049592 Bacteria 2474
277 Ga0501076_0207516 3300049592 Bacteria 1600
278 Ga0501077_0115103 3300049593 Bacteria 1704
279 Ga0501081_0037150 3300049743 Bacteria 3323
280 Ga0501045_0105340 3300049824 Bacteria 2090
281 nmdc:mga00v17_79076_c1 3300050491 Bacteria 2050
282 nmdc:mga05p37_601685_c1 3300050507 Bacteria 1241
283 nmdc:mga0qj67_19939_c1 3300050509 Bacteria 5131
284 nmdc:mga0rr50_135221_c1 3300050513 Bacteria 1978
285 nmdc:mga0a205_14439_c1 3300050515 Bacteria 7366
286 nmdc:mga0a205_153514_c1 3300050515 Bacteria 2201
287 Ga0495601_0001509 3300053077 Bacteria 12838
288 Ga0495601_0006662 3300053077 Bacteria 6761
289 Ga0495612_0000029 3300053078 Bacteria 84891
290 Ga0500641_0061373 3300053096 Bacteria 1566
291 Ga0500616_0004409 3300053153 Bacteria 10041
292 Ga0501084_0068063 3300054114 Bacteria 2981
293 Ga0501084_0156163 3300054114 Bacteria 1924
294 Ga0501082_0023699 3300060353 Bacteria 5293
295 Ga0466962_0129701 3300061719 Bacteria 1218
296 Ga0530510_0102842 3300061734 Bacteria 2089
297 Ga0496115_0000475
298 JGI25407J50210_10014790
299 Ga0070676_10287488
300 Ga0070683_100017677
301 Ga0070690_100019258
302 Ga0070666_10141359
303 Ga0070682_100005699
304 Ga0070682_100076876
305 Ga0068868_100022331
306 Ga0068868_100052517
307 Ga0070692_10039083
308 Ga0070674_100079905
309 Ga0070674_100213065
310 Ga0070674_100382146
311 Ga0070688_100164156
312 Ga0070703_10010885
313 Ga0070713_100125458
314 Ga0070713_100147773
315 Ga0070710_10197202
316 Ga0070701_10034841
317 Ga0070711_100015780
318 Ga0070711_100028325
319 Ga0070711_100192933
320 Ga0070700_100020637
321 Ga0070700_100028729
322 Ga0070663_100026969
323 Ga0070662_100048797
324 Ga0070662_100319020
325 Ga0068867_100031453
326 Ga0070685_10010153
327 Ga0070685_10045715
328 Ga0070706_100130488
329 Ga0070699_100250881
330 Ga0070684_100061090
331 Ga0070684_100202183
332 Ga0070686_100055620
333 Ga0070665_100530031
334 Ga0070704_100036252
335 Ga0070704_100114867
336 Ga0070664_100045850
337 Ga0068856_100045786
338 Ga0070702_100042763
339 Ga0068852_100064869
340 Ga0068864_100047397
341 Ga0068864_100106645
342 Ga0068864_100168334
343 Ga0068864_100169208
344 Ga0068861_100091143
345 Ga0068863_100489119
346 Ga0068860_100161090
347 Ga0081538_10031801
348 Ga0081538_10038340
349 Ga0081538_10066269
350 Ga0081540_1004948
351 Ga0081539_10015574
352 Ga0070717_10003877
353 Ga0070717_10033094
354 Ga0075364_10034161
355 Ga0070712_100026791
356 Ga0075430_100021958
357 Ga0075433_10144487
358 Ga0075434_100102307
359 Ga0068865_100011147
360 Ga0068865_100022933
361 Ga0068865_100100938
362 Ga0075436_100076768
363 Ga0075435_100036162
364 Ga0105240_10073648
365 Ga0111539_10024544
366 Ga0111539_10176392
367 Ga0105245_10061617
368 Ga0105245_10078431
369 Ga0105245_10150536
370 Ga0114129_10308368
371 Ga0114129_10471504
372 Ga0105243_10099431
373 Ga0105243_10438475
374 Ga0105248_10526848
375 Ga0105237_10004667
376 Ga0105237_10127764
377 Ga0105249_10072816
378 Ga0105249_10346099
379 Ga0105239_10067397
380 Ga0105239_10139248
381 Ga0105246_10020948
382 Ga0157371_10109048
383 Ga0157369_10255354
384 Ga0157374_10015900
385 Ga0163162_10179939
386 Ga0163162_10315243
387 Ga0157372_10208310
388 Ga0157372_10279726
389 Ga0157372_10532027
390 Ga0157375_10147115
391 Ga0157380_10125053
392 Ga0157380_10258509
393 Ga0157377_10002989
394 Ga0157379_10007974
395 Ga0157379_10105339
396 Ga0157379_10206625
397 Ga0157376_10143251
398 Ga0206352_10304464
399 Ga0213876_10008816
400 Ga0207656_10024200
401 Ga0207692_10089939
402 Ga0207692_10139929
403 Ga0207642_10035151
404 Ga0207642_10036221
405 Ga0207642_10094964
406 Ga0207688_10124086
407 Ga0207643_10007462
408 Ga0207654_10061172
409 Ga0207695_10020035
410 Ga0207695_10243681
411 Ga0207671_10002112
412 Ga0207693_10008120
413 Ga0207693_10032718
414 Ga0207663_10050232
415 Ga0207662_10050993
416 Ga0207662_10116212
417 Ga0207657_10082040
418 Ga0207657_10154645
419 Ga0207657_10292114
420 Ga0207681_10112062
421 Ga0207650_10190128
422 Ga0207687_10098982
423 Ga0207687_10300030
424 Ga0207700_10049223
425 Ga0207706_10099351
426 Ga0207706_10187544
427 Ga0207709_10061556
428 Ga0207669_10294688
429 Ga0207704_10018558
430 Ga0207704_10165476
431 Ga0207711_10096852
432 Ga0207711_10139887
433 Ga0207689_10132210
434 Ga0207679_10169448
435 Ga0207712_10035271
436 Ga0207668_10085006
437 Ga0207640_10040603
438 Ga0207677_10178480
439 Ga0207678_10033283
440 Ga0207708_10000206
441 Ga0207708_10051772
442 Ga0207641_10335145
443 Ga0207648_10041337
444 Ga0207676_10063225
445 Ga0207674_10095100
446 Ga0207674_10247244
447 Ga0207675_100169896
448 Ga0207675_100267775
449 Ga0207675_100364686
450 Ga0207683_10061617
451 Ga0207698_10196071
452 Ga0207698_10358745
453 Ga0207428_10025466
454 Ga0265337_1006945
455 Ga0265326_10000818
456 Ga0265319_1000670
457 Ga0265318_10002609
458 Ga0265336_10000002
459 Ga0265338_10000001
460 Ga0265338_10027697
461 Ga0265324_10004220
462 Ga0265340_10000001
463 Ga0265327_10002631
464 Ga0265316_10049704
465 Ga0307416_100086617
466 Ga0307416_100087185
467 Ga0373939_0082876
468 Ga0316574_0033240
469 Ga0395900_0108038
470 Ga0395898_0048469
471 Ga0395898_0052141
472 Ga0395898_0533867
473 Ga0436364_0501062
474 Ga0436364_1424608
475 Ga0395901_0028916
476 Ga0395901_0244195
477 Ga0395901_0465127
478 Ga0436365_0320762
479 Ga0466966_0084576
480 Ga0466963_0010553
481 Ga0466968_0052841
482 Ga0466960_0000134
483 Ga0466958_0142485
484 Ga0466967_0047866
485 Ga0466967_0091808
486 Ga0495653_0000334
487 Ga0495580_0174563
488 Ga0495664_0000007
489 Ga0495584_0024674
490 Ga0495618_0000760
491 Ga0495630_0001650
492 Ga0495642_0091844
493 Ga0495652_0140089
494 Ga0495645_0000055
495 Ga0495645_0001137
496 Ga0495588_0131046
497 Ga0495657_0000013
498 Ga0495600_0063817
499 Ga0495581_0100353
500 Ga0496100_0003717
501 Ga0496100_0004277
502 Ga0496100_0152491
503 Ga0496101_0012600
504 Ga0496101_0067590
505 Ga0496101_0196240
506 Ga0496102_0000002
507 Ga0496102_0064934
508 Ga0496102_0080716
509 Ga0496102_0158191
510 Ga0496102_0160939
511 Ga0496102_0232289
512 Ga0496103_0000017
513 Ga0496103_0045360
514 Ga0496103_0141814
515 Ga0496104_0000001
516 Ga0496104_0023983
517 Ga0496104_0042579
518 Ga0496104_0130665
519 Ga0496104_0355639
520 Ga0496105_0005467
521 Ga0496105_0079315
522 Ga0496105_0279686
523 Ga0496106_0012115
524 Ga0496106_0110031
525 Ga0496106_0194912
526 Ga0496106_0213004
527 Ga0496107_0044203
528 Ga0496107_0053496
529 Ga0496107_0257980
530 Ga0496108_0002835
531 Ga0496108_0059572
532 Ga0496108_0060166
533 Ga0496108_0288981
534 Ga0496109_0002835
535 Ga0496109_0095080
536 Ga0496109_0140272
537 Ga0496110_0000248
538 Ga0496110_0000684
539 Ga0496110_0091388
540 Ga0496111_0000021
541 Ga0496111_0006566
542 Ga0496111_0070979
543 Ga0496111_0079346
544 Ga0496111_0087306
545 Ga0496112_0000411
546 Ga0496112_0004469
547 Ga0496112_0090852
548 Ga0496113_0079078
549 Ga0496113_0159046
550 Ga0496113_0183959
551 Ga0496113_0268526
552 Ga0496114_0108466
553 Ga0496114_0112039
554 Ga0496114_0217489
555 Ga0496114_0461485
556 Ga0496115_0001207
557 Ga0496115_0067991
558 Ga0496115_0232229
559 Ga0496115_0234052
560 Ga0496121_0005914
561 Ga0496121_0049959
562 Ga0501036_0075229
563 Ga0501040_0049257
564 Ga0501042_0010955
565 Ga0501042_0015259
566 Ga0501046_0126817
567 Ga0501048_0180292
568 Ga0501072_0227701
569 Ga0501075_0052467
570 Ga0501075_0139226
571 Ga0501076_0024066
572 Ga0501076_0089539
573 Ga0501076_0207516
574 Ga0501077_0115103
575 Ga0501081_0037150
576 Ga0501045_0105340
577 nmdc:mga00v17_79076_c1
578 nmdc:mga05p37_601685_c1
579 nmdc:mga0qj67_19939_c1
580 nmdc:mga0rr50_135221_c1
581 nmdc:mga0a205_14439_c1
582 nmdc:mga0a205_153514_c1
583 Ga0495601_0001509
584 Ga0495601_0006662
585 Ga0495612_0000029
586 Ga0500641_0061373
587 Ga0500616_0004409
588 Ga0501084_0068063
589 Ga0501084_0156163
590 Ga0501082_0023699
591 Ga0466962_0129701
592 Ga0530510_0102842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07136

DUF1385

Protein of unknown function (DUF1385)

123

373

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7enc-assembly1.cif.gz_p tfiid-based pic-mediator holo-complex in fully-assembled state (hpic-med) 0.8329 22 50
2fja-assembly1.cif.gz_D adenosine 5'-phosphosulfate reductase in complex with substrate 0.7589 15 51
8h0n-assembly1.cif.gz_A crystal structure of the human mettl1-wdr4 complex 0.7334 13 48
3gyx-assembly6.cif.gz_L crystal structure of adenylylsulfate reductase from desulfovibrio gigas 0.7082 20 51
7u20-assembly1.cif.gz_B crystal structure of human mettl1 and wdr4 complex 0.6921 12 54
ID Description Score Start End Superfamily
af_Q54VE6_6_119_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8675 21 48 3.30.450.30
1jnrB02 Special;Other non-globular;Signal recognition particle alu RNA binding heterodimer, srp9/1;Adenylylsulphate reductase, beta subunit, C-terminal domain 0.7579 15 51 6.20.260.10
3gyxB02 Special;Other non-globular;Signal recognition particle alu RNA binding heterodimer, srp9/1;Adenylylsulphate reductase, beta subunit, C-terminal domain 0.7541 15 51 6.20.260.10
af_Q3UKK2_274_392_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.751 29 49 2.60.40.10
af_Q4DB22_67_348_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.75 22 51 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1Q7WYG1-F1-model_v4 Metal-dependent enzyme 0.9847 8 298 GO:0016020
AF-A0A842UB63-F1-model_v4 DUF1385 domain-containing protein 0.9778 14 292 GO:0016020
AF-A0A419GXF3-F1-model_v4 DUF1385 domain-containing protein 0.9773 24 295 GO:0016020
AF-A0A2J6GYS6-F1-model_v4 DUF1385 domain-containing protein 0.9714 14 294 GO:0016020
AF-A0A7V8YMM8-F1-model_v4 DUF1385 domain-containing protein 0.9702 15 294 GO:0016020

Map