F393541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 297 | 186 | 295 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100615903|Ga0070683_1006159032 |
| Length | 188 |
| Sequence | VGKYPRGGQFAVTEGAAELAPVTPSLDERDRATVAAQLGRSPRAIRAVAHRCPCGLPDVIESSPRLPDGTPFPTLYYLTCPRASAAIGRLEALGLMAEMTDRLSSDPRLADRYRTAHESYLRHRERLGHVAEIAGTSAGGMPRRVKCLHALVAHSLAAGRGVNPLGDEALDRLAPWWTSGPCVPAAAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 2 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 130 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 143 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 145 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 147 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 148 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 154 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 155 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 158 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 159 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 160 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 163 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 167 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 168 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 169 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 170 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 171 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 183 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 184 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 185 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 186 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.99 |
| Metatranscriptomes | 0.34 |
| Isolates | 0.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.69 |
| Nodule | 0 |
| Rhizoplane | 0.34 |
| Rhizosphere | 91.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10042288 | 3300003320 | Bacteria | 1674 |
| 2 | JGI25407J50210_10023362 | 3300003373 | Bacteria | 1605 |
| 3 | Ga0070658_10019955 | 3300005327 | Bacteria | 5369 |
| 4 | Ga0070658_10030013 | 3300005327 | Bacteria | 4369 |
| 5 | Ga0070683_100615903 | 3300005329 | Bacteria | 1039 |
| 6 | Ga0070683_100762373 | 3300005329 | Bacteria | 927 |
| 7 | Ga0070683_100893461 | 3300005329 | Bacteria | 852 |
| 8 | Ga0070690_100321534 | 3300005330 | Bacteria | 1115 |
| 9 | Ga0068869_100101202 | 3300005334 | Bacteria | 2180 |
| 10 | Ga0070682_100113383 | 3300005337 | Bacteria | 1810 |
| 11 | Ga0068868_100147718 | 3300005338 | Bacteria | 1934 |
| 12 | Ga0068868_100227265 | 3300005338 | Bacteria | 1564 |
| 13 | Ga0070660_100127470 | 3300005339 | Bacteria | 2034 |
| 14 | Ga0070689_100061231 | 3300005340 | Bacteria | 2927 |
| 15 | Ga0070692_10003752 | 3300005345 | Bacteria | 6244 |
| 16 | Ga0070668_100010781 | 3300005347 | Bacteria | 6796 |
| 17 | Ga0070669_100078836 | 3300005353 | Bacteria | 2449 |
| 18 | Ga0070671_100046469 | 3300005355 | Bacteria | 3610 |
| 19 | Ga0070671_100402765 | 3300005355 | Bacteria | 1170 |
| 20 | Ga0070674_100040431 | 3300005356 | Bacteria | 3155 |
| 21 | Ga0070673_100200602 | 3300005364 | Bacteria | 1718 |
| 22 | Ga0070659_100002263 | 3300005366 | Bacteria | 13712 |
| 23 | Ga0070659_100030673 | 3300005366 | Bacteria | 4161 |
| 24 | Ga0070667_100202031 | 3300005367 | Bacteria | 1764 |
| 25 | Ga0070709_10058500 | 3300005434 | Bacteria | 2444 |
| 26 | Ga0070713_100281305 | 3300005436 | Bacteria | 1526 |
| 27 | Ga0070713_100662976 | 3300005436 | Bacteria | 994 |
| 28 | Ga0070710_10030635 | 3300005437 | Bacteria | 2896 |
| 29 | Ga0070711_100012330 | 3300005439 | Bacteria | 5334 |
| 30 | Ga0070705_100018612 | 3300005440 | Bacteria | 3643 |
| 31 | Ga0070708_100294818 | 3300005445 | Bacteria | 1527 |
| 32 | Ga0070678_100006112 | 3300005456 | Bacteria | 7030 |
| 33 | Ga0070678_101268473 | 3300005456 | Bacteria | 685 |
| 34 | Ga0070662_100251827 | 3300005457 | Bacteria | 1420 |
| 35 | Ga0070681_10355198 | 3300005458 | Bacteria | 1376 |
| 36 | Ga0070685_10009871 | 3300005466 | Bacteria | 4950 |
| 37 | Ga0070679_100296144 | 3300005530 | Bacteria | 1569 |
| 38 | Ga0068853_100026777 | 3300005539 | Bacteria | 4843 |
| 39 | Ga0068853_100340925 | 3300005539 | Bacteria | 1393 |
| 40 | Ga0070695_100025471 | 3300005545 | Bacteria | 3653 |
| 41 | Ga0070696_100085592 | 3300005546 | Bacteria | 2237 |
| 42 | Ga0070693_100062803 | 3300005547 | Bacteria | 2162 |
| 43 | Ga0070665_100031315 | 3300005548 | Bacteria | 5354 |
| 44 | Ga0070704_100012172 | 3300005549 | Bacteria | 5309 |
| 45 | Ga0068855_100004728 | 3300005563 | Bacteria | 16630 |
| 46 | Ga0068855_100063636 | 3300005563 | Bacteria | 4304 |
| 47 | Ga0068855_100120555 | 3300005563 | Bacteria | 3002 |
| 48 | Ga0068857_100013991 | 3300005577 | Bacteria | 6981 |
| 49 | Ga0068857_100176459 | 3300005577 | Bacteria | 1944 |
| 50 | Ga0068854_100171877 | 3300005578 | Bacteria | 1687 |
| 51 | Ga0068854_100622717 | 3300005578 | Bacteria | 924 |
| 52 | Ga0068856_100066241 | 3300005614 | Bacteria | 3569 |
| 53 | Ga0068856_100129262 | 3300005614 | Bacteria | 2530 |
| 54 | Ga0068856_101428186 | 3300005614 | Bacteria | 706 |
| 55 | Ga0070702_100011756 | 3300005615 | Bacteria | 4365 |
| 56 | Ga0070702_100363498 | 3300005615 | Bacteria | 1023 |
| 57 | Ga0068852_100005155 | 3300005616 | Bacteria | 9314 |
| 58 | Ga0068852_100009144 | 3300005616 | Bacteria | 7340 |
| 59 | Ga0068852_100024306 | 3300005616 | Bacteria | 4894 |
| 60 | Ga0068852_100153185 | 3300005616 | Bacteria | 2146 |
| 61 | Ga0068852_100215858 | 3300005616 | Bacteria | 1822 |
| 62 | Ga0068852_100253792 | 3300005616 | Bacteria | 1686 |
| 63 | Ga0068859_100155399 | 3300005617 | Bacteria | 2365 |
| 64 | Ga0068859_100270934 | 3300005617 | Bacteria | 1790 |
| 65 | Ga0068864_100129901 | 3300005618 | Bacteria | 2262 |
| 66 | Ga0068866_10086712 | 3300005718 | Bacteria | 1695 |
| 67 | Ga0068866_10302321 | 3300005718 | Bacteria | 1000 |
| 68 | Ga0068861_100015420 | 3300005719 | Bacteria | 5384 |
| 69 | Ga0068861_100089537 | 3300005719 | Bacteria | 2426 |
| 70 | Ga0068851_10000043 | 3300005834 | Bacteria | 87775 |
| 71 | Ga0068858_100000229 | 3300005842 | Bacteria | 60583 |
| 72 | Ga0068858_100044997 | 3300005842 | Bacteria | 4090 |
| 73 | Ga0068860_100053155 | 3300005843 | Bacteria | 3852 |
| 74 | Ga0068862_100063539 | 3300005844 | Bacteria | 3176 |
| 75 | Ga0081455_10001272 | 3300005937 | Bacteria | 31484 |
| 76 | Ga0081455_10002482 | 3300005937 | Bacteria | 21928 |
| 77 | Ga0081455_10034071 | 3300005937 | Bacteria | 4567 |
| 78 | Ga0081455_10075220 | 3300005937 | Bacteria | 2787 |
| 79 | Ga0081455_10077930 | 3300005937 | Unclassified | 2725 |
| 80 | Ga0081455_10219672 | 3300005937 | Bacteria | 1409 |
| 81 | Ga0081538_10000160 | 3300005981 | Bacteria | 70950 |
| 82 | Ga0070717_10325029 | 3300006028 | Bacteria | 1371 |
| 83 | Ga0070717_10325260 | 3300006028 | Bacteria | 1370 |
| 84 | Ga0075432_10000109 | 3300006058 | Bacteria | 17845 |
| 85 | Ga0075432_10001766 | 3300006058 | Bacteria | 7117 |
| 86 | Ga0097621_100063100 | 3300006237 | Bacteria | 3044 |
| 87 | Ga0075428_100001169 | 3300006844 | Bacteria | 28087 |
| 88 | Ga0075428_100547301 | 3300006844 | Bacteria | 1237 |
| 89 | Ga0075428_101376658 | 3300006844 | Bacteria | 741 |
| 90 | Ga0075428_101425811 | 3300006844 | Bacteria | 726 |
| 91 | Ga0075431_100002935 | 3300006847 | Bacteria | 16511 |
| 92 | Ga0075431_101433532 | 3300006847 | Bacteria | 650 |
| 93 | Ga0075433_10001070 | 3300006852 | Bacteria | 19665 |
| 94 | Ga0075433_10004552 | 3300006852 | Bacteria | 10814 |
| 95 | Ga0075433_10006482 | 3300006852 | Bacteria | 9253 |
| 96 | Ga0075434_100014177 | 3300006871 | Bacteria | 7615 |
| 97 | Ga0075434_100036878 | 3300006871 | Bacteria | 4837 |
| 98 | Ga0075429_100031127 | 3300006880 | Bacteria | 4638 |
| 99 | Ga0068865_100074280 | 3300006881 | Bacteria | 2421 |
| 100 | Ga0068865_100152494 | 3300006881 | Bacteria | 1754 |
| 101 | Ga0075436_100014844 | 3300006914 | Bacteria | 5338 |
| 102 | Ga0075436_100537858 | 3300006914 | Bacteria | 857 |
| 103 | Ga0097620_100155394 | 3300006931 | Bacteria | 2365 |
| 104 | Ga0097620_100270929 | 3300006931 | Bacteria | 1790 |
| 105 | Ga0075435_100000540 | 3300007076 | Bacteria | 23169 |
| 106 | Ga0075435_100003913 | 3300007076 | Bacteria | 10172 |
| 107 | Ga0075435_100024811 | 3300007076 | Bacteria | 4659 |
| 108 | Ga0105240_10054210 | 3300009093 | Bacteria | 5026 |
| 109 | Ga0105240_10115022 | 3300009093 | Bacteria | 3249 |
| 110 | Ga0105245_10038296 | 3300009098 | Bacteria | 4266 |
| 111 | Ga0105245_10283224 | 3300009098 | Bacteria | 1621 |
| 112 | Ga0105248_10290811 | 3300009177 | Bacteria | 1840 |
| 113 | Ga0105237_10000164 | 3300009545 | Bacteria | 93890 |
| 114 | Ga0105237_10061346 | 3300009545 | Bacteria | 3760 |
| 115 | Ga0105238_10117366 | 3300009551 | Bacteria | 2641 |
| 116 | Ga0105249_10164660 | 3300009553 | Bacteria | 2146 |
| 117 | Ga0105239_10986729 | 3300010375 | Bacteria | 968 |
| 118 | Ga0157329_1001431 | 3300012491 | Bacteria | 1210 |
| 119 | Ga0157370_10016502 | 3300013104 | Bacteria | 7472 |
| 120 | Ga0157369_10092318 | 3300013105 | Bacteria | 3231 |
| 121 | Ga0157379_10034666 | 3300014968 | Bacteria | 4500 |
| 122 | Ga0206354_11167409 | 3300020081 | Bacteria | 1079 |
| 123 | Ga0209148_1000962 | 3300025254 | Bacteria | 18770 |
| 124 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 125 | Ga0207656_10000003 | 3300025321 | Bacteria | 771644 |
| 126 | Ga0207656_10000004 | 3300025321 | Bacteria | 632320 |
| 127 | Ga0207692_10272993 | 3300025898 | Bacteria | 1020 |
| 128 | Ga0207642_10015400 | 3300025899 | Bacteria | 2848 |
| 129 | Ga0207688_10057781 | 3300025901 | Bacteria | 2182 |
| 130 | Ga0207647_10051538 | 3300025904 | Bacteria | 2543 |
| 131 | Ga0207705_10074849 | 3300025909 | Bacteria | 2458 |
| 132 | Ga0207705_10100362 | 3300025909 | Bacteria | 2129 |
| 133 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 134 | Ga0207707_10298370 | 3300025912 | Bacteria | 1394 |
| 135 | Ga0207695_10004783 | 3300025913 | Bacteria | 18318 |
| 136 | Ga0207695_10071196 | 3300025913 | Bacteria | 3552 |
| 137 | Ga0207695_10388460 | 3300025913 | Bacteria | 1281 |
| 138 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 139 | Ga0207671_10018435 | 3300025914 | Bacteria | 5355 |
| 140 | Ga0207671_10047687 | 3300025914 | Bacteria | 3171 |
| 141 | Ga0207693_10001768 | 3300025915 | Bacteria | 18954 |
| 142 | Ga0207663_10097133 | 3300025916 | Bacteria | 1969 |
| 143 | Ga0207657_10023858 | 3300025919 | Bacteria | 5683 |
| 144 | Ga0207657_10042950 | 3300025919 | Bacteria | 3986 |
| 145 | Ga0207652_10045384 | 3300025921 | Bacteria | 3747 |
| 146 | Ga0207652_10276882 | 3300025921 | Bacteria | 1514 |
| 147 | Ga0207681_10052263 | 3300025923 | Bacteria | 2771 |
| 148 | Ga0207694_10000148 | 3300025924 | Bacteria | 72467 |
| 149 | Ga0207694_10143897 | 3300025924 | Bacteria | 1918 |
| 150 | Ga0207659_10580277 | 3300025926 | Bacteria | 955 |
| 151 | Ga0207687_10032489 | 3300025927 | Bacteria | 3535 |
| 152 | Ga0207687_10116285 | 3300025927 | Bacteria | 1993 |
| 153 | Ga0207687_10311167 | 3300025927 | Bacteria | 1272 |
| 154 | Ga0207687_10412005 | 3300025927 | Bacteria | 1114 |
| 155 | Ga0207700_10334441 | 3300025928 | Bacteria | 1315 |
| 156 | Ga0207644_10257499 | 3300025931 | Bacteria | 1394 |
| 157 | Ga0207690_10000776 | 3300025932 | Bacteria | 20682 |
| 158 | Ga0207690_10145361 | 3300025932 | Bacteria | 1752 |
| 159 | Ga0207706_10113395 | 3300025933 | Bacteria | 2385 |
| 160 | Ga0207706_10173698 | 3300025933 | Bacteria | 1893 |
| 161 | Ga0207709_10014107 | 3300025935 | Bacteria | 4411 |
| 162 | Ga0207709_10500964 | 3300025935 | Unclassified | 948 |
| 163 | Ga0207704_10011059 | 3300025938 | Bacteria | 4429 |
| 164 | Ga0207704_10270306 | 3300025938 | Bacteria | 1287 |
| 165 | Ga0207665_10001799 | 3300025939 | Bacteria | 14440 |
| 166 | Ga0207691_10088620 | 3300025940 | Bacteria | 2775 |
| 167 | Ga0207711_10067346 | 3300025941 | Bacteria | 3099 |
| 168 | Ga0207711_10173457 | 3300025941 | Bacteria | 1958 |
| 169 | Ga0207711_10329833 | 3300025941 | Bacteria | 1411 |
| 170 | Ga0207689_10106888 | 3300025942 | Bacteria | 2299 |
| 171 | Ga0207679_10866983 | 3300025945 | Bacteria | 825 |
| 172 | Ga0207667_10002739 | 3300025949 | Bacteria | 21787 |
| 173 | Ga0207667_10002791 | 3300025949 | Bacteria | 21636 |
| 174 | Ga0207667_10236619 | 3300025949 | Bacteria | 1869 |
| 175 | Ga0207667_10392917 | 3300025949 | Bacteria | 1412 |
| 176 | Ga0207712_10303181 | 3300025961 | Bacteria | 1312 |
| 177 | Ga0207640_10205670 | 3300025981 | Bacteria | 1495 |
| 178 | Ga0207640_10884414 | 3300025981 | Bacteria | 779 |
| 179 | Ga0207658_10401660 | 3300025986 | Bacteria | 1205 |
| 180 | Ga0207677_10026086 | 3300026023 | Bacteria | 3659 |
| 181 | Ga0207677_10060832 | 3300026023 | Bacteria | 2612 |
| 182 | Ga0207703_10000308 | 3300026035 | Bacteria | 53266 |
| 183 | Ga0207703_10161236 | 3300026035 | Bacteria | 1964 |
| 184 | Ga0207639_10003822 | 3300026041 | Bacteria | 10145 |
| 185 | Ga0207678_10284419 | 3300026067 | Bacteria | 1420 |
| 186 | Ga0207708_10071287 | 3300026075 | Bacteria | 2661 |
| 187 | Ga0207702_10040836 | 3300026078 | Bacteria | 3889 |
| 188 | Ga0207702_10477615 | 3300026078 | Bacteria | 1213 |
| 189 | Ga0207648_10265689 | 3300026089 | Bacteria | 1532 |
| 190 | Ga0207676_10308591 | 3300026095 | Bacteria | 1447 |
| 191 | Ga0207674_10020786 | 3300026116 | Bacteria | 7084 |
| 192 | Ga0207674_10154785 | 3300026116 | Bacteria | 2248 |
| 193 | Ga0207675_100010037 | 3300026118 | Bacteria | 8876 |
| 194 | Ga0207675_100039337 | 3300026118 | Bacteria | 4414 |
| 195 | Ga0207683_10001907 | 3300026121 | Bacteria | 18449 |
| 196 | Ga0207698_10001313 | 3300026142 | Bacteria | 14490 |
| 197 | Ga0207698_10006931 | 3300026142 | Bacteria | 7092 |
| 198 | Ga0207698_10108229 | 3300026142 | Bacteria | 2323 |
| 199 | Ga0207428_10000468 | 3300027907 | Bacteria | 48737 |
| 200 | Ga0207428_10002915 | 3300027907 | Bacteria | 16946 |
| 201 | Ga0207428_10469761 | 3300027907 | Bacteria | 916 |
| 202 | Ga0268265_10133122 | 3300028380 | Bacteria | 2070 |
| 203 | Ga0268264_10040113 | 3300028381 | Bacteria | 3868 |
| 204 | Ga0268264_10313956 | 3300028381 | Bacteria | 1480 |
| 205 | Ga0307509_10438969 | 3300031507 | Bacteria | 1002 |
| 206 | Ga0307408_100000788 | 3300031548 | Bacteria | 25461 |
| 207 | Ga0307408_100233620 | 3300031548 | Bacteria | 1507 |
| 208 | Ga0316576_10329352 | 3300031727 | Bacteria | 1138 |
| 209 | Ga0316578_10018887 | 3300031728 | Bacteria | 3786 |
| 210 | Ga0307405_10162285 | 3300031731 | Bacteria | 1584 |
| 211 | Ga0307405_10183000 | 3300031731 | Bacteria | 1506 |
| 212 | Ga0307413_10017880 | 3300031824 | Bacteria | 3704 |
| 213 | Ga0307413_10031252 | 3300031824 | Bacteria | 3002 |
| 214 | Ga0307413_10174486 | 3300031824 | Bacteria | 1525 |
| 215 | Ga0307410_10000723 | 3300031852 | Bacteria | 13800 |
| 216 | Ga0307410_10002273 | 3300031852 | Bacteria | 9207 |
| 217 | Ga0307406_10002207 | 3300031901 | Bacteria | 10596 |
| 218 | Ga0307406_10176747 | 3300031901 | Bacteria | 1550 |
| 219 | Ga0307406_10206415 | 3300031901 | Bacteria | 1450 |
| 220 | Ga0307407_10005103 | 3300031903 | Bacteria | 5660 |
| 221 | Ga0307407_10038292 | 3300031903 | Bacteria | 2656 |
| 222 | Ga0307407_10119281 | 3300031903 | Unclassified | 1669 |
| 223 | Ga0307407_10174619 | 3300031903 | Bacteria | 1418 |
| 224 | Ga0307412_10824720 | 3300031911 | Bacteria | 807 |
| 225 | Ga0307409_100000343 | 3300031995 | Bacteria | 19292 |
| 226 | Ga0307409_100206865 | 3300031995 | Bacteria | 1760 |
| 227 | Ga0307409_100843814 | 3300031995 | Bacteria | 926 |
| 228 | Ga0307409_100859343 | 3300031995 | Bacteria | 918 |
| 229 | Ga0307409_101014097 | 3300031995 | Bacteria | 848 |
| 230 | Ga0307416_100000067 | 3300032002 | Bacteria | 86975 |
| 231 | Ga0307416_100172513 | 3300032002 | Bacteria | 2015 |
| 232 | Ga0307416_100359477 | 3300032002 | Bacteria | 1477 |
| 233 | Ga0307416_101319117 | 3300032002 | Bacteria | 827 |
| 234 | Ga0307414_10006201 | 3300032004 | Bacteria | 6648 |
| 235 | Ga0307414_10009323 | 3300032004 | Bacteria | 5632 |
| 236 | Ga0307414_10245290 | 3300032004 | Bacteria | 1485 |
| 237 | Ga0307411_10004247 | 3300032005 | Bacteria | 6823 |
| 238 | Ga0307411_10028457 | 3300032005 | Bacteria | 3398 |
| 239 | Ga0307411_10047185 | 3300032005 | Bacteria | 2783 |
| 240 | Ga0307411_10081526 | 3300032005 | Bacteria | 2228 |
| 241 | Ga0307415_100000692 | 3300032126 | Bacteria | 14983 |
| 242 | Ga0307415_100055932 | 3300032126 | Bacteria | 2702 |
| 243 | Ga0307415_100229652 | 3300032126 | Bacteria | 1493 |
| 244 | Ga0316585_10052655 | 3300032137 | Bacteria | 1308 |
| 245 | Ga0373941_0378825 | 3300035115 | Bacteria | 581 |
| 246 | Ga0316574_0012304 | 3300035398 | Bacteria | 4892 |
| 247 | Ga0373931_0073069 | 3300035691 | Bacteria | 1877 |
| 248 | Ga0316582_0201245 | 3300036647 | Bacteria | 1359 |
| 249 | Ga0316584_0002099 | 3300036712 | Bacteria | 12483 |
| 250 | Ga0395899_0257469 | 3300037312 | Bacteria | 1195 |
| 251 | Ga0395900_0086314 | 3300037418 | Bacteria | 3225 |
| 252 | Ga0395898_0060515 | 3300037466 | Bacteria | 3680 |
| 253 | Ga0436364_1233723 | 3300037853 | Bacteria | 2765 |
| 254 | Ga0395901_0309131 | 3300038443 | Bacteria | 1637 |
| 255 | Ga0400485_04416 | 3300038735 | Bacteria | 6522 |
| 256 | Ga0400488_32990 | 3300038741 | Bacteria | 4804 |
| 257 | Ga0400486_29215 | 3300038742 | Bacteria | 140932 |
| 258 | Ga0436363_0111212 | 3300039450 | Bacteria | 652 |
| 259 | Ga0436363_0398281 | 3300039450 | Bacteria | 567 |
| 260 | Ga0451577_0265376 | 3300042876 | Bacteria | 1554 |
| 261 | Ga0439440_0223065 | 3300042993 | Bacteria | 566 |
| 262 | Ga0466961_0176513 | 3300044693 | Bacteria | 1327 |
| 263 | Ga0466971_0065554 | 3300044719 | Bacteria | 1645 |
| 264 | Ga0466957_0940526 | 3300044842 | Bacteria | 619 |
| 265 | Ga0466967_0083519 | 3300045976 | Bacteria | 2888 |
| 266 | Ga0466967_0332665 | 3300045976 | Bacteria | 1467 |
| 267 | Ga0495641_0371498 | 3300046461 | Bacteria | 648 |
| 268 | Ga0495620_0144351 | 3300046515 | Bacteria | 930 |
| 269 | Ga0496110_1548255 | 3300048913 | Bacteria | 573 |
| 270 | Ga0496117_0074757 | 3300048920 | Bacteria | 2254 |
| 271 | Ga0496118_0009551 | 3300048921 | Bacteria | 9768 |
| 272 | Ga0496119_0001631 | 3300048922 | Bacteria | 26493 |
| 273 | Ga0496120_0000484 | 3300048923 | Bacteria | 62327 |
| 274 | Ga0496120_0014287 | 3300048923 | Bacteria | 5299 |
| 275 | Ga0496121_0000098 | 3300048924 | Bacteria | 200516 |
| 276 | Ga0501031_0337117 | 3300049568 | Bacteria | 976 |
| 277 | Ga0501032_0635144 | 3300049569 | Bacteria | 678 |
| 278 | Ga0501034_0336827 | 3300049571 | Bacteria | 1439 |
| 279 | Ga0501038_0298342 | 3300049574 | Bacteria | 1265 |
| 280 | Ga0501047_0015150 | 3300049581 | Bacteria | 7341 |
| 281 | Ga0501069_0281615 | 3300049585 | Unclassified | 973 |
| 282 | Ga0501070_0149715 | 3300049586 | Bacteria | 1926 |
| 283 | Ga0501070_0156561 | 3300049586 | Bacteria | 1879 |
| 284 | Ga0501070_0652361 | 3300049586 | Bacteria | 835 |
| 285 | Ga0501074_0185931 | 3300049590 | Bacteria | 1482 |
| 286 | Ga0501035_0018215 | 3300049822 | Bacteria | 6468 |
| 287 | Ga0501044_0002221 | 3300049823 | Bacteria | 22261 |
| 288 | Ga0501045_0488293 | 3300049824 | Bacteria | 915 |
| 289 | Ga0500651_0006699 | 3300053093 | Bacteria | 6667 |
| 290 | Ga0500559_0110894 | 3300053136 | Bacteria | 1271 |
| 291 | Ga0500568_0201109 | 3300053139 | Bacteria | 730 |
| 292 | Ga0500573_0060163 | 3300053140 | Bacteria | 2176 |
| 293 | Ga0500573_0109213 | 3300053140 | Bacteria | 1549 |
| 294 | Ga0500573_0215311 | 3300053140 | Bacteria | 1011 |
| 295 | Ga0500620_000122 | 3300053155 | Bacteria | 15500 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025921 | Ga0207652_10045384 | Ga0207652_100453843 | 134 |
| 2 | 3300049586 | Ga0501070_0149715 | Ga0501070_0149715_1433_1876 | 134 |
| 3 | 3300049569 | Ga0501032_0635144 | Ga0501032_0635144_22_471 | 139 |
| 4 | 3300037853 | Ga0436364_1233723 | Ga0436364_1233723_1349_1849 | 145 |
| 5 | 3300039450 | Ga0436363_0398281 | Ga0436363_0398281_38_538 | 146 |
| 6 | 3300039450 | Ga0436363_0111212 | Ga0436363_0111212_38_538 | 147 |
| 7 | 3300005615 | Ga0070702_100363498 | Ga0070702_1003634981 | 150 |
| 8 | 3300053140 | Ga0500573_0109213 | Ga0500573_0109213_991_1515 | 150 |
| 9 | 3300005436 | Ga0070713_100662976 | Ga0070713_1006629762 | 154 |
| 10 | 3300006028 | Ga0070717_10325029 | Ga0070717_103250292 | 154 |
| 11 | iso_pu_bacteria | 2731639228 | 2731909248 | 154 |
| 12 | 3300005457 | Ga0070662_100251827 | Ga0070662_1002518272 | 155 |
| 13 | 3300005718 | Ga0068866_10302321 | Ga0068866_103023212 | 155 |
| 14 | 3300005719 | Ga0068861_100089537 | Ga0068861_1000895371 | 155 |
| 15 | 3300005937 | Ga0081455_10001272 | Ga0081455_1000127223 | 155 |
| 16 | 3300005937 | Ga0081455_10002482 | Ga0081455_100024822 | 155 |
| 17 | 3300005937 | Ga0081455_10219672 | Ga0081455_102196722 | 155 |
| 18 | 3300006058 | Ga0075432_10000109 | Ga0075432_1000010914 | 155 |
| 19 | 3300006844 | Ga0075428_100001169 | Ga0075428_10000116913 | 155 |
| 20 | 3300006847 | Ga0075431_100002935 | Ga0075431_10000293513 | 155 |
| 21 | 3300006847 | Ga0075431_101433532 | Ga0075431_1014335322 | 155 |
| 22 | 3300006852 | Ga0075433_10001070 | Ga0075433_100010702 | 155 |
| 23 | 3300006871 | Ga0075434_100036878 | Ga0075434_1000368782 | 155 |
| 24 | 3300006880 | Ga0075429_100031127 | Ga0075429_1000311272 | 155 |
| 25 | 3300006881 | Ga0068865_100074280 | Ga0068865_1000742802 | 155 |
| 26 | 3300006914 | Ga0075436_100537858 | Ga0075436_1005378582 | 155 |
| 27 | 3300007076 | Ga0075435_100000540 | Ga0075435_10000054016 | 155 |
| 28 | 3300009553 | Ga0105249_10164660 | Ga0105249_101646603 | 155 |
| 29 | 3300012491 | Ga0157329_1001431 | Ga0157329_10014312 | 155 |
| 30 | 3300025901 | Ga0207688_10057781 | Ga0207688_100577812 | 155 |
| 31 | 3300025927 | Ga0207687_10311167 | Ga0207687_103111672 | 155 |
| 32 | 3300025933 | Ga0207706_10173698 | Ga0207706_101736982 | 155 |
| 33 | 3300025935 | Ga0207709_10500964 | Ga0207709_105009641 | 155 |
| 34 | 3300025938 | Ga0207704_10011059 | Ga0207704_100110595 | 155 |
| 35 | 3300025961 | Ga0207712_10303181 | Ga0207712_103031812 | 155 |
| 36 | 3300026118 | Ga0207675_100039337 | Ga0207675_1000393372 | 155 |
| 37 | 3300027907 | Ga0207428_10002915 | Ga0207428_1000291513 | 155 |
| 38 | 3300028381 | Ga0268264_10313956 | Ga0268264_103139562 | 155 |
| 39 | 3300031548 | Ga0307408_100000788 | Ga0307408_10000078821 | 155 |
| 40 | 3300031731 | Ga0307405_10183000 | Ga0307405_101830002 | 155 |
| 41 | 3300031824 | Ga0307413_10031252 | Ga0307413_100312522 | 155 |
| 42 | 3300031852 | Ga0307410_10000723 | Ga0307410_1000072313 | 155 |
| 43 | 3300031901 | Ga0307406_10206415 | Ga0307406_102064152 | 155 |
| 44 | 3300031903 | Ga0307407_10119281 | Ga0307407_101192812 | 155 |
| 45 | 3300031995 | Ga0307409_100859343 | Ga0307409_1008593432 | 155 |
| 46 | 3300032005 | Ga0307411_10047185 | Ga0307411_100471851 | 155 |
| 47 | 3300032005 | Ga0307411_10081526 | Ga0307411_100815262 | 155 |
| 48 | 3300035115 | Ga0373941_0378825 | Ga0373941_0378825_23_508 | 155 |
| 49 | 3300035691 | Ga0373931_0073069 | Ga0373931_0073069_596_1081 | 155 |
| 50 | 3300042993 | Ga0439440_0223065 | Ga0439440_0223065_21_506 | 155 |
| 51 | 3300046515 | Ga0495620_0144351 | Ga0495620_0144351_257_742 | 155 |
| 52 | 3300049824 | Ga0501045_0488293 | Ga0501045_0488293_395_877 | 155 |
| 53 | 3300044842 | Ga0466957_0940526 | Ga0466957_0940526_46_528 | 156 |
| 54 | 3300005329 | Ga0070683_100762373 | Ga0070683_1007623732 | 157 |
| 55 | 3300005530 | Ga0070679_100296144 | Ga0070679_1002961442 | 157 |
| 56 | 3300005563 | Ga0068855_100120555 | Ga0068855_1001205553 | 157 |
| 57 | 3300005616 | Ga0068852_100153185 | Ga0068852_1001531852 | 157 |
| 58 | 3300009093 | Ga0105240_10054210 | Ga0105240_100542104 | 157 |
| 59 | 3300013104 | Ga0157370_10016502 | Ga0157370_100165023 | 157 |
| 60 | 3300013105 | Ga0157369_10092318 | Ga0157369_100923183 | 157 |
| 61 | 3300020081 | Ga0206354_11167409 | Ga0206354_111674092 | 157 |
| 62 | 3300025909 | Ga0207705_10100362 | Ga0207705_101003622 | 157 |
| 63 | 3300025913 | Ga0207695_10388460 | Ga0207695_103884602 | 157 |
| 64 | 3300025919 | Ga0207657_10042950 | Ga0207657_100429504 | 157 |
| 65 | 3300025921 | Ga0207652_10276882 | Ga0207652_102768822 | 157 |
| 66 | 3300025949 | Ga0207667_10236619 | Ga0207667_102366192 | 157 |
| 67 | 3300026142 | Ga0207698_10108229 | Ga0207698_101082293 | 157 |
| 68 | 3300037312 | Ga0395899_0257469 | Ga0395899_0257469_76_579 | 157 |
| 69 | 3300037418 | Ga0395900_0086314 | Ga0395900_0086314_2108_2611 | 157 |
| 70 | 3300037466 | Ga0395898_0060515 | Ga0395898_0060515_1232_1735 | 157 |
| 71 | 3300038443 | Ga0395901_0309131 | Ga0395901_0309131_432_935 | 157 |
| 72 | 3300044693 | Ga0466961_0176513 | Ga0466961_0176513_699_1187 | 157 |
| 73 | 3300049586 | Ga0501070_0652361 | Ga0501070_0652361_130_657 | 157 |
| 74 | 3300049590 | Ga0501074_0185931 | Ga0501074_0185931_743_1270 | 157 |
| 75 | 3300005937 | Ga0081455_10034071 | Ga0081455_100340713 | 158 |
| 76 | 3300042876 | Ga0451577_0265376 | Ga0451577_0265376_503_1006 | 158 |
| 77 | 3300045976 | Ga0466967_0332665 | Ga0466967_0332665_864_1352 | 158 |
| 78 | 3300003373 | JGI25407J50210_10023362 | JGI25407J50210_100233622 | 159 |
| 79 | 3300005456 | Ga0070678_101268473 | Ga0070678_1012684731 | 159 |
| 80 | 3300005616 | Ga0068852_100253792 | Ga0068852_1002537922 | 159 |
| 81 | 3300005937 | Ga0081455_10075220 | Ga0081455_100752201 | 159 |
| 82 | 3300005937 | Ga0081455_10077930 | Ga0081455_100779304 | 159 |
| 83 | 3300005981 | Ga0081538_10000160 | Ga0081538_1000016031 | 159 |
| 84 | 3300006058 | Ga0075432_10001766 | Ga0075432_100017664 | 159 |
| 85 | 3300006844 | Ga0075428_100547301 | Ga0075428_1005473012 | 159 |
| 86 | 3300006844 | Ga0075428_101376658 | Ga0075428_1013766582 | 159 |
| 87 | 3300006844 | Ga0075428_101425811 | Ga0075428_1014258112 | 159 |
| 88 | 3300006852 | Ga0075433_10004552 | Ga0075433_100045529 | 159 |
| 89 | 3300006914 | Ga0075436_100014844 | Ga0075436_1000148442 | 159 |
| 90 | 3300007076 | Ga0075435_100024811 | Ga0075435_1000248114 | 159 |
| 91 | 3300026089 | Ga0207648_10265689 | Ga0207648_102656893 | 159 |
| 92 | 3300027907 | Ga0207428_10000468 | Ga0207428_100004685 | 159 |
| 93 | 3300031548 | Ga0307408_100233620 | Ga0307408_1002336202 | 159 |
| 94 | 3300031731 | Ga0307405_10162285 | Ga0307405_101622852 | 159 |
| 95 | 3300031824 | Ga0307413_10017880 | Ga0307413_100178802 | 159 |
| 96 | 3300031824 | Ga0307413_10174486 | Ga0307413_101744862 | 159 |
| 97 | 3300031852 | Ga0307410_10002273 | Ga0307410_100022734 | 159 |
| 98 | 3300031901 | Ga0307406_10002207 | Ga0307406_100022079 | 159 |
| 99 | 3300031901 | Ga0307406_10176747 | Ga0307406_101767472 | 159 |
| 100 | 3300031903 | Ga0307407_10005103 | Ga0307407_100051037 | 159 |
| 101 | 3300031903 | Ga0307407_10038292 | Ga0307407_100382923 | 159 |
| 102 | 3300031903 | Ga0307407_10174619 | Ga0307407_101746192 | 159 |
| 103 | 3300031911 | Ga0307412_10824720 | Ga0307412_108247202 | 159 |
| 104 | 3300031995 | Ga0307409_100000343 | Ga0307409_1000003434 | 159 |
| 105 | 3300031995 | Ga0307409_100206865 | Ga0307409_1002068652 | 159 |
| 106 | 3300031995 | Ga0307409_100843814 | Ga0307409_1008438142 | 159 |
| 107 | 3300031995 | Ga0307409_101014097 | Ga0307409_1010140972 | 159 |
| 108 | 3300032002 | Ga0307416_100000067 | Ga0307416_10000006793 | 159 |
| 109 | 3300032002 | Ga0307416_100172513 | Ga0307416_1001725132 | 159 |
| 110 | 3300032002 | Ga0307416_100359477 | Ga0307416_1003594772 | 159 |
| 111 | 3300032002 | Ga0307416_101319117 | Ga0307416_1013191172 | 159 |
| 112 | 3300032004 | Ga0307414_10006201 | Ga0307414_100062017 | 159 |
| 113 | 3300032004 | Ga0307414_10009323 | Ga0307414_100093235 | 159 |
| 114 | 3300032004 | Ga0307414_10245290 | Ga0307414_102452902 | 159 |
| 115 | 3300032005 | Ga0307411_10004247 | Ga0307411_100042472 | 159 |
| 116 | 3300032005 | Ga0307411_10028457 | Ga0307411_100284572 | 159 |
| 117 | 3300032126 | Ga0307415_100000692 | Ga0307415_10000069212 | 159 |
| 118 | 3300032126 | Ga0307415_100055932 | Ga0307415_1000559324 | 159 |
| 119 | 3300032126 | Ga0307415_100229652 | Ga0307415_1002296522 | 159 |
| 120 | 3300046461 | Ga0495641_0371498 | Ga0495641_0371498_105_602 | 159 |
| 121 | 3300048913 | Ga0496110_1548255 | Ga0496110_1548255_26_538 | 159 |
| 122 | 3300049585 | Ga0501069_0281615 | Ga0501069_0281615_166_663 | 159 |
| 123 | 3300049586 | Ga0501070_0156561 | Ga0501070_0156561_334_843 | 159 |
| 124 | 3300053139 | Ga0500568_0201109 | Ga0500568_0201109_53_544 | 159 |
| 125 | 3300038735 | Ga0400485_04416 | Ga0400485_04416_5230_5766 | 160 |
| 126 | 3300038741 | Ga0400488_32990 | Ga0400488_32990_488_1048 | 160 |
| 127 | 3300038742 | Ga0400486_29215 | Ga0400486_29215_104188_104724 | 160 |
| 128 | 3300045976 | Ga0466967_0083519 | Ga0466967_0083519_419_919 | 160 |
| 129 | 3300031727 | Ga0316576_10329352 | Ga0316576_103293522 | 161 |
| 130 | 3300031728 | Ga0316578_10018887 | Ga0316578_100188874 | 161 |
| 131 | 3300032137 | Ga0316585_10052655 | Ga0316585_100526552 | 161 |
| 132 | 3300035398 | Ga0316574_0012304 | Ga0316574_0012304_82_612 | 161 |
| 133 | 3300036647 | Ga0316582_0201245 | Ga0316582_0201245_666_1196 | 161 |
| 134 | 3300036712 | Ga0316584_0002099 | Ga0316584_0002099_1752_2282 | 161 |
| 135 | 3300005329 | Ga0070683_100893461 | Ga0070683_1008934612 | 162 |
| 136 | 3300009098 | Ga0105245_10283224 | Ga0105245_102832242 | 162 |
| 137 | 3300005329 | Ga0070683_100615903 | Ga0070683_1006159032 | 163 |
| 138 | 3300005330 | Ga0070690_100321534 | Ga0070690_1003215343 | 163 |
| 139 | 3300005334 | Ga0068869_100101202 | Ga0068869_1001012022 | 163 |
| 140 | 3300005337 | Ga0070682_100113383 | Ga0070682_1001133832 | 163 |
| 141 | 3300005338 | Ga0068868_100227265 | Ga0068868_1002272652 | 163 |
| 142 | 3300005340 | Ga0070689_100061231 | Ga0070689_1000612313 | 163 |
| 143 | 3300005345 | Ga0070692_10003752 | Ga0070692_100037527 | 163 |
| 144 | 3300005347 | Ga0070668_100010781 | Ga0070668_1000107818 | 163 |
| 145 | 3300005353 | Ga0070669_100078836 | Ga0070669_1000788362 | 163 |
| 146 | 3300005355 | Ga0070671_100402765 | Ga0070671_1004027652 | 163 |
| 147 | 3300005356 | Ga0070674_100040431 | Ga0070674_1000404312 | 163 |
| 148 | 3300005364 | Ga0070673_100200602 | Ga0070673_1002006023 | 163 |
| 149 | 3300005366 | Ga0070659_100030673 | Ga0070659_1000306732 | 163 |
| 150 | 3300005367 | Ga0070667_100202031 | Ga0070667_1002020312 | 163 |
| 151 | 3300005434 | Ga0070709_10058500 | Ga0070709_100585003 | 163 |
| 152 | 3300005436 | Ga0070713_100281305 | Ga0070713_1002813051 | 163 |
| 153 | 3300005437 | Ga0070710_10030635 | Ga0070710_100306353 | 163 |
| 154 | 3300005439 | Ga0070711_100012330 | Ga0070711_1000123304 | 163 |
| 155 | 3300005440 | Ga0070705_100018612 | Ga0070705_1000186122 | 163 |
| 156 | 3300005445 | Ga0070708_100294818 | Ga0070708_1002948182 | 163 |
| 157 | 3300005456 | Ga0070678_100006112 | Ga0070678_1000061126 | 163 |
| 158 | 3300005458 | Ga0070681_10355198 | Ga0070681_103551981 | 163 |
| 159 | 3300005539 | Ga0068853_100340925 | Ga0068853_1003409252 | 163 |
| 160 | 3300005545 | Ga0070695_100025471 | Ga0070695_1000254712 | 163 |
| 161 | 3300005546 | Ga0070696_100085592 | Ga0070696_1000855922 | 163 |
| 162 | 3300005547 | Ga0070693_100062803 | Ga0070693_1000628032 | 163 |
| 163 | 3300005548 | Ga0070665_100031315 | Ga0070665_1000313153 | 163 |
| 164 | 3300005549 | Ga0070704_100012172 | Ga0070704_1000121722 | 163 |
| 165 | 3300005578 | Ga0068854_100171877 | Ga0068854_1001718772 | 163 |
| 166 | 3300005614 | Ga0068856_100066241 | Ga0068856_1000662415 | 163 |
| 167 | 3300005615 | Ga0070702_100011756 | Ga0070702_1000117566 | 163 |
| 168 | 3300005616 | Ga0068852_100005155 | Ga0068852_1000051554 | 163 |
| 169 | 3300005617 | Ga0068859_100155399 | Ga0068859_1001553993 | 163 |
| 170 | 3300005718 | Ga0068866_10086712 | Ga0068866_100867123 | 163 |
| 171 | 3300005719 | Ga0068861_100015420 | Ga0068861_1000154206 | 163 |
| 172 | 3300005842 | Ga0068858_100044997 | Ga0068858_1000449973 | 163 |
| 173 | 3300005843 | Ga0068860_100053155 | Ga0068860_1000531552 | 163 |
| 174 | 3300005844 | Ga0068862_100063539 | Ga0068862_1000635392 | 163 |
| 175 | 3300006028 | Ga0070717_10325260 | Ga0070717_103252602 | 163 |
| 176 | 3300006237 | Ga0097621_100063100 | Ga0097621_1000631005 | 163 |
| 177 | 3300006852 | Ga0075433_10006482 | Ga0075433_100064827 | 163 |
| 178 | 3300006871 | Ga0075434_100014177 | Ga0075434_1000141772 | 163 |
| 179 | 3300006881 | Ga0068865_100152494 | Ga0068865_1001524942 | 163 |
| 180 | 3300006931 | Ga0097620_100155394 | Ga0097620_1001553943 | 163 |
| 181 | 3300007076 | Ga0075435_100003913 | Ga0075435_1000039137 | 163 |
| 182 | 3300025898 | Ga0207692_10272993 | Ga0207692_102729932 | 163 |
| 183 | 3300025899 | Ga0207642_10015400 | Ga0207642_100154003 | 163 |
| 184 | 3300025904 | Ga0207647_10051538 | Ga0207647_100515383 | 163 |
| 185 | 3300025912 | Ga0207707_10298370 | Ga0207707_102983703 | 163 |
| 186 | 3300025914 | Ga0207671_10018435 | Ga0207671_100184355 | 163 |
| 187 | 3300025915 | Ga0207693_10001768 | Ga0207693_100017686 | 163 |
| 188 | 3300025916 | Ga0207663_10097133 | Ga0207663_100971333 | 163 |
| 189 | 3300025919 | Ga0207657_10023858 | Ga0207657_100238585 | 163 |
| 190 | 3300025923 | Ga0207681_10052263 | Ga0207681_100522633 | 163 |
| 191 | 3300025924 | Ga0207694_10143897 | Ga0207694_101438972 | 163 |
| 192 | 3300025926 | Ga0207659_10580277 | Ga0207659_105802772 | 163 |
| 193 | 3300025927 | Ga0207687_10412005 | Ga0207687_104120052 | 163 |
| 194 | 3300025928 | Ga0207700_10334441 | Ga0207700_103344413 | 163 |
| 195 | 3300025932 | Ga0207690_10145361 | Ga0207690_101453612 | 163 |
| 196 | 3300025933 | Ga0207706_10113395 | Ga0207706_101133952 | 163 |
| 197 | 3300025935 | Ga0207709_10014107 | Ga0207709_100141073 | 163 |
| 198 | 3300025938 | Ga0207704_10270306 | Ga0207704_102703062 | 163 |
| 199 | 3300025939 | Ga0207665_10001799 | Ga0207665_100017996 | 163 |
| 200 | 3300025940 | Ga0207691_10088620 | Ga0207691_100886203 | 163 |
| 201 | 3300025941 | Ga0207711_10067346 | Ga0207711_100673463 | 163 |
| 202 | 3300025942 | Ga0207689_10106888 | Ga0207689_101068882 | 163 |
| 203 | 3300025945 | Ga0207679_10866983 | Ga0207679_108669832 | 163 |
| 204 | 3300025981 | Ga0207640_10205670 | Ga0207640_102056702 | 163 |
| 205 | 3300025986 | Ga0207658_10401660 | Ga0207658_104016602 | 163 |
| 206 | 3300026023 | Ga0207677_10060832 | Ga0207677_100608322 | 163 |
| 207 | 3300026035 | Ga0207703_10161236 | Ga0207703_101612363 | 163 |
| 208 | 3300026067 | Ga0207678_10284419 | Ga0207678_102844192 | 163 |
| 209 | 3300026075 | Ga0207708_10071287 | Ga0207708_100712873 | 163 |
| 210 | 3300026078 | Ga0207702_10040836 | Ga0207702_100408362 | 163 |
| 211 | 3300026095 | Ga0207676_10308591 | Ga0207676_103085912 | 163 |
| 212 | 3300026118 | Ga0207675_100010037 | Ga0207675_10001003710 | 163 |
| 213 | 3300026121 | Ga0207683_10001907 | Ga0207683_100019078 | 163 |
| 214 | 3300027907 | Ga0207428_10469761 | Ga0207428_104697612 | 163 |
| 215 | 3300028380 | Ga0268265_10133122 | Ga0268265_101331222 | 163 |
| 216 | 3300028381 | Ga0268264_10040113 | Ga0268264_100401134 | 163 |
| 217 | 3300044719 | Ga0466971_0065554 | Ga0466971_0065554_708_1223 | 163 |
| 218 | iso_pu_bacteria | 2643221549 | 2643769787 | 163 |
| 219 | 3300053140 | Ga0500573_0060163 | Ga0500573_0060163_1446_1952 | 165 |
| 220 | 3300048924 | Ga0496121_0000098 | Ga0496121_0000098_145730_146332 | 166 |
| 221 | 3300049568 | Ga0501031_0337117 | Ga0501031_0337117_38_580 | 166 |
| 222 | 3300049571 | Ga0501034_0336827 | Ga0501034_0336827_921_1421 | 166 |
| 223 | 3300049574 | Ga0501038_0298342 | Ga0501038_0298342_210_752 | 166 |
| 224 | 3300049581 | Ga0501047_0015150 | Ga0501047_0015150_2031_2573 | 166 |
| 225 | 3300049822 | Ga0501035_0018215 | Ga0501035_0018215_4550_5092 | 166 |
| 226 | 3300049823 | Ga0501044_0002221 | Ga0501044_0002221_19540_20070 | 166 |
| 227 | 3300003320 | rootH2_10042288 | rootH2_100422882 | 171 |
| 228 | 3300005327 | Ga0070658_10019955 | Ga0070658_100199553 | 171 |
| 229 | 3300005327 | Ga0070658_10030013 | Ga0070658_100300134 | 171 |
| 230 | 3300005338 | Ga0068868_100147718 | Ga0068868_1001477181 | 171 |
| 231 | 3300005339 | Ga0070660_100127470 | Ga0070660_1001274701 | 171 |
| 232 | 3300005355 | Ga0070671_100046469 | Ga0070671_1000464693 | 171 |
| 233 | 3300005366 | Ga0070659_100002263 | Ga0070659_1000022636 | 171 |
| 234 | 3300005466 | Ga0070685_10009871 | Ga0070685_100098712 | 171 |
| 235 | 3300005539 | Ga0068853_100026777 | Ga0068853_1000267772 | 171 |
| 236 | 3300005563 | Ga0068855_100004728 | Ga0068855_1000047288 | 171 |
| 237 | 3300005563 | Ga0068855_100063636 | Ga0068855_1000636364 | 171 |
| 238 | 3300005577 | Ga0068857_100013991 | Ga0068857_1000139912 | 171 |
| 239 | 3300005577 | Ga0068857_100176459 | Ga0068857_1001764592 | 171 |
| 240 | 3300005578 | Ga0068854_100622717 | Ga0068854_1006227172 | 171 |
| 241 | 3300005614 | Ga0068856_100129262 | Ga0068856_1001292622 | 171 |
| 242 | 3300005614 | Ga0068856_101428186 | Ga0068856_1014281861 | 171 |
| 243 | 3300005616 | Ga0068852_100009144 | Ga0068852_1000091443 | 171 |
| 244 | 3300005616 | Ga0068852_100024306 | Ga0068852_1000243062 | 171 |
| 245 | 3300005616 | Ga0068852_100215858 | Ga0068852_1002158582 | 171 |
| 246 | 3300005617 | Ga0068859_100270934 | Ga0068859_1002709342 | 171 |
| 247 | 3300005618 | Ga0068864_100129901 | Ga0068864_1001299012 | 171 |
| 248 | 3300005834 | Ga0068851_10000043 | Ga0068851_1000004360 | 171 |
| 249 | 3300005842 | Ga0068858_100000229 | Ga0068858_10000022947 | 171 |
| 250 | 3300006931 | Ga0097620_100270929 | Ga0097620_1002709292 | 171 |
| 251 | 3300009093 | Ga0105240_10115022 | Ga0105240_101150224 | 171 |
| 252 | 3300009098 | Ga0105245_10038296 | Ga0105245_100382964 | 171 |
| 253 | 3300009177 | Ga0105248_10290811 | Ga0105248_102908112 | 171 |
| 254 | 3300009545 | Ga0105237_10000164 | Ga0105237_1000016470 | 171 |
| 255 | 3300009545 | Ga0105237_10061346 | Ga0105237_100613464 | 171 |
| 256 | 3300009551 | Ga0105238_10117366 | Ga0105238_101173662 | 171 |
| 257 | 3300010375 | Ga0105239_10986729 | Ga0105239_109867292 | 171 |
| 258 | 3300014968 | Ga0157379_10034666 | Ga0157379_100346662 | 171 |
| 259 | 3300025254 | Ga0209148_1000962 | Ga0209148_100096210 | 171 |
| 260 | 3300025321 | Ga0207656_10000001 | Ga0207656_10000001552 | 171 |
| 261 | 3300025321 | Ga0207656_10000003 | Ga0207656_10000003658 | 171 |
| 262 | 3300025321 | Ga0207656_10000004 | Ga0207656_10000004515 | 171 |
| 263 | 3300025909 | Ga0207705_10074849 | Ga0207705_100748492 | 171 |
| 264 | 3300025911 | Ga0207654_10000003 | Ga0207654_10000003842 | 171 |
| 265 | 3300025913 | Ga0207695_10004783 | Ga0207695_1000478311 | 171 |
| 266 | 3300025913 | Ga0207695_10071196 | Ga0207695_100711963 | 171 |
| 267 | 3300025914 | Ga0207671_10000001 | Ga0207671_10000001550 | 171 |
| 268 | 3300025914 | Ga0207671_10047687 | Ga0207671_100476873 | 171 |
| 269 | 3300025924 | Ga0207694_10000148 | Ga0207694_100001489 | 171 |
| 270 | 3300025927 | Ga0207687_10032489 | Ga0207687_100324894 | 171 |
| 271 | 3300025927 | Ga0207687_10116285 | Ga0207687_101162852 | 171 |
| 272 | 3300025931 | Ga0207644_10257499 | Ga0207644_102574991 | 171 |
| 273 | 3300025932 | Ga0207690_10000776 | Ga0207690_100007768 | 171 |
| 274 | 3300025941 | Ga0207711_10173457 | Ga0207711_101734573 | 171 |
| 275 | 3300025941 | Ga0207711_10329833 | Ga0207711_103298332 | 171 |
| 276 | 3300025949 | Ga0207667_10002739 | Ga0207667_1000273911 | 171 |
| 277 | 3300025949 | Ga0207667_10002791 | Ga0207667_1000279119 | 171 |
| 278 | 3300025949 | Ga0207667_10392917 | Ga0207667_103929172 | 171 |
| 279 | 3300025981 | Ga0207640_10884414 | Ga0207640_108844142 | 171 |
| 280 | 3300026023 | Ga0207677_10026086 | Ga0207677_100260863 | 171 |
| 281 | 3300026035 | Ga0207703_10000308 | Ga0207703_1000030810 | 171 |
| 282 | 3300026041 | Ga0207639_10003822 | Ga0207639_100038229 | 171 |
| 283 | 3300026078 | Ga0207702_10477615 | Ga0207702_104776152 | 171 |
| 284 | 3300026116 | Ga0207674_10020786 | Ga0207674_100207866 | 171 |
| 285 | 3300026116 | Ga0207674_10154785 | Ga0207674_101547852 | 171 |
| 286 | 3300026142 | Ga0207698_10001313 | Ga0207698_100013132 | 171 |
| 287 | 3300026142 | Ga0207698_10006931 | Ga0207698_100069313 | 171 |
| 288 | 3300031507 | Ga0307509_10438969 | Ga0307509_104389692 | 171 |
| 289 | 3300048920 | Ga0496117_0074757 | Ga0496117_0074757_258_794 | 171 |
| 290 | 3300048921 | Ga0496118_0009551 | Ga0496118_0009551_2560_3096 | 171 |
| 291 | 3300048922 | Ga0496119_0001631 | Ga0496119_0001631_7246_7782 | 171 |
| 292 | 3300048923 | Ga0496120_0000484 | Ga0496120_0000484_20452_20988 | 171 |
| 293 | 3300048923 | Ga0496120_0014287 | Ga0496120_0014287_1679_2215 | 171 |
| 294 | 3300053093 | Ga0500651_0006699 | Ga0500651_0006699_1338_1874 | 171 |
| 295 | 3300053136 | Ga0500559_0110894 | Ga0500559_0110894_53_589 | 171 |
| 296 | 3300053140 | Ga0500573_0215311 | Ga0500573_0215311_381_917 | 171 |
| 297 | 3300053155 | Ga0500620_000122 | Ga0500620_000122_12109_12645 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1x6o-assembly1.cif.gz_A | structural analysis of leishmania braziliensis eukaryotic initiation factor 5a | 0.37 | 26 | 77 |
| 1xtd-assembly1.cif.gz_A | structural analysis of leishmania mexicana eukaryotic initiation factor 5a | 0.3694 | 26 | 77 |
| 4y0c-assembly1.cif.gz_B | the structure of arabidopsis clpt2 | 0.3584 | 65 | 163 |
| 3lgi-assembly1.cif.gz_A | structure of the protease domain of degs (degs-deltapdz) at 1.65 a | 0.2923 | 24 | 77 |
| 2oqm-assembly2.cif.gz_D | crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution | 0.273 | 65 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9H2U1_649_762_1.20.120.1080 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5744 | 71 | 100 | 1.20.120.1080 |
| af_Q5JK54_3_266_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.5467 | 71 | 112 | 1.10.510.10 |
| af_P24785_815_973_1.20.120.1080 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5341 | 71 | 100 | 1.20.120.1080 |
| af_Q8SWT2_587_700_1.20.120.1080 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5293 | 74 | 100 | 1.20.120.1080 |
| af_Q9SVD4_135_350_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.5163 | 86 | 105 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A3ZML8-F1-model_v4 | DUF501 domain-containing protein | 0.9848 | 18 | 160 |
|
| AF-A0A6L6XTS8-F1-model_v4 | DUF501 domain-containing protein | 0.9824 | 10 | 158 |
|
| AF-A0A2G6HC19-F1-model_v4 | Septum formation initiator family protein | 0.9816 | 17 | 158 |
|
| AF-A0A4R2IVI0-F1-model_v4 | Septum formation initiator family protein | 0.9803 | 9 | 159 |
|
| AF-A0A4Q9KB54-F1-model_v4 | DUF501 domain-containing protein | 0.9802 | 4 | 158 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar