F393541

General Info

Members Datasets Scaffolds Average Seq Length
297 186 295 173

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100615903|Ga0070683_1006159032
Length 188
Sequence VGKYPRGGQFAVTEGAAELAPVTPSLDERDRATVAAQLGRSPRAIRAVAHRCPCGLPDVIESSPRLPDGTPFPTLYYLTCPRASAAIGRLEALGLMAEMTDRLSSDPRLADRYRTAHESYLRHRERLGHVAEIAGTSAGGMPRRVKCLHALVAHSLAAGRGVNPLGDEALDRLAPWWTSGPCVPAAAN

Samples

Sample ID Description Type Environment
1 2643221549 Agromyces sp. Root1464 Isolate Unclassified
2 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
154 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
155 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
186 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0.34
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 0.34
Rhizosphere 91.92
Stem 0
Stem Tuber 0
Unclassified 5.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10042288 3300003320 Bacteria 1674
2 JGI25407J50210_10023362 3300003373 Bacteria 1605
3 Ga0070658_10019955 3300005327 Bacteria 5369
4 Ga0070658_10030013 3300005327 Bacteria 4369
5 Ga0070683_100615903 3300005329 Bacteria 1039
6 Ga0070683_100762373 3300005329 Bacteria 927
7 Ga0070683_100893461 3300005329 Bacteria 852
8 Ga0070690_100321534 3300005330 Bacteria 1115
9 Ga0068869_100101202 3300005334 Bacteria 2180
10 Ga0070682_100113383 3300005337 Bacteria 1810
11 Ga0068868_100147718 3300005338 Bacteria 1934
12 Ga0068868_100227265 3300005338 Bacteria 1564
13 Ga0070660_100127470 3300005339 Bacteria 2034
14 Ga0070689_100061231 3300005340 Bacteria 2927
15 Ga0070692_10003752 3300005345 Bacteria 6244
16 Ga0070668_100010781 3300005347 Bacteria 6796
17 Ga0070669_100078836 3300005353 Bacteria 2449
18 Ga0070671_100046469 3300005355 Bacteria 3610
19 Ga0070671_100402765 3300005355 Bacteria 1170
20 Ga0070674_100040431 3300005356 Bacteria 3155
21 Ga0070673_100200602 3300005364 Bacteria 1718
22 Ga0070659_100002263 3300005366 Bacteria 13712
23 Ga0070659_100030673 3300005366 Bacteria 4161
24 Ga0070667_100202031 3300005367 Bacteria 1764
25 Ga0070709_10058500 3300005434 Bacteria 2444
26 Ga0070713_100281305 3300005436 Bacteria 1526
27 Ga0070713_100662976 3300005436 Bacteria 994
28 Ga0070710_10030635 3300005437 Bacteria 2896
29 Ga0070711_100012330 3300005439 Bacteria 5334
30 Ga0070705_100018612 3300005440 Bacteria 3643
31 Ga0070708_100294818 3300005445 Bacteria 1527
32 Ga0070678_100006112 3300005456 Bacteria 7030
33 Ga0070678_101268473 3300005456 Bacteria 685
34 Ga0070662_100251827 3300005457 Bacteria 1420
35 Ga0070681_10355198 3300005458 Bacteria 1376
36 Ga0070685_10009871 3300005466 Bacteria 4950
37 Ga0070679_100296144 3300005530 Bacteria 1569
38 Ga0068853_100026777 3300005539 Bacteria 4843
39 Ga0068853_100340925 3300005539 Bacteria 1393
40 Ga0070695_100025471 3300005545 Bacteria 3653
41 Ga0070696_100085592 3300005546 Bacteria 2237
42 Ga0070693_100062803 3300005547 Bacteria 2162
43 Ga0070665_100031315 3300005548 Bacteria 5354
44 Ga0070704_100012172 3300005549 Bacteria 5309
45 Ga0068855_100004728 3300005563 Bacteria 16630
46 Ga0068855_100063636 3300005563 Bacteria 4304
47 Ga0068855_100120555 3300005563 Bacteria 3002
48 Ga0068857_100013991 3300005577 Bacteria 6981
49 Ga0068857_100176459 3300005577 Bacteria 1944
50 Ga0068854_100171877 3300005578 Bacteria 1687
51 Ga0068854_100622717 3300005578 Bacteria 924
52 Ga0068856_100066241 3300005614 Bacteria 3569
53 Ga0068856_100129262 3300005614 Bacteria 2530
54 Ga0068856_101428186 3300005614 Bacteria 706
55 Ga0070702_100011756 3300005615 Bacteria 4365
56 Ga0070702_100363498 3300005615 Bacteria 1023
57 Ga0068852_100005155 3300005616 Bacteria 9314
58 Ga0068852_100009144 3300005616 Bacteria 7340
59 Ga0068852_100024306 3300005616 Bacteria 4894
60 Ga0068852_100153185 3300005616 Bacteria 2146
61 Ga0068852_100215858 3300005616 Bacteria 1822
62 Ga0068852_100253792 3300005616 Bacteria 1686
63 Ga0068859_100155399 3300005617 Bacteria 2365
64 Ga0068859_100270934 3300005617 Bacteria 1790
65 Ga0068864_100129901 3300005618 Bacteria 2262
66 Ga0068866_10086712 3300005718 Bacteria 1695
67 Ga0068866_10302321 3300005718 Bacteria 1000
68 Ga0068861_100015420 3300005719 Bacteria 5384
69 Ga0068861_100089537 3300005719 Bacteria 2426
70 Ga0068851_10000043 3300005834 Bacteria 87775
71 Ga0068858_100000229 3300005842 Bacteria 60583
72 Ga0068858_100044997 3300005842 Bacteria 4090
73 Ga0068860_100053155 3300005843 Bacteria 3852
74 Ga0068862_100063539 3300005844 Bacteria 3176
75 Ga0081455_10001272 3300005937 Bacteria 31484
76 Ga0081455_10002482 3300005937 Bacteria 21928
77 Ga0081455_10034071 3300005937 Bacteria 4567
78 Ga0081455_10075220 3300005937 Bacteria 2787
79 Ga0081455_10077930 3300005937 Unclassified 2725
80 Ga0081455_10219672 3300005937 Bacteria 1409
81 Ga0081538_10000160 3300005981 Bacteria 70950
82 Ga0070717_10325029 3300006028 Bacteria 1371
83 Ga0070717_10325260 3300006028 Bacteria 1370
84 Ga0075432_10000109 3300006058 Bacteria 17845
85 Ga0075432_10001766 3300006058 Bacteria 7117
86 Ga0097621_100063100 3300006237 Bacteria 3044
87 Ga0075428_100001169 3300006844 Bacteria 28087
88 Ga0075428_100547301 3300006844 Bacteria 1237
89 Ga0075428_101376658 3300006844 Bacteria 741
90 Ga0075428_101425811 3300006844 Bacteria 726
91 Ga0075431_100002935 3300006847 Bacteria 16511
92 Ga0075431_101433532 3300006847 Bacteria 650
93 Ga0075433_10001070 3300006852 Bacteria 19665
94 Ga0075433_10004552 3300006852 Bacteria 10814
95 Ga0075433_10006482 3300006852 Bacteria 9253
96 Ga0075434_100014177 3300006871 Bacteria 7615
97 Ga0075434_100036878 3300006871 Bacteria 4837
98 Ga0075429_100031127 3300006880 Bacteria 4638
99 Ga0068865_100074280 3300006881 Bacteria 2421
100 Ga0068865_100152494 3300006881 Bacteria 1754
101 Ga0075436_100014844 3300006914 Bacteria 5338
102 Ga0075436_100537858 3300006914 Bacteria 857
103 Ga0097620_100155394 3300006931 Bacteria 2365
104 Ga0097620_100270929 3300006931 Bacteria 1790
105 Ga0075435_100000540 3300007076 Bacteria 23169
106 Ga0075435_100003913 3300007076 Bacteria 10172
107 Ga0075435_100024811 3300007076 Bacteria 4659
108 Ga0105240_10054210 3300009093 Bacteria 5026
109 Ga0105240_10115022 3300009093 Bacteria 3249
110 Ga0105245_10038296 3300009098 Bacteria 4266
111 Ga0105245_10283224 3300009098 Bacteria 1621
112 Ga0105248_10290811 3300009177 Bacteria 1840
113 Ga0105237_10000164 3300009545 Bacteria 93890
114 Ga0105237_10061346 3300009545 Bacteria 3760
115 Ga0105238_10117366 3300009551 Bacteria 2641
116 Ga0105249_10164660 3300009553 Bacteria 2146
117 Ga0105239_10986729 3300010375 Bacteria 968
118 Ga0157329_1001431 3300012491 Bacteria 1210
119 Ga0157370_10016502 3300013104 Bacteria 7472
120 Ga0157369_10092318 3300013105 Bacteria 3231
121 Ga0157379_10034666 3300014968 Bacteria 4500
122 Ga0206354_11167409 3300020081 Bacteria 1079
123 Ga0209148_1000962 3300025254 Bacteria 18770
124 Ga0207656_10000001 3300025321 Bacteria 1323684
125 Ga0207656_10000003 3300025321 Bacteria 771644
126 Ga0207656_10000004 3300025321 Bacteria 632320
127 Ga0207692_10272993 3300025898 Bacteria 1020
128 Ga0207642_10015400 3300025899 Bacteria 2848
129 Ga0207688_10057781 3300025901 Bacteria 2182
130 Ga0207647_10051538 3300025904 Bacteria 2543
131 Ga0207705_10074849 3300025909 Bacteria 2458
132 Ga0207705_10100362 3300025909 Bacteria 2129
133 Ga0207654_10000003 3300025911 Bacteria 1030378
134 Ga0207707_10298370 3300025912 Bacteria 1394
135 Ga0207695_10004783 3300025913 Bacteria 18318
136 Ga0207695_10071196 3300025913 Bacteria 3552
137 Ga0207695_10388460 3300025913 Bacteria 1281
138 Ga0207671_10000001 3300025914 Bacteria 1318881
139 Ga0207671_10018435 3300025914 Bacteria 5355
140 Ga0207671_10047687 3300025914 Bacteria 3171
141 Ga0207693_10001768 3300025915 Bacteria 18954
142 Ga0207663_10097133 3300025916 Bacteria 1969
143 Ga0207657_10023858 3300025919 Bacteria 5683
144 Ga0207657_10042950 3300025919 Bacteria 3986
145 Ga0207652_10045384 3300025921 Bacteria 3747
146 Ga0207652_10276882 3300025921 Bacteria 1514
147 Ga0207681_10052263 3300025923 Bacteria 2771
148 Ga0207694_10000148 3300025924 Bacteria 72467
149 Ga0207694_10143897 3300025924 Bacteria 1918
150 Ga0207659_10580277 3300025926 Bacteria 955
151 Ga0207687_10032489 3300025927 Bacteria 3535
152 Ga0207687_10116285 3300025927 Bacteria 1993
153 Ga0207687_10311167 3300025927 Bacteria 1272
154 Ga0207687_10412005 3300025927 Bacteria 1114
155 Ga0207700_10334441 3300025928 Bacteria 1315
156 Ga0207644_10257499 3300025931 Bacteria 1394
157 Ga0207690_10000776 3300025932 Bacteria 20682
158 Ga0207690_10145361 3300025932 Bacteria 1752
159 Ga0207706_10113395 3300025933 Bacteria 2385
160 Ga0207706_10173698 3300025933 Bacteria 1893
161 Ga0207709_10014107 3300025935 Bacteria 4411
162 Ga0207709_10500964 3300025935 Unclassified 948
163 Ga0207704_10011059 3300025938 Bacteria 4429
164 Ga0207704_10270306 3300025938 Bacteria 1287
165 Ga0207665_10001799 3300025939 Bacteria 14440
166 Ga0207691_10088620 3300025940 Bacteria 2775
167 Ga0207711_10067346 3300025941 Bacteria 3099
168 Ga0207711_10173457 3300025941 Bacteria 1958
169 Ga0207711_10329833 3300025941 Bacteria 1411
170 Ga0207689_10106888 3300025942 Bacteria 2299
171 Ga0207679_10866983 3300025945 Bacteria 825
172 Ga0207667_10002739 3300025949 Bacteria 21787
173 Ga0207667_10002791 3300025949 Bacteria 21636
174 Ga0207667_10236619 3300025949 Bacteria 1869
175 Ga0207667_10392917 3300025949 Bacteria 1412
176 Ga0207712_10303181 3300025961 Bacteria 1312
177 Ga0207640_10205670 3300025981 Bacteria 1495
178 Ga0207640_10884414 3300025981 Bacteria 779
179 Ga0207658_10401660 3300025986 Bacteria 1205
180 Ga0207677_10026086 3300026023 Bacteria 3659
181 Ga0207677_10060832 3300026023 Bacteria 2612
182 Ga0207703_10000308 3300026035 Bacteria 53266
183 Ga0207703_10161236 3300026035 Bacteria 1964
184 Ga0207639_10003822 3300026041 Bacteria 10145
185 Ga0207678_10284419 3300026067 Bacteria 1420
186 Ga0207708_10071287 3300026075 Bacteria 2661
187 Ga0207702_10040836 3300026078 Bacteria 3889
188 Ga0207702_10477615 3300026078 Bacteria 1213
189 Ga0207648_10265689 3300026089 Bacteria 1532
190 Ga0207676_10308591 3300026095 Bacteria 1447
191 Ga0207674_10020786 3300026116 Bacteria 7084
192 Ga0207674_10154785 3300026116 Bacteria 2248
193 Ga0207675_100010037 3300026118 Bacteria 8876
194 Ga0207675_100039337 3300026118 Bacteria 4414
195 Ga0207683_10001907 3300026121 Bacteria 18449
196 Ga0207698_10001313 3300026142 Bacteria 14490
197 Ga0207698_10006931 3300026142 Bacteria 7092
198 Ga0207698_10108229 3300026142 Bacteria 2323
199 Ga0207428_10000468 3300027907 Bacteria 48737
200 Ga0207428_10002915 3300027907 Bacteria 16946
201 Ga0207428_10469761 3300027907 Bacteria 916
202 Ga0268265_10133122 3300028380 Bacteria 2070
203 Ga0268264_10040113 3300028381 Bacteria 3868
204 Ga0268264_10313956 3300028381 Bacteria 1480
205 Ga0307509_10438969 3300031507 Bacteria 1002
206 Ga0307408_100000788 3300031548 Bacteria 25461
207 Ga0307408_100233620 3300031548 Bacteria 1507
208 Ga0316576_10329352 3300031727 Bacteria 1138
209 Ga0316578_10018887 3300031728 Bacteria 3786
210 Ga0307405_10162285 3300031731 Bacteria 1584
211 Ga0307405_10183000 3300031731 Bacteria 1506
212 Ga0307413_10017880 3300031824 Bacteria 3704
213 Ga0307413_10031252 3300031824 Bacteria 3002
214 Ga0307413_10174486 3300031824 Bacteria 1525
215 Ga0307410_10000723 3300031852 Bacteria 13800
216 Ga0307410_10002273 3300031852 Bacteria 9207
217 Ga0307406_10002207 3300031901 Bacteria 10596
218 Ga0307406_10176747 3300031901 Bacteria 1550
219 Ga0307406_10206415 3300031901 Bacteria 1450
220 Ga0307407_10005103 3300031903 Bacteria 5660
221 Ga0307407_10038292 3300031903 Bacteria 2656
222 Ga0307407_10119281 3300031903 Unclassified 1669
223 Ga0307407_10174619 3300031903 Bacteria 1418
224 Ga0307412_10824720 3300031911 Bacteria 807
225 Ga0307409_100000343 3300031995 Bacteria 19292
226 Ga0307409_100206865 3300031995 Bacteria 1760
227 Ga0307409_100843814 3300031995 Bacteria 926
228 Ga0307409_100859343 3300031995 Bacteria 918
229 Ga0307409_101014097 3300031995 Bacteria 848
230 Ga0307416_100000067 3300032002 Bacteria 86975
231 Ga0307416_100172513 3300032002 Bacteria 2015
232 Ga0307416_100359477 3300032002 Bacteria 1477
233 Ga0307416_101319117 3300032002 Bacteria 827
234 Ga0307414_10006201 3300032004 Bacteria 6648
235 Ga0307414_10009323 3300032004 Bacteria 5632
236 Ga0307414_10245290 3300032004 Bacteria 1485
237 Ga0307411_10004247 3300032005 Bacteria 6823
238 Ga0307411_10028457 3300032005 Bacteria 3398
239 Ga0307411_10047185 3300032005 Bacteria 2783
240 Ga0307411_10081526 3300032005 Bacteria 2228
241 Ga0307415_100000692 3300032126 Bacteria 14983
242 Ga0307415_100055932 3300032126 Bacteria 2702
243 Ga0307415_100229652 3300032126 Bacteria 1493
244 Ga0316585_10052655 3300032137 Bacteria 1308
245 Ga0373941_0378825 3300035115 Bacteria 581
246 Ga0316574_0012304 3300035398 Bacteria 4892
247 Ga0373931_0073069 3300035691 Bacteria 1877
248 Ga0316582_0201245 3300036647 Bacteria 1359
249 Ga0316584_0002099 3300036712 Bacteria 12483
250 Ga0395899_0257469 3300037312 Bacteria 1195
251 Ga0395900_0086314 3300037418 Bacteria 3225
252 Ga0395898_0060515 3300037466 Bacteria 3680
253 Ga0436364_1233723 3300037853 Bacteria 2765
254 Ga0395901_0309131 3300038443 Bacteria 1637
255 Ga0400485_04416 3300038735 Bacteria 6522
256 Ga0400488_32990 3300038741 Bacteria 4804
257 Ga0400486_29215 3300038742 Bacteria 140932
258 Ga0436363_0111212 3300039450 Bacteria 652
259 Ga0436363_0398281 3300039450 Bacteria 567
260 Ga0451577_0265376 3300042876 Bacteria 1554
261 Ga0439440_0223065 3300042993 Bacteria 566
262 Ga0466961_0176513 3300044693 Bacteria 1327
263 Ga0466971_0065554 3300044719 Bacteria 1645
264 Ga0466957_0940526 3300044842 Bacteria 619
265 Ga0466967_0083519 3300045976 Bacteria 2888
266 Ga0466967_0332665 3300045976 Bacteria 1467
267 Ga0495641_0371498 3300046461 Bacteria 648
268 Ga0495620_0144351 3300046515 Bacteria 930
269 Ga0496110_1548255 3300048913 Bacteria 573
270 Ga0496117_0074757 3300048920 Bacteria 2254
271 Ga0496118_0009551 3300048921 Bacteria 9768
272 Ga0496119_0001631 3300048922 Bacteria 26493
273 Ga0496120_0000484 3300048923 Bacteria 62327
274 Ga0496120_0014287 3300048923 Bacteria 5299
275 Ga0496121_0000098 3300048924 Bacteria 200516
276 Ga0501031_0337117 3300049568 Bacteria 976
277 Ga0501032_0635144 3300049569 Bacteria 678
278 Ga0501034_0336827 3300049571 Bacteria 1439
279 Ga0501038_0298342 3300049574 Bacteria 1265
280 Ga0501047_0015150 3300049581 Bacteria 7341
281 Ga0501069_0281615 3300049585 Unclassified 973
282 Ga0501070_0149715 3300049586 Bacteria 1926
283 Ga0501070_0156561 3300049586 Bacteria 1879
284 Ga0501070_0652361 3300049586 Bacteria 835
285 Ga0501074_0185931 3300049590 Bacteria 1482
286 Ga0501035_0018215 3300049822 Bacteria 6468
287 Ga0501044_0002221 3300049823 Bacteria 22261
288 Ga0501045_0488293 3300049824 Bacteria 915
289 Ga0500651_0006699 3300053093 Bacteria 6667
290 Ga0500559_0110894 3300053136 Bacteria 1271
291 Ga0500568_0201109 3300053139 Bacteria 730
292 Ga0500573_0060163 3300053140 Bacteria 2176
293 Ga0500573_0109213 3300053140 Bacteria 1549
294 Ga0500573_0215311 3300053140 Bacteria 1011
295 Ga0500620_000122 3300053155 Bacteria 15500

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025921 Ga0207652_10045384 Ga0207652_100453843 134
2 3300049586 Ga0501070_0149715 Ga0501070_0149715_1433_1876 134
3 3300049569 Ga0501032_0635144 Ga0501032_0635144_22_471 139
4 3300037853 Ga0436364_1233723 Ga0436364_1233723_1349_1849 145
5 3300039450 Ga0436363_0398281 Ga0436363_0398281_38_538 146
6 3300039450 Ga0436363_0111212 Ga0436363_0111212_38_538 147
7 3300005615 Ga0070702_100363498 Ga0070702_1003634981 150
8 3300053140 Ga0500573_0109213 Ga0500573_0109213_991_1515 150
9 3300005436 Ga0070713_100662976 Ga0070713_1006629762 154
10 3300006028 Ga0070717_10325029 Ga0070717_103250292 154
11 iso_pu_bacteria 2731639228 2731909248 154
12 3300005457 Ga0070662_100251827 Ga0070662_1002518272 155
13 3300005718 Ga0068866_10302321 Ga0068866_103023212 155
14 3300005719 Ga0068861_100089537 Ga0068861_1000895371 155
15 3300005937 Ga0081455_10001272 Ga0081455_1000127223 155
16 3300005937 Ga0081455_10002482 Ga0081455_100024822 155
17 3300005937 Ga0081455_10219672 Ga0081455_102196722 155
18 3300006058 Ga0075432_10000109 Ga0075432_1000010914 155
19 3300006844 Ga0075428_100001169 Ga0075428_10000116913 155
20 3300006847 Ga0075431_100002935 Ga0075431_10000293513 155
21 3300006847 Ga0075431_101433532 Ga0075431_1014335322 155
22 3300006852 Ga0075433_10001070 Ga0075433_100010702 155
23 3300006871 Ga0075434_100036878 Ga0075434_1000368782 155
24 3300006880 Ga0075429_100031127 Ga0075429_1000311272 155
25 3300006881 Ga0068865_100074280 Ga0068865_1000742802 155
26 3300006914 Ga0075436_100537858 Ga0075436_1005378582 155
27 3300007076 Ga0075435_100000540 Ga0075435_10000054016 155
28 3300009553 Ga0105249_10164660 Ga0105249_101646603 155
29 3300012491 Ga0157329_1001431 Ga0157329_10014312 155
30 3300025901 Ga0207688_10057781 Ga0207688_100577812 155
31 3300025927 Ga0207687_10311167 Ga0207687_103111672 155
32 3300025933 Ga0207706_10173698 Ga0207706_101736982 155
33 3300025935 Ga0207709_10500964 Ga0207709_105009641 155
34 3300025938 Ga0207704_10011059 Ga0207704_100110595 155
35 3300025961 Ga0207712_10303181 Ga0207712_103031812 155
36 3300026118 Ga0207675_100039337 Ga0207675_1000393372 155
37 3300027907 Ga0207428_10002915 Ga0207428_1000291513 155
38 3300028381 Ga0268264_10313956 Ga0268264_103139562 155
39 3300031548 Ga0307408_100000788 Ga0307408_10000078821 155
40 3300031731 Ga0307405_10183000 Ga0307405_101830002 155
41 3300031824 Ga0307413_10031252 Ga0307413_100312522 155
42 3300031852 Ga0307410_10000723 Ga0307410_1000072313 155
43 3300031901 Ga0307406_10206415 Ga0307406_102064152 155
44 3300031903 Ga0307407_10119281 Ga0307407_101192812 155
45 3300031995 Ga0307409_100859343 Ga0307409_1008593432 155
46 3300032005 Ga0307411_10047185 Ga0307411_100471851 155
47 3300032005 Ga0307411_10081526 Ga0307411_100815262 155
48 3300035115 Ga0373941_0378825 Ga0373941_0378825_23_508 155
49 3300035691 Ga0373931_0073069 Ga0373931_0073069_596_1081 155
50 3300042993 Ga0439440_0223065 Ga0439440_0223065_21_506 155
51 3300046515 Ga0495620_0144351 Ga0495620_0144351_257_742 155
52 3300049824 Ga0501045_0488293 Ga0501045_0488293_395_877 155
53 3300044842 Ga0466957_0940526 Ga0466957_0940526_46_528 156
54 3300005329 Ga0070683_100762373 Ga0070683_1007623732 157
55 3300005530 Ga0070679_100296144 Ga0070679_1002961442 157
56 3300005563 Ga0068855_100120555 Ga0068855_1001205553 157
57 3300005616 Ga0068852_100153185 Ga0068852_1001531852 157
58 3300009093 Ga0105240_10054210 Ga0105240_100542104 157
59 3300013104 Ga0157370_10016502 Ga0157370_100165023 157
60 3300013105 Ga0157369_10092318 Ga0157369_100923183 157
61 3300020081 Ga0206354_11167409 Ga0206354_111674092 157
62 3300025909 Ga0207705_10100362 Ga0207705_101003622 157
63 3300025913 Ga0207695_10388460 Ga0207695_103884602 157
64 3300025919 Ga0207657_10042950 Ga0207657_100429504 157
65 3300025921 Ga0207652_10276882 Ga0207652_102768822 157
66 3300025949 Ga0207667_10236619 Ga0207667_102366192 157
67 3300026142 Ga0207698_10108229 Ga0207698_101082293 157
68 3300037312 Ga0395899_0257469 Ga0395899_0257469_76_579 157
69 3300037418 Ga0395900_0086314 Ga0395900_0086314_2108_2611 157
70 3300037466 Ga0395898_0060515 Ga0395898_0060515_1232_1735 157
71 3300038443 Ga0395901_0309131 Ga0395901_0309131_432_935 157
72 3300044693 Ga0466961_0176513 Ga0466961_0176513_699_1187 157
73 3300049586 Ga0501070_0652361 Ga0501070_0652361_130_657 157
74 3300049590 Ga0501074_0185931 Ga0501074_0185931_743_1270 157
75 3300005937 Ga0081455_10034071 Ga0081455_100340713 158
76 3300042876 Ga0451577_0265376 Ga0451577_0265376_503_1006 158
77 3300045976 Ga0466967_0332665 Ga0466967_0332665_864_1352 158
78 3300003373 JGI25407J50210_10023362 JGI25407J50210_100233622 159
79 3300005456 Ga0070678_101268473 Ga0070678_1012684731 159
80 3300005616 Ga0068852_100253792 Ga0068852_1002537922 159
81 3300005937 Ga0081455_10075220 Ga0081455_100752201 159
82 3300005937 Ga0081455_10077930 Ga0081455_100779304 159
83 3300005981 Ga0081538_10000160 Ga0081538_1000016031 159
84 3300006058 Ga0075432_10001766 Ga0075432_100017664 159
85 3300006844 Ga0075428_100547301 Ga0075428_1005473012 159
86 3300006844 Ga0075428_101376658 Ga0075428_1013766582 159
87 3300006844 Ga0075428_101425811 Ga0075428_1014258112 159
88 3300006852 Ga0075433_10004552 Ga0075433_100045529 159
89 3300006914 Ga0075436_100014844 Ga0075436_1000148442 159
90 3300007076 Ga0075435_100024811 Ga0075435_1000248114 159
91 3300026089 Ga0207648_10265689 Ga0207648_102656893 159
92 3300027907 Ga0207428_10000468 Ga0207428_100004685 159
93 3300031548 Ga0307408_100233620 Ga0307408_1002336202 159
94 3300031731 Ga0307405_10162285 Ga0307405_101622852 159
95 3300031824 Ga0307413_10017880 Ga0307413_100178802 159
96 3300031824 Ga0307413_10174486 Ga0307413_101744862 159
97 3300031852 Ga0307410_10002273 Ga0307410_100022734 159
98 3300031901 Ga0307406_10002207 Ga0307406_100022079 159
99 3300031901 Ga0307406_10176747 Ga0307406_101767472 159
100 3300031903 Ga0307407_10005103 Ga0307407_100051037 159
101 3300031903 Ga0307407_10038292 Ga0307407_100382923 159
102 3300031903 Ga0307407_10174619 Ga0307407_101746192 159
103 3300031911 Ga0307412_10824720 Ga0307412_108247202 159
104 3300031995 Ga0307409_100000343 Ga0307409_1000003434 159
105 3300031995 Ga0307409_100206865 Ga0307409_1002068652 159
106 3300031995 Ga0307409_100843814 Ga0307409_1008438142 159
107 3300031995 Ga0307409_101014097 Ga0307409_1010140972 159
108 3300032002 Ga0307416_100000067 Ga0307416_10000006793 159
109 3300032002 Ga0307416_100172513 Ga0307416_1001725132 159
110 3300032002 Ga0307416_100359477 Ga0307416_1003594772 159
111 3300032002 Ga0307416_101319117 Ga0307416_1013191172 159
112 3300032004 Ga0307414_10006201 Ga0307414_100062017 159
113 3300032004 Ga0307414_10009323 Ga0307414_100093235 159
114 3300032004 Ga0307414_10245290 Ga0307414_102452902 159
115 3300032005 Ga0307411_10004247 Ga0307411_100042472 159
116 3300032005 Ga0307411_10028457 Ga0307411_100284572 159
117 3300032126 Ga0307415_100000692 Ga0307415_10000069212 159
118 3300032126 Ga0307415_100055932 Ga0307415_1000559324 159
119 3300032126 Ga0307415_100229652 Ga0307415_1002296522 159
120 3300046461 Ga0495641_0371498 Ga0495641_0371498_105_602 159
121 3300048913 Ga0496110_1548255 Ga0496110_1548255_26_538 159
122 3300049585 Ga0501069_0281615 Ga0501069_0281615_166_663 159
123 3300049586 Ga0501070_0156561 Ga0501070_0156561_334_843 159
124 3300053139 Ga0500568_0201109 Ga0500568_0201109_53_544 159
125 3300038735 Ga0400485_04416 Ga0400485_04416_5230_5766 160
126 3300038741 Ga0400488_32990 Ga0400488_32990_488_1048 160
127 3300038742 Ga0400486_29215 Ga0400486_29215_104188_104724 160
128 3300045976 Ga0466967_0083519 Ga0466967_0083519_419_919 160
129 3300031727 Ga0316576_10329352 Ga0316576_103293522 161
130 3300031728 Ga0316578_10018887 Ga0316578_100188874 161
131 3300032137 Ga0316585_10052655 Ga0316585_100526552 161
132 3300035398 Ga0316574_0012304 Ga0316574_0012304_82_612 161
133 3300036647 Ga0316582_0201245 Ga0316582_0201245_666_1196 161
134 3300036712 Ga0316584_0002099 Ga0316584_0002099_1752_2282 161
135 3300005329 Ga0070683_100893461 Ga0070683_1008934612 162
136 3300009098 Ga0105245_10283224 Ga0105245_102832242 162
137 3300005329 Ga0070683_100615903 Ga0070683_1006159032 163
138 3300005330 Ga0070690_100321534 Ga0070690_1003215343 163
139 3300005334 Ga0068869_100101202 Ga0068869_1001012022 163
140 3300005337 Ga0070682_100113383 Ga0070682_1001133832 163
141 3300005338 Ga0068868_100227265 Ga0068868_1002272652 163
142 3300005340 Ga0070689_100061231 Ga0070689_1000612313 163
143 3300005345 Ga0070692_10003752 Ga0070692_100037527 163
144 3300005347 Ga0070668_100010781 Ga0070668_1000107818 163
145 3300005353 Ga0070669_100078836 Ga0070669_1000788362 163
146 3300005355 Ga0070671_100402765 Ga0070671_1004027652 163
147 3300005356 Ga0070674_100040431 Ga0070674_1000404312 163
148 3300005364 Ga0070673_100200602 Ga0070673_1002006023 163
149 3300005366 Ga0070659_100030673 Ga0070659_1000306732 163
150 3300005367 Ga0070667_100202031 Ga0070667_1002020312 163
151 3300005434 Ga0070709_10058500 Ga0070709_100585003 163
152 3300005436 Ga0070713_100281305 Ga0070713_1002813051 163
153 3300005437 Ga0070710_10030635 Ga0070710_100306353 163
154 3300005439 Ga0070711_100012330 Ga0070711_1000123304 163
155 3300005440 Ga0070705_100018612 Ga0070705_1000186122 163
156 3300005445 Ga0070708_100294818 Ga0070708_1002948182 163
157 3300005456 Ga0070678_100006112 Ga0070678_1000061126 163
158 3300005458 Ga0070681_10355198 Ga0070681_103551981 163
159 3300005539 Ga0068853_100340925 Ga0068853_1003409252 163
160 3300005545 Ga0070695_100025471 Ga0070695_1000254712 163
161 3300005546 Ga0070696_100085592 Ga0070696_1000855922 163
162 3300005547 Ga0070693_100062803 Ga0070693_1000628032 163
163 3300005548 Ga0070665_100031315 Ga0070665_1000313153 163
164 3300005549 Ga0070704_100012172 Ga0070704_1000121722 163
165 3300005578 Ga0068854_100171877 Ga0068854_1001718772 163
166 3300005614 Ga0068856_100066241 Ga0068856_1000662415 163
167 3300005615 Ga0070702_100011756 Ga0070702_1000117566 163
168 3300005616 Ga0068852_100005155 Ga0068852_1000051554 163
169 3300005617 Ga0068859_100155399 Ga0068859_1001553993 163
170 3300005718 Ga0068866_10086712 Ga0068866_100867123 163
171 3300005719 Ga0068861_100015420 Ga0068861_1000154206 163
172 3300005842 Ga0068858_100044997 Ga0068858_1000449973 163
173 3300005843 Ga0068860_100053155 Ga0068860_1000531552 163
174 3300005844 Ga0068862_100063539 Ga0068862_1000635392 163
175 3300006028 Ga0070717_10325260 Ga0070717_103252602 163
176 3300006237 Ga0097621_100063100 Ga0097621_1000631005 163
177 3300006852 Ga0075433_10006482 Ga0075433_100064827 163
178 3300006871 Ga0075434_100014177 Ga0075434_1000141772 163
179 3300006881 Ga0068865_100152494 Ga0068865_1001524942 163
180 3300006931 Ga0097620_100155394 Ga0097620_1001553943 163
181 3300007076 Ga0075435_100003913 Ga0075435_1000039137 163
182 3300025898 Ga0207692_10272993 Ga0207692_102729932 163
183 3300025899 Ga0207642_10015400 Ga0207642_100154003 163
184 3300025904 Ga0207647_10051538 Ga0207647_100515383 163
185 3300025912 Ga0207707_10298370 Ga0207707_102983703 163
186 3300025914 Ga0207671_10018435 Ga0207671_100184355 163
187 3300025915 Ga0207693_10001768 Ga0207693_100017686 163
188 3300025916 Ga0207663_10097133 Ga0207663_100971333 163
189 3300025919 Ga0207657_10023858 Ga0207657_100238585 163
190 3300025923 Ga0207681_10052263 Ga0207681_100522633 163
191 3300025924 Ga0207694_10143897 Ga0207694_101438972 163
192 3300025926 Ga0207659_10580277 Ga0207659_105802772 163
193 3300025927 Ga0207687_10412005 Ga0207687_104120052 163
194 3300025928 Ga0207700_10334441 Ga0207700_103344413 163
195 3300025932 Ga0207690_10145361 Ga0207690_101453612 163
196 3300025933 Ga0207706_10113395 Ga0207706_101133952 163
197 3300025935 Ga0207709_10014107 Ga0207709_100141073 163
198 3300025938 Ga0207704_10270306 Ga0207704_102703062 163
199 3300025939 Ga0207665_10001799 Ga0207665_100017996 163
200 3300025940 Ga0207691_10088620 Ga0207691_100886203 163
201 3300025941 Ga0207711_10067346 Ga0207711_100673463 163
202 3300025942 Ga0207689_10106888 Ga0207689_101068882 163
203 3300025945 Ga0207679_10866983 Ga0207679_108669832 163
204 3300025981 Ga0207640_10205670 Ga0207640_102056702 163
205 3300025986 Ga0207658_10401660 Ga0207658_104016602 163
206 3300026023 Ga0207677_10060832 Ga0207677_100608322 163
207 3300026035 Ga0207703_10161236 Ga0207703_101612363 163
208 3300026067 Ga0207678_10284419 Ga0207678_102844192 163
209 3300026075 Ga0207708_10071287 Ga0207708_100712873 163
210 3300026078 Ga0207702_10040836 Ga0207702_100408362 163
211 3300026095 Ga0207676_10308591 Ga0207676_103085912 163
212 3300026118 Ga0207675_100010037 Ga0207675_10001003710 163
213 3300026121 Ga0207683_10001907 Ga0207683_100019078 163
214 3300027907 Ga0207428_10469761 Ga0207428_104697612 163
215 3300028380 Ga0268265_10133122 Ga0268265_101331222 163
216 3300028381 Ga0268264_10040113 Ga0268264_100401134 163
217 3300044719 Ga0466971_0065554 Ga0466971_0065554_708_1223 163
218 iso_pu_bacteria 2643221549 2643769787 163
219 3300053140 Ga0500573_0060163 Ga0500573_0060163_1446_1952 165
220 3300048924 Ga0496121_0000098 Ga0496121_0000098_145730_146332 166
221 3300049568 Ga0501031_0337117 Ga0501031_0337117_38_580 166
222 3300049571 Ga0501034_0336827 Ga0501034_0336827_921_1421 166
223 3300049574 Ga0501038_0298342 Ga0501038_0298342_210_752 166
224 3300049581 Ga0501047_0015150 Ga0501047_0015150_2031_2573 166
225 3300049822 Ga0501035_0018215 Ga0501035_0018215_4550_5092 166
226 3300049823 Ga0501044_0002221 Ga0501044_0002221_19540_20070 166
227 3300003320 rootH2_10042288 rootH2_100422882 171
228 3300005327 Ga0070658_10019955 Ga0070658_100199553 171
229 3300005327 Ga0070658_10030013 Ga0070658_100300134 171
230 3300005338 Ga0068868_100147718 Ga0068868_1001477181 171
231 3300005339 Ga0070660_100127470 Ga0070660_1001274701 171
232 3300005355 Ga0070671_100046469 Ga0070671_1000464693 171
233 3300005366 Ga0070659_100002263 Ga0070659_1000022636 171
234 3300005466 Ga0070685_10009871 Ga0070685_100098712 171
235 3300005539 Ga0068853_100026777 Ga0068853_1000267772 171
236 3300005563 Ga0068855_100004728 Ga0068855_1000047288 171
237 3300005563 Ga0068855_100063636 Ga0068855_1000636364 171
238 3300005577 Ga0068857_100013991 Ga0068857_1000139912 171
239 3300005577 Ga0068857_100176459 Ga0068857_1001764592 171
240 3300005578 Ga0068854_100622717 Ga0068854_1006227172 171
241 3300005614 Ga0068856_100129262 Ga0068856_1001292622 171
242 3300005614 Ga0068856_101428186 Ga0068856_1014281861 171
243 3300005616 Ga0068852_100009144 Ga0068852_1000091443 171
244 3300005616 Ga0068852_100024306 Ga0068852_1000243062 171
245 3300005616 Ga0068852_100215858 Ga0068852_1002158582 171
246 3300005617 Ga0068859_100270934 Ga0068859_1002709342 171
247 3300005618 Ga0068864_100129901 Ga0068864_1001299012 171
248 3300005834 Ga0068851_10000043 Ga0068851_1000004360 171
249 3300005842 Ga0068858_100000229 Ga0068858_10000022947 171
250 3300006931 Ga0097620_100270929 Ga0097620_1002709292 171
251 3300009093 Ga0105240_10115022 Ga0105240_101150224 171
252 3300009098 Ga0105245_10038296 Ga0105245_100382964 171
253 3300009177 Ga0105248_10290811 Ga0105248_102908112 171
254 3300009545 Ga0105237_10000164 Ga0105237_1000016470 171
255 3300009545 Ga0105237_10061346 Ga0105237_100613464 171
256 3300009551 Ga0105238_10117366 Ga0105238_101173662 171
257 3300010375 Ga0105239_10986729 Ga0105239_109867292 171
258 3300014968 Ga0157379_10034666 Ga0157379_100346662 171
259 3300025254 Ga0209148_1000962 Ga0209148_100096210 171
260 3300025321 Ga0207656_10000001 Ga0207656_10000001552 171
261 3300025321 Ga0207656_10000003 Ga0207656_10000003658 171
262 3300025321 Ga0207656_10000004 Ga0207656_10000004515 171
263 3300025909 Ga0207705_10074849 Ga0207705_100748492 171
264 3300025911 Ga0207654_10000003 Ga0207654_10000003842 171
265 3300025913 Ga0207695_10004783 Ga0207695_1000478311 171
266 3300025913 Ga0207695_10071196 Ga0207695_100711963 171
267 3300025914 Ga0207671_10000001 Ga0207671_10000001550 171
268 3300025914 Ga0207671_10047687 Ga0207671_100476873 171
269 3300025924 Ga0207694_10000148 Ga0207694_100001489 171
270 3300025927 Ga0207687_10032489 Ga0207687_100324894 171
271 3300025927 Ga0207687_10116285 Ga0207687_101162852 171
272 3300025931 Ga0207644_10257499 Ga0207644_102574991 171
273 3300025932 Ga0207690_10000776 Ga0207690_100007768 171
274 3300025941 Ga0207711_10173457 Ga0207711_101734573 171
275 3300025941 Ga0207711_10329833 Ga0207711_103298332 171
276 3300025949 Ga0207667_10002739 Ga0207667_1000273911 171
277 3300025949 Ga0207667_10002791 Ga0207667_1000279119 171
278 3300025949 Ga0207667_10392917 Ga0207667_103929172 171
279 3300025981 Ga0207640_10884414 Ga0207640_108844142 171
280 3300026023 Ga0207677_10026086 Ga0207677_100260863 171
281 3300026035 Ga0207703_10000308 Ga0207703_1000030810 171
282 3300026041 Ga0207639_10003822 Ga0207639_100038229 171
283 3300026078 Ga0207702_10477615 Ga0207702_104776152 171
284 3300026116 Ga0207674_10020786 Ga0207674_100207866 171
285 3300026116 Ga0207674_10154785 Ga0207674_101547852 171
286 3300026142 Ga0207698_10001313 Ga0207698_100013132 171
287 3300026142 Ga0207698_10006931 Ga0207698_100069313 171
288 3300031507 Ga0307509_10438969 Ga0307509_104389692 171
289 3300048920 Ga0496117_0074757 Ga0496117_0074757_258_794 171
290 3300048921 Ga0496118_0009551 Ga0496118_0009551_2560_3096 171
291 3300048922 Ga0496119_0001631 Ga0496119_0001631_7246_7782 171
292 3300048923 Ga0496120_0000484 Ga0496120_0000484_20452_20988 171
293 3300048923 Ga0496120_0014287 Ga0496120_0014287_1679_2215 171
294 3300053093 Ga0500651_0006699 Ga0500651_0006699_1338_1874 171
295 3300053136 Ga0500559_0110894 Ga0500559_0110894_53_589 171
296 3300053140 Ga0500573_0215311 Ga0500573_0215311_381_917 171
297 3300053155 Ga0500620_000122 Ga0500620_000122_12109_12645 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04417

DUF501

Protein of unknown function (DUF501)

48

171

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x6o-assembly1.cif.gz_A structural analysis of leishmania braziliensis eukaryotic initiation factor 5a 0.37 26 77
1xtd-assembly1.cif.gz_A structural analysis of leishmania mexicana eukaryotic initiation factor 5a 0.3694 26 77
4y0c-assembly1.cif.gz_B the structure of arabidopsis clpt2 0.3584 65 163
3lgi-assembly1.cif.gz_A structure of the protease domain of degs (degs-deltapdz) at 1.65 a 0.2923 24 77
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.273 65 119
ID Description Score Start End Superfamily
af_Q9H2U1_649_762_1.20.120.1080 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5744 71 100 1.20.120.1080
af_Q5JK54_3_266_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5467 71 112 1.10.510.10
af_P24785_815_973_1.20.120.1080 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5341 71 100 1.20.120.1080
af_Q8SWT2_587_700_1.20.120.1080 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5293 74 100 1.20.120.1080
af_Q9SVD4_135_350_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5163 86 105 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A3A3ZML8-F1-model_v4 DUF501 domain-containing protein 0.9848 18 160
AF-A0A6L6XTS8-F1-model_v4 DUF501 domain-containing protein 0.9824 10 158
AF-A0A2G6HC19-F1-model_v4 Septum formation initiator family protein 0.9816 17 158
AF-A0A4R2IVI0-F1-model_v4 Septum formation initiator family protein 0.9803 9 159
AF-A0A4Q9KB54-F1-model_v4 DUF501 domain-containing protein 0.9802 4 158

Feature Viewer

pLDDT pTM Quality
93.28 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map