F393572
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 297 | 176 | 289 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_101195560|Ga0070674_1011955601 |
| Length | 183 |
| Sequence | MNNLLFDFTVDKATKTVSITREFDAELSLVWDAFTKKEILDQWWAPKPFASKTKVMDFKVGGRRFYAMVSPEGQERWVIQKYTSISPKTNFKFFNAFADENENPELPGSEWDHTFSEQNGMTKVSVTIYNESLERMEKQIEMGFKEGFTMTLNYLDELLETLSKMIPLPIGIVFKISLKFLRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 131 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 132 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 140 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 141 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 148 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 149 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 150 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 151 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 152 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 159 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 160 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 161 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 162 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 163 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 164 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 165 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 167 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 168 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 169 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 175 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 176 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.68 |
| Nodule | 0 |
| Rhizoplane | 1.35 |
| Rhizosphere | 95.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1037558 | 3300002076 | Unclassified | 705 |
| 2 | Ga0065704_10124968 | 3300005289 | Bacteria | 1710 |
| 3 | Ga0065704_10440797 | 3300005289 | Unclassified | 714 |
| 4 | Ga0065712_10321304 | 3300005290 | Bacteria | 801 |
| 5 | Ga0065715_10341684 | 3300005293 | Unclassified | 966 |
| 6 | Ga0070658_10027667 | 3300005327 | Bacteria | 4549 |
| 7 | Ga0070676_10321524 | 3300005328 | Bacteria | 1055 |
| 8 | Ga0070683_101046925 | 3300005329 | Bacteria | 784 |
| 9 | Ga0070683_101161632 | 3300005329 | Bacteria | 742 |
| 10 | Ga0070670_100121058 | 3300005331 | Unclassified | 2257 |
| 11 | Ga0070670_100127367 | 3300005331 | Bacteria | 2198 |
| 12 | Ga0070670_100351490 | 3300005331 | Bacteria | 1295 |
| 13 | Ga0068869_100228817 | 3300005334 | Bacteria | 1477 |
| 14 | Ga0068869_100512852 | 3300005334 | Bacteria | 1003 |
| 15 | Ga0068869_100738697 | 3300005334 | Bacteria | 842 |
| 16 | Ga0070666_10250792 | 3300005335 | Bacteria | 1253 |
| 17 | Ga0070680_100083143 | 3300005336 | Bacteria | 2643 |
| 18 | Ga0070680_100086766 | 3300005336 | Unclassified | 2587 |
| 19 | Ga0070680_100532181 | 3300005336 | Bacteria | 1006 |
| 20 | Ga0068868_100873236 | 3300005338 | Bacteria | 816 |
| 21 | Ga0070689_100781375 | 3300005340 | Bacteria | 839 |
| 22 | Ga0070661_100059917 | 3300005344 | Unclassified | 2793 |
| 23 | Ga0070661_100796456 | 3300005344 | Unclassified | 775 |
| 24 | Ga0070668_101527210 | 3300005347 | Bacteria | 611 |
| 25 | Ga0070669_100256196 | 3300005353 | Bacteria | 1395 |
| 26 | Ga0070671_100435536 | 3300005355 | Bacteria | 1124 |
| 27 | Ga0070674_101195560 | 3300005356 | Bacteria | 675 |
| 28 | Ga0070673_100178909 | 3300005364 | Bacteria | 1815 |
| 29 | Ga0070673_100514721 | 3300005364 | Bacteria | 1084 |
| 30 | Ga0070673_100626248 | 3300005364 | Bacteria | 983 |
| 31 | Ga0070673_100981337 | 3300005364 | Bacteria | 786 |
| 32 | Ga0070688_100998654 | 3300005365 | Bacteria | 665 |
| 33 | Ga0070659_100023933 | 3300005366 | Unclassified | 4678 |
| 34 | Ga0070659_100600489 | 3300005366 | Bacteria | 946 |
| 35 | Ga0070667_100119452 | 3300005367 | Bacteria | 2292 |
| 36 | Ga0070667_100240369 | 3300005367 | Bacteria | 1617 |
| 37 | Ga0070694_100169909 | 3300005444 | Bacteria | 1605 |
| 38 | Ga0070663_100683725 | 3300005455 | Bacteria | 871 |
| 39 | Ga0070678_100066441 | 3300005456 | Bacteria | 2681 |
| 40 | Ga0070678_100907791 | 3300005456 | Bacteria | 806 |
| 41 | Ga0070662_100167799 | 3300005457 | Bacteria | 1721 |
| 42 | Ga0070662_100366851 | 3300005457 | Bacteria | 1183 |
| 43 | Ga0070662_100925262 | 3300005457 | Bacteria | 745 |
| 44 | Ga0070662_100943442 | 3300005457 | Bacteria | 737 |
| 45 | Ga0070681_10141920 | 3300005458 | Bacteria | 2331 |
| 46 | Ga0070681_10228557 | 3300005458 | Bacteria | 1775 |
| 47 | Ga0068867_100293407 | 3300005459 | Bacteria | 1338 |
| 48 | Ga0068867_100301602 | 3300005459 | Bacteria | 1321 |
| 49 | Ga0068867_101221022 | 3300005459 | Bacteria | 691 |
| 50 | Ga0070707_100157563 | 3300005468 | Bacteria | 2212 |
| 51 | Ga0070698_100006677 | 3300005471 | Bacteria | 12513 |
| 52 | Ga0070698_100368055 | 3300005471 | Bacteria | 1369 |
| 53 | Ga0070699_100381311 | 3300005518 | Bacteria | 1273 |
| 54 | Ga0070679_100061836 | 3300005530 | Bacteria | 3733 |
| 55 | Ga0070679_100939911 | 3300005530 | Bacteria | 808 |
| 56 | Ga0070684_100698596 | 3300005535 | Bacteria | 946 |
| 57 | Ga0068853_100016182 | 3300005539 | Bacteria | 6135 |
| 58 | Ga0068853_100023893 | 3300005539 | Bacteria | 5122 |
| 59 | Ga0068853_100033399 | 3300005539 | Bacteria | 4365 |
| 60 | Ga0068853_100045747 | 3300005539 | Bacteria | 3750 |
| 61 | Ga0068853_100925002 | 3300005539 | Bacteria | 838 |
| 62 | Ga0070672_100790106 | 3300005543 | Bacteria | 835 |
| 63 | Ga0070686_100171183 | 3300005544 | Bacteria | 1536 |
| 64 | Ga0070686_100214058 | 3300005544 | Bacteria | 1389 |
| 65 | Ga0070695_100097670 | 3300005545 | Bacteria | 1972 |
| 66 | Ga0070696_100135122 | 3300005546 | Bacteria | 1797 |
| 67 | Ga0070704_100562697 | 3300005549 | Bacteria | 997 |
| 68 | Ga0068855_100167212 | 3300005563 | Bacteria | 2492 |
| 69 | Ga0068855_101000275 | 3300005563 | Bacteria | 879 |
| 70 | Ga0068857_100049348 | 3300005577 | Bacteria | 3734 |
| 71 | Ga0068854_100074863 | 3300005578 | Bacteria | 2484 |
| 72 | Ga0068854_100124670 | 3300005578 | Bacteria | 1960 |
| 73 | Ga0068854_101558466 | 3300005578 | Bacteria | 601 |
| 74 | Ga0068856_100270434 | 3300005614 | Bacteria | 1715 |
| 75 | Ga0068852_100094229 | 3300005616 | Bacteria | 2685 |
| 76 | Ga0068852_100741408 | 3300005616 | Bacteria | 994 |
| 77 | Ga0068852_101272040 | 3300005616 | Bacteria | 757 |
| 78 | Ga0068859_100000128 | 3300005617 | Bacteria | 72119 |
| 79 | Ga0068859_100051894 | 3300005617 | Bacteria | 4123 |
| 80 | Ga0068851_10068343 | 3300005834 | Bacteria | 1834 |
| 81 | Ga0068870_10161949 | 3300005840 | Bacteria | 1328 |
| 82 | Ga0068870_11078036 | 3300005840 | Bacteria | 577 |
| 83 | Ga0068863_100035033 | 3300005841 | Bacteria | 4782 |
| 84 | Ga0068858_100140749 | 3300005842 | Bacteria | 2265 |
| 85 | Ga0068860_100000218 | 3300005843 | Bacteria | 90001 |
| 86 | Ga0068862_100174682 | 3300005844 | Bacteria | 1925 |
| 87 | Ga0097621_100112299 | 3300006237 | Bacteria | 2304 |
| 88 | Ga0075428_100102014 | 3300006844 | Bacteria | 3128 |
| 89 | Ga0075430_100006345 | 3300006846 | Bacteria | 9974 |
| 90 | Ga0075431_100105332 | 3300006847 | Bacteria | 2910 |
| 91 | Ga0075433_10960811 | 3300006852 | Bacteria | 745 |
| 92 | Ga0097620_100000128 | 3300006931 | Bacteria | 72119 |
| 93 | Ga0097620_100051893 | 3300006931 | Bacteria | 4123 |
| 94 | Ga0105240_10009185 | 3300009093 | Bacteria | 14021 |
| 95 | Ga0105240_10039076 | 3300009093 | Bacteria | 6080 |
| 96 | Ga0105240_10812663 | 3300009093 | Bacteria | 1012 |
| 97 | Ga0111539_11398288 | 3300009094 | Bacteria | 812 |
| 98 | Ga0114129_10200659 | 3300009147 | Bacteria | 2702 |
| 99 | Ga0105243_10314154 | 3300009148 | Bacteria | 1425 |
| 100 | Ga0105241_10149296 | 3300009174 | Bacteria | 1910 |
| 101 | Ga0105237_10051778 | 3300009545 | Bacteria | 4124 |
| 102 | Ga0105237_10061861 | 3300009545 | Bacteria | 3742 |
| 103 | Ga0105238_10033177 | 3300009551 | Bacteria | 5254 |
| 104 | Ga0105249_10010246 | 3300009553 | Bacteria | 8232 |
| 105 | Ga0105239_10000146 | 3300010375 | Bacteria | 101177 |
| 106 | Ga0105239_10031586 | 3300010375 | Bacteria | 5822 |
| 107 | Ga0157373_10027671 | 3300013100 | Bacteria | 4090 |
| 108 | Ga0157371_10170911 | 3300013102 | Bacteria | 1553 |
| 109 | Ga0157371_10717692 | 3300013102 | Bacteria | 749 |
| 110 | Ga0157369_10293525 | 3300013105 | Unclassified | 1692 |
| 111 | Ga0157369_10663988 | 3300013105 | Bacteria | 1075 |
| 112 | Ga0157374_10048982 | 3300013296 | Bacteria | 3922 |
| 113 | Ga0157374_10192317 | 3300013296 | Bacteria | 1996 |
| 114 | Ga0157374_10447333 | 3300013296 | Bacteria | 1293 |
| 115 | Ga0157378_10048916 | 3300013297 | Bacteria | 3761 |
| 116 | Ga0163162_10001254 | 3300013306 | Bacteria | 23756 |
| 117 | Ga0163162_10082817 | 3300013306 | Bacteria | 3281 |
| 118 | Ga0157372_10327163 | 3300013307 | Bacteria | 1784 |
| 119 | Ga0157372_10489284 | 3300013307 | Bacteria | 1434 |
| 120 | Ga0157372_11709654 | 3300013307 | Unclassified | 724 |
| 121 | Ga0157372_12443419 | 3300013307 | Bacteria | 600 |
| 122 | Ga0157375_10027534 | 3300013308 | Bacteria | 5314 |
| 123 | Ga0157375_10191982 | 3300013308 | Bacteria | 2197 |
| 124 | Ga0157375_10478143 | 3300013308 | Bacteria | 1411 |
| 125 | Ga0163163_10339308 | 3300014325 | Bacteria | 1558 |
| 126 | Ga0163163_10711298 | 3300014325 | Bacteria | 1068 |
| 127 | Ga0163163_11036311 | 3300014325 | Bacteria | 884 |
| 128 | Ga0157380_10093576 | 3300014326 | Bacteria | 2485 |
| 129 | Ga0157380_10771919 | 3300014326 | Bacteria | 975 |
| 130 | Ga0157380_11308140 | 3300014326 | Bacteria | 772 |
| 131 | Ga0157377_10333381 | 3300014745 | Bacteria | 1012 |
| 132 | Ga0157379_10328207 | 3300014968 | Bacteria | 1398 |
| 133 | Ga0163161_10426129 | 3300017792 | Bacteria | 1068 |
| 134 | Ga0163161_11625089 | 3300017792 | Unclassified | 570 |
| 135 | Ga0209148_1044118 | 3300025254 | Bacteria | 603 |
| 136 | Ga0209455_1012474 | 3300025272 | Bacteria | 2033 |
| 137 | Ga0207656_10108139 | 3300025321 | Bacteria | 1282 |
| 138 | Ga0207642_10138388 | 3300025899 | Bacteria | 1280 |
| 139 | Ga0207680_10210224 | 3300025903 | Bacteria | 1330 |
| 140 | Ga0207680_10477651 | 3300025903 | Bacteria | 886 |
| 141 | Ga0207680_10565820 | 3300025903 | Bacteria | 812 |
| 142 | Ga0207680_10566605 | 3300025903 | Bacteria | 811 |
| 143 | Ga0207647_10158900 | 3300025904 | Bacteria | 1319 |
| 144 | Ga0207645_10300818 | 3300025907 | Bacteria | 1068 |
| 145 | Ga0207645_10402260 | 3300025907 | Bacteria | 921 |
| 146 | Ga0207705_10116403 | 3300025909 | Bacteria | 1979 |
| 147 | Ga0207707_10004351 | 3300025912 | Bacteria | 12529 |
| 148 | Ga0207707_10054355 | 3300025912 | Bacteria | 3486 |
| 149 | Ga0207695_10008488 | 3300025913 | Bacteria | 12845 |
| 150 | Ga0207695_10045285 | 3300025913 | Bacteria | 4671 |
| 151 | Ga0207671_10003314 | 3300025914 | Bacteria | 16185 |
| 152 | Ga0207671_10015750 | 3300025914 | Bacteria | 5906 |
| 153 | Ga0207671_10126173 | 3300025914 | Bacteria | 1961 |
| 154 | Ga0207660_10217004 | 3300025917 | Bacteria | 1500 |
| 155 | Ga0207657_10126602 | 3300025919 | Bacteria | 2098 |
| 156 | Ga0207649_10192085 | 3300025920 | Bacteria | 1437 |
| 157 | Ga0207649_10969097 | 3300025920 | Unclassified | 668 |
| 158 | Ga0207652_10217436 | 3300025921 | Bacteria | 1721 |
| 159 | Ga0207652_11052428 | 3300025921 | Bacteria | 713 |
| 160 | Ga0207646_10324718 | 3300025922 | Bacteria | 1390 |
| 161 | Ga0207646_10592786 | 3300025922 | Bacteria | 995 |
| 162 | Ga0207681_10229393 | 3300025923 | Bacteria | 1440 |
| 163 | Ga0207694_10092889 | 3300025924 | Bacteria | 2382 |
| 164 | Ga0207650_10558534 | 3300025925 | Bacteria | 960 |
| 165 | Ga0207650_10580939 | 3300025925 | Unclassified | 941 |
| 166 | Ga0207659_11153221 | 3300025926 | Bacteria | 666 |
| 167 | Ga0207706_10137714 | 3300025933 | Bacteria | 2147 |
| 168 | Ga0207706_10874593 | 3300025933 | Bacteria | 760 |
| 169 | Ga0207706_11098010 | 3300025933 | Bacteria | 665 |
| 170 | Ga0207686_10165571 | 3300025934 | Bacteria | 1554 |
| 171 | Ga0207691_10143217 | 3300025940 | Bacteria | 2105 |
| 172 | Ga0207691_10438984 | 3300025940 | Bacteria | 1111 |
| 173 | Ga0207691_10688414 | 3300025940 | Bacteria | 862 |
| 174 | Ga0207711_10058541 | 3300025941 | Plasmid | 3316 |
| 175 | Ga0207689_10088190 | 3300025942 | Bacteria | 2549 |
| 176 | Ga0207689_10197403 | 3300025942 | Bacteria | 1661 |
| 177 | Ga0207689_10664703 | 3300025942 | Bacteria | 878 |
| 178 | Ga0207661_10199908 | 3300025944 | Bacteria | 1757 |
| 179 | Ga0207679_10631868 | 3300025945 | Bacteria | 967 |
| 180 | Ga0207667_10043383 | 3300025949 | Bacteria | 4773 |
| 181 | Ga0207667_10536834 | 3300025949 | Bacteria | 1184 |
| 182 | Ga0207651_10267121 | 3300025960 | Bacteria | 1407 |
| 183 | Ga0207651_10322165 | 3300025960 | Bacteria | 1292 |
| 184 | Ga0207712_10006327 | 3300025961 | Bacteria | 7469 |
| 185 | Ga0207712_10519514 | 3300025961 | Bacteria | 1020 |
| 186 | Ga0207640_10604524 | 3300025981 | Bacteria | 929 |
| 187 | Ga0207640_10979420 | 3300025981 | Bacteria | 743 |
| 188 | Ga0207658_10140865 | 3300025986 | Bacteria | 1951 |
| 189 | Ga0207658_10377237 | 3300025986 | Bacteria | 1241 |
| 190 | Ga0207703_10185681 | 3300026035 | Bacteria | 1838 |
| 191 | Ga0207639_10055215 | 3300026041 | Bacteria | 3039 |
| 192 | Ga0207639_10472807 | 3300026041 | Bacteria | 1141 |
| 193 | Ga0207708_10177086 | 3300026075 | Bacteria | 1692 |
| 194 | Ga0207641_10369928 | 3300026088 | Bacteria | 1370 |
| 195 | Ga0207648_10207934 | 3300026089 | Bacteria | 1737 |
| 196 | Ga0207648_10646450 | 3300026089 | Bacteria | 977 |
| 197 | Ga0207674_10034538 | 3300026116 | Bacteria | 5284 |
| 198 | Ga0207675_100243520 | 3300026118 | Bacteria | 1738 |
| 199 | Ga0207675_100390755 | 3300026118 | Bacteria | 1369 |
| 200 | Ga0207683_10141153 | 3300026121 | Bacteria | 2171 |
| 201 | Ga0209968_1036611 | 3300027526 | Bacteria | 831 |
| 202 | Ga0268266_10157107 | 3300028379 | Bacteria | 2055 |
| 203 | Ga0268265_10388340 | 3300028380 | Bacteria | 1286 |
| 204 | Ga0268265_10761454 | 3300028380 | Bacteria | 941 |
| 205 | Ga0268265_11885674 | 3300028380 | Bacteria | 604 |
| 206 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 207 | Ga0268264_10000019 | 3300028381 | Bacteria | 488112 |
| 208 | Ga0268264_10000054 | 3300028381 | Bacteria | 317048 |
| 209 | Ga0268264_10563124 | 3300028381 | Bacteria | 1119 |
| 210 | Ga0265327_10002463 | 3300031251 | Bacteria | 19492 |
| 211 | Ga0307513_10147908 | 3300031456 | Bacteria | 2264 |
| 212 | Ga0307408_100008172 | 3300031548 | Bacteria | 6911 |
| 213 | Ga0307408_100910530 | 3300031548 | Unclassified | 805 |
| 214 | Ga0307516_10268537 | 3300031730 | Bacteria | 1393 |
| 215 | Ga0307413_10072299 | 3300031824 | Bacteria | 2177 |
| 216 | Ga0307413_10161578 | 3300031824 | Unclassified | 1574 |
| 217 | Ga0307413_10210952 | 3300031824 | Bacteria | 1410 |
| 218 | Ga0307410_10031968 | 3300031852 | Unclassified | 3381 |
| 219 | Ga0307410_10040110 | 3300031852 | Bacteria | 3079 |
| 220 | Ga0307410_10086505 | 3300031852 | Bacteria | 2214 |
| 221 | Ga0307406_10015702 | 3300031901 | Bacteria | 4389 |
| 222 | Ga0307406_10078261 | 3300031901 | Bacteria | 2190 |
| 223 | Ga0307407_10047029 | 3300031903 | Bacteria | 2446 |
| 224 | Ga0307407_10066811 | 3300031903 | Bacteria | 2122 |
| 225 | Ga0307407_10373232 | 3300031903 | Bacteria | 1016 |
| 226 | Ga0307412_10136438 | 3300031911 | Bacteria | 1791 |
| 227 | Ga0307412_10429055 | 3300031911 | Bacteria | 1083 |
| 228 | Ga0307409_100047040 | 3300031995 | Bacteria | 3271 |
| 229 | Ga0307409_100200814 | 3300031995 | Unclassified | 1783 |
| 230 | Ga0307409_100348385 | 3300031995 | Bacteria | 1397 |
| 231 | Ga0307409_100513991 | 3300031995 | Bacteria | 1169 |
| 232 | Ga0307409_100820637 | 3300031995 | Bacteria | 939 |
| 233 | Ga0307409_101381385 | 3300031995 | Unclassified | 730 |
| 234 | Ga0307416_100592587 | 3300032002 | Bacteria | 1187 |
| 235 | Ga0307416_100987863 | 3300032002 | Unclassified | 944 |
| 236 | Ga0307414_10319277 | 3300032004 | Bacteria | 1321 |
| 237 | Ga0307414_10378953 | 3300032004 | Bacteria | 1222 |
| 238 | Ga0307411_10003392 | 3300032005 | Bacteria | 7380 |
| 239 | Ga0307411_10096653 | 3300032005 | Bacteria | 2077 |
| 240 | Ga0307411_10102941 | 3300032005 | Unclassified | 2024 |
| 241 | Ga0307411_10558348 | 3300032005 | Bacteria | 978 |
| 242 | Ga0307415_100035964 | 3300032126 | Unclassified | 3240 |
| 243 | Ga0307415_100439810 | 3300032126 | Unclassified | 1124 |
| 244 | Ga0307510_10006020 | 3300033180 | Bacteria | 14470 |
| 245 | Ga0373950_0061321 | 3300034818 | Bacteria | 756 |
| 246 | Ga0395900_0700163 | 3300037418 | Bacteria | 947 |
| 247 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 248 | Ga0395905_0669924 | 3300037471 | Bacteria | 940 |
| 249 | Ga0395905_0740722 | 3300037471 | Bacteria | 885 |
| 250 | Ga0395905_1278226 | 3300037471 | Bacteria | 637 |
| 251 | Ga0451789_0574475 | 3300041443 | Bacteria | 657 |
| 252 | Ga0451798_1133423 | 3300041458 | Bacteria | 781 |
| 253 | Ga0451804_0672434 | 3300041463 | Bacteria | 969 |
| 254 | Ga0451807_1345623 | 3300041486 | Bacteria | 629 |
| 255 | Ga0451835_0679064 | 3300041492 | Bacteria | 789 |
| 256 | Ga0439449_0122647 | 3300042007 | Bacteria | 965 |
| 257 | Ga0439457_013242 | 3300042014 | Bacteria | 1854 |
| 258 | Ga0439462_0007020 | 3300042015 | Bacteria | 2815 |
| 259 | Ga0466957_0001789 | 3300044842 | Bacteria | 11316 |
| 260 | Ga0466957_1075175 | 3300044842 | Bacteria | 580 |
| 261 | Ga0495638_0102001 | 3300046460 | Bacteria | 1715 |
| 262 | Ga0495650_0025828 | 3300046471 | Bacteria | 2744 |
| 263 | Ga0495598_0220329 | 3300046537 | Bacteria | 692 |
| 264 | Ga0495621_0095139 | 3300046539 | Bacteria | 1128 |
| 265 | Ga0495625_0001321 | 3300046660 | Bacteria | 30823 |
| 266 | Ga0495672_0033756 | 3300047320 | Bacteria | 3168 |
| 267 | Ga0495672_0100640 | 3300047320 | Bacteria | 1568 |
| 268 | Ga0501207_086726 | 3300049654 | Unclassified | 610 |
| 269 | Ga0501217_054548 | 3300049661 | Bacteria | 1053 |
| 270 | Ga0501233_058171 | 3300049668 | Bacteria | 953 |
| 271 | Ga0501233_071716 | 3300049668 | Unclassified | 878 |
| 272 | Ga0501235_012398 | 3300049669 | Bacteria | 1875 |
| 273 | Ga0501239_007378 | 3300049672 | Bacteria | 1151 |
| 274 | Ga0501260_028651 | 3300049689 | Bacteria | 633 |
| 275 | Ga0501221_188472 | 3300049704 | Unclassified | 568 |
| 276 | Ga0501225_0003849 | 3300049705 | Unclassified | 4503 |
| 277 | Ga0501225_0101102 | 3300049705 | Unclassified | 842 |
| 278 | Ga0501245_051691 | 3300049708 | Unclassified | 730 |
| 279 | Ga0501268_017538 | 3300049765 | Bacteria | 1195 |
| 280 | Ga0501270_014610 | 3300049767 | Unclassified | 1108 |
| 281 | nmdc:mga05p37_428031_c1 | 3300050507 | Bacteria | 1538 |
| 282 | nmdc:mga09592_232197_c1 | 3300050508 | Bacteria | 1599 |
| 283 | nmdc:mga0qj67_77243_c1 | 3300050509 | Bacteria | 2664 |
| 284 | nmdc:mga06r32_103035_c1 | 3300050510 | Bacteria | 2802 |
| 285 | nmdc:mga08y16_1026237_c1 | 3300050511 | Bacteria | 803 |
| 286 | nmdc:mga08y16_289801_c1 | 3300050511 | Bacteria | 1688 |
| 287 | Ga0500578_0131115 | 3300053086 | Bacteria | 1572 |
| 288 | Ga0500628_099568 | 3300053129 | Bacteria | 768 |
| 289 | Ga0500611_000037 | 3300053727 | Bacteria | 72513 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_101046925 | Ga0070683_1010469251 | 150 |
| 2 | 3300005344 | Ga0070661_100796456 | Ga0070661_1007964561 | 150 |
| 3 | 3300005355 | Ga0070671_100435536 | Ga0070671_1004355362 | 150 |
| 4 | 3300005364 | Ga0070673_100981337 | Ga0070673_1009813372 | 150 |
| 5 | 3300005535 | Ga0070684_100698596 | Ga0070684_1006985961 | 150 |
| 6 | 3300005578 | Ga0068854_101558466 | Ga0068854_1015584661 | 150 |
| 7 | 3300013296 | Ga0157374_10192317 | Ga0157374_101923173 | 150 |
| 8 | 3300013306 | Ga0163162_10082817 | Ga0163162_100828173 | 150 |
| 9 | 3300025920 | Ga0207649_10969097 | Ga0207649_109690971 | 150 |
| 10 | 3300025926 | Ga0207659_11153221 | Ga0207659_111532212 | 150 |
| 11 | 3300025940 | Ga0207691_10143217 | Ga0207691_101432175 | 150 |
| 12 | 3300025944 | Ga0207661_10199908 | Ga0207661_101999082 | 150 |
| 13 | 3300025945 | Ga0207679_10631868 | Ga0207679_106318681 | 150 |
| 14 | 3300025981 | Ga0207640_10979420 | Ga0207640_109794201 | 150 |
| 15 | 3300005329 | Ga0070683_101161632 | Ga0070683_1011616321 | 152 |
| 16 | 3300005336 | Ga0070680_100086766 | Ga0070680_1000867664 | 152 |
| 17 | 3300005344 | Ga0070661_100059917 | Ga0070661_1000599173 | 152 |
| 18 | 3300005366 | Ga0070659_100023933 | Ga0070659_1000239333 | 152 |
| 19 | 3300005458 | Ga0070681_10228557 | Ga0070681_102285572 | 152 |
| 20 | 3300005577 | Ga0068857_100049348 | Ga0068857_1000493486 | 152 |
| 21 | 3300005578 | Ga0068854_100124670 | Ga0068854_1001246701 | 152 |
| 22 | 3300005834 | Ga0068851_10068343 | Ga0068851_100683431 | 152 |
| 23 | 3300009093 | Ga0105240_10812663 | Ga0105240_108126632 | 152 |
| 24 | 3300013105 | Ga0157369_10293525 | Ga0157369_102935251 | 152 |
| 25 | 3300013307 | Ga0157372_10327163 | Ga0157372_103271633 | 152 |
| 26 | 3300025321 | Ga0207656_10108139 | Ga0207656_101081391 | 152 |
| 27 | 3300025912 | Ga0207707_10054355 | Ga0207707_100543552 | 152 |
| 28 | 3300025919 | Ga0207657_10126602 | Ga0207657_101266022 | 152 |
| 29 | 3300025920 | Ga0207649_10192085 | Ga0207649_101920852 | 152 |
| 30 | 3300025921 | Ga0207652_11052428 | Ga0207652_110524281 | 152 |
| 31 | 3300025981 | Ga0207640_10604524 | Ga0207640_106045241 | 152 |
| 32 | 3300026116 | Ga0207674_10034538 | Ga0207674_100345386 | 152 |
| 33 | 3300031995 | Ga0307409_100820637 | Ga0307409_1008206372 | 152 |
| 34 | 3300049767 | Ga0501270_014610 | Ga0501270_014610_26_487 | 152 |
| 35 | 3300005290 | Ga0065712_10321304 | Ga0065712_103213042 | 153 |
| 36 | 3300005293 | Ga0065715_10341684 | Ga0065715_103416842 | 153 |
| 37 | 3300005328 | Ga0070676_10321524 | Ga0070676_103215242 | 153 |
| 38 | 3300005331 | Ga0070670_100121058 | Ga0070670_1001210583 | 153 |
| 39 | 3300005331 | Ga0070670_100351490 | Ga0070670_1003514902 | 153 |
| 40 | 3300005364 | Ga0070673_100626248 | Ga0070673_1006262482 | 153 |
| 41 | 3300005455 | Ga0070663_100683725 | Ga0070663_1006837251 | 153 |
| 42 | 3300005457 | Ga0070662_100366851 | Ga0070662_1003668511 | 153 |
| 43 | 3300005457 | Ga0070662_100925262 | Ga0070662_1009252621 | 153 |
| 44 | 3300005457 | Ga0070662_100943442 | Ga0070662_1009434421 | 153 |
| 45 | 3300005539 | Ga0068853_100023893 | Ga0068853_1000238932 | 153 |
| 46 | 3300025903 | Ga0207680_10477651 | Ga0207680_104776511 | 153 |
| 47 | 3300025903 | Ga0207680_10565820 | Ga0207680_105658201 | 153 |
| 48 | 3300025907 | Ga0207645_10300818 | Ga0207645_103008182 | 153 |
| 49 | 3300025925 | Ga0207650_10580939 | Ga0207650_105809392 | 153 |
| 50 | 3300025933 | Ga0207706_10874593 | Ga0207706_108745931 | 153 |
| 51 | 3300031903 | Ga0307407_10373232 | Ga0307407_103732322 | 153 |
| 52 | 3300031911 | Ga0307412_10429055 | Ga0307412_104290552 | 153 |
| 53 | 3300037471 | Ga0395905_0669924 | Ga0395905_0669924_376_885 | 153 |
| 54 | 3300049668 | Ga0501233_071716 | Ga0501233_071716_229_741 | 153 |
| 55 | 3300005563 | Ga0068855_101000275 | Ga0068855_1010002752 | 154 |
| 56 | 3300005614 | Ga0068856_100270434 | Ga0068856_1002704342 | 154 |
| 57 | 3300005616 | Ga0068852_100094229 | Ga0068852_1000942294 | 154 |
| 58 | 3300025914 | Ga0207671_10126173 | Ga0207671_101261734 | 154 |
| 59 | 3300005366 | Ga0070659_100600489 | Ga0070659_1006004892 | 155 |
| 60 | 3300017792 | Ga0163161_10426129 | Ga0163161_104261292 | 155 |
| 61 | 3300025933 | Ga0207706_11098010 | Ga0207706_110980101 | 155 |
| 62 | 3300005539 | Ga0068853_100033399 | Ga0068853_1000333996 | 156 |
| 63 | 3300009174 | Ga0105241_10149296 | Ga0105241_101492964 | 156 |
| 64 | 3300013307 | Ga0157372_10489284 | Ga0157372_104892842 | 156 |
| 65 | 3300014326 | Ga0157380_11308140 | Ga0157380_113081402 | 156 |
| 66 | 3300005468 | Ga0070707_100157563 | Ga0070707_1001575634 | 157 |
| 67 | 3300032126 | Ga0307415_100439810 | Ga0307415_1004398102 | 157 |
| 68 | iso_pu_bacteria | 2585428187 | 2588231919 | 157 |
| 69 | 3300046660 | Ga0495625_0001321 | Ga0495625_0001321_16333_16818 | 158 |
| 70 | 3300005336 | Ga0070680_100083143 | Ga0070680_1000831433 | 159 |
| 71 | 3300005338 | Ga0068868_100873236 | Ga0068868_1008732361 | 159 |
| 72 | 3300005364 | Ga0070673_100514721 | Ga0070673_1005147212 | 159 |
| 73 | 3300005365 | Ga0070688_100998654 | Ga0070688_1009986541 | 159 |
| 74 | 3300005367 | Ga0070667_100119452 | Ga0070667_1001194522 | 159 |
| 75 | 3300005444 | Ga0070694_100169909 | Ga0070694_1001699092 | 159 |
| 76 | 3300005456 | Ga0070678_100907791 | Ga0070678_1009077911 | 159 |
| 77 | 3300005457 | Ga0070662_100167799 | Ga0070662_1001677993 | 159 |
| 78 | 3300005459 | Ga0068867_100293407 | Ga0068867_1002934072 | 159 |
| 79 | 3300005545 | Ga0070695_100097670 | Ga0070695_1000976702 | 159 |
| 80 | 3300005546 | Ga0070696_100135122 | Ga0070696_1001351222 | 159 |
| 81 | 3300005549 | Ga0070704_100562697 | Ga0070704_1005626971 | 159 |
| 82 | 3300005578 | Ga0068854_100074863 | Ga0068854_1000748632 | 159 |
| 83 | 3300005617 | Ga0068859_100051894 | Ga0068859_1000518943 | 159 |
| 84 | 3300005840 | Ga0068870_11078036 | Ga0068870_110780361 | 159 |
| 85 | 3300006931 | Ga0097620_100051893 | Ga0097620_1000518932 | 159 |
| 86 | 3300013100 | Ga0157373_10027671 | Ga0157373_100276713 | 159 |
| 87 | 3300013308 | Ga0157375_10027534 | Ga0157375_100275343 | 159 |
| 88 | 3300013308 | Ga0157375_10191982 | Ga0157375_101919823 | 159 |
| 89 | 3300014325 | Ga0163163_10339308 | Ga0163163_103393081 | 159 |
| 90 | 3300014326 | Ga0157380_10771919 | Ga0157380_107719191 | 159 |
| 91 | 3300025903 | Ga0207680_10566605 | Ga0207680_105666051 | 159 |
| 92 | 3300025904 | Ga0207647_10158900 | Ga0207647_101589002 | 159 |
| 93 | 3300025907 | Ga0207645_10402260 | Ga0207645_104022601 | 159 |
| 94 | 3300025917 | Ga0207660_10217004 | Ga0207660_102170042 | 159 |
| 95 | 3300025933 | Ga0207706_10137714 | Ga0207706_101377142 | 159 |
| 96 | 3300025940 | Ga0207691_10438984 | Ga0207691_104389841 | 159 |
| 97 | 3300025960 | Ga0207651_10322165 | Ga0207651_103221652 | 159 |
| 98 | 3300025986 | Ga0207658_10140865 | Ga0207658_101408652 | 159 |
| 99 | 3300026089 | Ga0207648_10207934 | Ga0207648_102079342 | 159 |
| 100 | 3300026118 | Ga0207675_100390755 | Ga0207675_1003907552 | 159 |
| 101 | 3300026121 | Ga0207683_10141153 | Ga0207683_101411533 | 159 |
| 102 | 3300028381 | Ga0268264_10563124 | Ga0268264_105631242 | 159 |
| 103 | 3300031824 | Ga0307413_10072299 | Ga0307413_100722993 | 159 |
| 104 | 3300031995 | Ga0307409_100348385 | Ga0307409_1003483851 | 159 |
| 105 | 3300032004 | Ga0307414_10319277 | Ga0307414_103192772 | 159 |
| 106 | 3300032005 | Ga0307411_10558348 | Ga0307411_105583482 | 159 |
| 107 | 3300037471 | Ga0395905_0000003 | Ga0395905_0000003_866880_867377 | 159 |
| 108 | 3300037471 | Ga0395905_0740722 | Ga0395905_0740722_193_684 | 159 |
| 109 | 3300005331 | Ga0070670_100127367 | Ga0070670_1001273672 | 160 |
| 110 | 3300005456 | Ga0070678_100066441 | Ga0070678_1000664411 | 160 |
| 111 | 3300005530 | Ga0070679_100939911 | Ga0070679_1009399111 | 160 |
| 112 | 3300005539 | Ga0068853_100925002 | Ga0068853_1009250021 | 160 |
| 113 | 3300005563 | Ga0068855_100167212 | Ga0068855_1001672123 | 160 |
| 114 | 3300005616 | Ga0068852_101272040 | Ga0068852_1012720402 | 160 |
| 115 | 3300009093 | Ga0105240_10009185 | Ga0105240_1000918513 | 160 |
| 116 | 3300009148 | Ga0105243_10314154 | Ga0105243_103141543 | 160 |
| 117 | 3300009545 | Ga0105237_10061861 | Ga0105237_100618612 | 160 |
| 118 | 3300010375 | Ga0105239_10031586 | Ga0105239_100315864 | 160 |
| 119 | 3300013308 | Ga0157375_10478143 | Ga0157375_104781431 | 160 |
| 120 | 3300025254 | Ga0209148_1044118 | Ga0209148_10441181 | 160 |
| 121 | 3300025272 | Ga0209455_1012474 | Ga0209455_10124743 | 160 |
| 122 | 3300025913 | Ga0207695_10008488 | Ga0207695_1000848813 | 160 |
| 123 | 3300025914 | Ga0207671_10015750 | Ga0207671_100157507 | 160 |
| 124 | 3300025925 | Ga0207650_10558534 | Ga0207650_105585341 | 160 |
| 125 | 3300025949 | Ga0207667_10536834 | Ga0207667_105368341 | 160 |
| 126 | 3300031251 | Ga0265327_10002463 | Ga0265327_1000246318 | 160 |
| 127 | 3300042014 | Ga0439457_013242 | Ga0439457_013242_688_1182 | 160 |
| 128 | 3300042015 | Ga0439462_0007020 | Ga0439462_0007020_962_1456 | 160 |
| 129 | 3300044842 | Ga0466957_0001789 | Ga0466957_0001789_5865_6359 | 160 |
| 130 | 3300005335 | Ga0070666_10250792 | Ga0070666_102507922 | 161 |
| 131 | 3300005336 | Ga0070680_100532181 | Ga0070680_1005321812 | 161 |
| 132 | 3300005347 | Ga0070668_101527210 | Ga0070668_1015272101 | 161 |
| 133 | 3300005364 | Ga0070673_100178909 | Ga0070673_1001789093 | 161 |
| 134 | 3300005459 | Ga0068867_100301602 | Ga0068867_1003016021 | 161 |
| 135 | 3300005471 | Ga0070698_100006677 | Ga0070698_10000667713 | 161 |
| 136 | 3300005471 | Ga0070698_100368055 | Ga0070698_1003680553 | 161 |
| 137 | 3300005530 | Ga0070679_100061836 | Ga0070679_1000618364 | 161 |
| 138 | 3300005841 | Ga0068863_100035033 | Ga0068863_1000350337 | 161 |
| 139 | 3300006237 | Ga0097621_100112299 | Ga0097621_1001122994 | 161 |
| 140 | 3300009093 | Ga0105240_10039076 | Ga0105240_100390765 | 161 |
| 141 | 3300009553 | Ga0105249_10010246 | Ga0105249_1001024613 | 161 |
| 142 | 3300013307 | Ga0157372_11709654 | Ga0157372_117096542 | 161 |
| 143 | 3300014325 | Ga0163163_11036311 | Ga0163163_110363112 | 161 |
| 144 | 3300025903 | Ga0207680_10210224 | Ga0207680_102102242 | 161 |
| 145 | 3300025913 | Ga0207695_10045285 | Ga0207695_100452853 | 161 |
| 146 | 3300025960 | Ga0207651_10267121 | Ga0207651_102671212 | 161 |
| 147 | 3300025961 | Ga0207712_10006327 | Ga0207712_1000632712 | 161 |
| 148 | 3300026088 | Ga0207641_10369928 | Ga0207641_103699282 | 161 |
| 149 | 3300026089 | Ga0207648_10646450 | Ga0207648_106464502 | 161 |
| 150 | 3300028380 | Ga0268265_11885674 | Ga0268265_118856741 | 161 |
| 151 | 3300031730 | Ga0307516_10268537 | Ga0307516_102685372 | 161 |
| 152 | 3300031852 | Ga0307410_10040110 | Ga0307410_100401102 | 161 |
| 153 | 3300031901 | Ga0307406_10015702 | Ga0307406_100157022 | 161 |
| 154 | 3300031903 | Ga0307407_10047029 | Ga0307407_100470294 | 161 |
| 155 | 3300031995 | Ga0307409_100047040 | Ga0307409_1000470403 | 161 |
| 156 | 3300031995 | Ga0307409_100513991 | Ga0307409_1005139913 | 161 |
| 157 | 3300033180 | Ga0307510_10006020 | Ga0307510_100060204 | 161 |
| 158 | 3300046471 | Ga0495650_0025828 | Ga0495650_0025828_409_906 | 161 |
| 159 | 3300047320 | Ga0495672_0033756 | Ga0495672_0033756_1428_1925 | 161 |
| 160 | 3300050511 | nmdc:mga08y16_1026237_c1 | nmdc:mga08y16_1026237_c1_276_773 | 161 |
| 161 | 3300005289 | Ga0065704_10440797 | Ga0065704_104407971 | 162 |
| 162 | 3300005334 | Ga0068869_100228817 | Ga0068869_1002288173 | 162 |
| 163 | 3300005340 | Ga0070689_100781375 | Ga0070689_1007813752 | 162 |
| 164 | 3300005367 | Ga0070667_100240369 | Ga0070667_1002403692 | 162 |
| 165 | 3300005459 | Ga0068867_100301602 | Ga0068867_1003016022 | 162 |
| 166 | 3300005468 | Ga0070707_100157563 | Ga0070707_1001575632 | 162 |
| 167 | 3300005518 | Ga0070699_100381311 | Ga0070699_1003813112 | 162 |
| 168 | 3300005539 | Ga0068853_100016182 | Ga0068853_1000161827 | 162 |
| 169 | 3300005539 | Ga0068853_100045747 | Ga0068853_1000457474 | 162 |
| 170 | 3300005544 | Ga0070686_100171183 | Ga0070686_1001711832 | 162 |
| 171 | 3300005544 | Ga0070686_100214058 | Ga0070686_1002140583 | 162 |
| 172 | 3300005616 | Ga0068852_100741408 | Ga0068852_1007414082 | 162 |
| 173 | 3300005840 | Ga0068870_10161949 | Ga0068870_101619491 | 162 |
| 174 | 3300005842 | Ga0068858_100140749 | Ga0068858_1001407495 | 162 |
| 175 | 3300005843 | Ga0068860_100000218 | Ga0068860_10000021836 | 162 |
| 176 | 3300005844 | Ga0068862_100174682 | Ga0068862_1001746822 | 162 |
| 177 | 3300006844 | Ga0075428_100102014 | Ga0075428_1001020145 | 162 |
| 178 | 3300006846 | Ga0075430_100006345 | Ga0075430_1000063452 | 162 |
| 179 | 3300006847 | Ga0075431_100105332 | Ga0075431_1001053324 | 162 |
| 180 | 3300006852 | Ga0075433_10960811 | Ga0075433_109608112 | 162 |
| 181 | 3300009094 | Ga0111539_11398288 | Ga0111539_113982882 | 162 |
| 182 | 3300009147 | Ga0114129_10200659 | Ga0114129_102006594 | 162 |
| 183 | 3300009545 | Ga0105237_10051778 | Ga0105237_100517785 | 162 |
| 184 | 3300009551 | Ga0105238_10033177 | Ga0105238_100331774 | 162 |
| 185 | 3300010375 | Ga0105239_10000146 | Ga0105239_100001468 | 162 |
| 186 | 3300013102 | Ga0157371_10717692 | Ga0157371_107176922 | 162 |
| 187 | 3300013306 | Ga0163162_10001254 | Ga0163162_100012547 | 162 |
| 188 | 3300014326 | Ga0157380_10093576 | Ga0157380_100935763 | 162 |
| 189 | 3300014745 | Ga0157377_10333381 | Ga0157377_103333812 | 162 |
| 190 | 3300025914 | Ga0207671_10003314 | Ga0207671_1000331425 | 162 |
| 191 | 3300025922 | Ga0207646_10592786 | Ga0207646_105927862 | 162 |
| 192 | 3300025924 | Ga0207694_10092889 | Ga0207694_100928893 | 162 |
| 193 | 3300025942 | Ga0207689_10088190 | Ga0207689_100881903 | 162 |
| 194 | 3300025942 | Ga0207689_10197403 | Ga0207689_101974032 | 162 |
| 195 | 3300025949 | Ga0207667_10043383 | Ga0207667_100433835 | 162 |
| 196 | 3300025961 | Ga0207712_10519514 | Ga0207712_105195142 | 162 |
| 197 | 3300025986 | Ga0207658_10377237 | Ga0207658_103772372 | 162 |
| 198 | 3300026035 | Ga0207703_10185681 | Ga0207703_101856813 | 162 |
| 199 | 3300026041 | Ga0207639_10055215 | Ga0207639_100552154 | 162 |
| 200 | 3300026041 | Ga0207639_10472807 | Ga0207639_104728071 | 162 |
| 201 | 3300026075 | Ga0207708_10177086 | Ga0207708_101770862 | 162 |
| 202 | 3300027526 | Ga0209968_1036611 | Ga0209968_10366111 | 162 |
| 203 | 3300028379 | Ga0268266_10157107 | Ga0268266_101571073 | 162 |
| 204 | 3300028380 | Ga0268265_10388340 | Ga0268265_103883402 | 162 |
| 205 | 3300028380 | Ga0268265_10761454 | Ga0268265_107614542 | 162 |
| 206 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015216 | 162 |
| 207 | 3300028381 | Ga0268264_10000019 | Ga0268264_10000019312 | 162 |
| 208 | 3300028381 | Ga0268264_10000054 | Ga0268264_1000005461 | 162 |
| 209 | 3300031456 | Ga0307513_10147908 | Ga0307513_101479082 | 162 |
| 210 | 3300031548 | Ga0307408_100008172 | Ga0307408_1000081722 | 162 |
| 211 | 3300031548 | Ga0307408_100910530 | Ga0307408_1009105302 | 162 |
| 212 | 3300031824 | Ga0307413_10161578 | Ga0307413_101615781 | 162 |
| 213 | 3300031824 | Ga0307413_10210952 | Ga0307413_102109522 | 162 |
| 214 | 3300031852 | Ga0307410_10031968 | Ga0307410_100319684 | 162 |
| 215 | 3300031852 | Ga0307410_10086505 | Ga0307410_100865053 | 162 |
| 216 | 3300031901 | Ga0307406_10078261 | Ga0307406_100782612 | 162 |
| 217 | 3300031903 | Ga0307407_10066811 | Ga0307407_100668112 | 162 |
| 218 | 3300031995 | Ga0307409_100200814 | Ga0307409_1002008143 | 162 |
| 219 | 3300031995 | Ga0307409_101381385 | Ga0307409_1013813852 | 162 |
| 220 | 3300032002 | Ga0307416_100592587 | Ga0307416_1005925872 | 162 |
| 221 | 3300032002 | Ga0307416_100987863 | Ga0307416_1009878632 | 162 |
| 222 | 3300032005 | Ga0307411_10003392 | Ga0307411_1000339215 | 162 |
| 223 | 3300032005 | Ga0307411_10102941 | Ga0307411_101029413 | 162 |
| 224 | 3300032126 | Ga0307415_100035964 | Ga0307415_1000359642 | 162 |
| 225 | 3300034818 | Ga0373950_0061321 | Ga0373950_0061321_19_507 | 162 |
| 226 | 3300037418 | Ga0395900_0700163 | Ga0395900_0700163_415_909 | 162 |
| 227 | 3300041443 | Ga0451789_0574475 | Ga0451789_0574475_104_604 | 162 |
| 228 | 3300041458 | Ga0451798_1133423 | Ga0451798_1133423_20_520 | 162 |
| 229 | 3300041463 | Ga0451804_0672434 | Ga0451804_0672434_24_524 | 162 |
| 230 | 3300041492 | Ga0451835_0679064 | Ga0451835_0679064_250_747 | 162 |
| 231 | 3300042007 | Ga0439449_0122647 | Ga0439449_0122647_183_683 | 162 |
| 232 | 3300046460 | Ga0495638_0102001 | Ga0495638_0102001_651_1157 | 162 |
| 233 | 3300046537 | Ga0495598_0220329 | Ga0495598_0220329_10_510 | 162 |
| 234 | 3300046539 | Ga0495621_0095139 | Ga0495621_0095139_192_692 | 162 |
| 235 | 3300047320 | Ga0495672_0033756 | Ga0495672_0033756_1985_2491 | 162 |
| 236 | 3300049654 | Ga0501207_086726 | Ga0501207_086726_88_579 | 162 |
| 237 | 3300049661 | Ga0501217_054548 | Ga0501217_054548_455_946 | 162 |
| 238 | 3300049668 | Ga0501233_058171 | Ga0501233_058171_22_513 | 162 |
| 239 | 3300049669 | Ga0501235_012398 | Ga0501235_012398_366_857 | 162 |
| 240 | 3300049672 | Ga0501239_007378 | Ga0501239_007378_25_516 | 162 |
| 241 | 3300049704 | Ga0501221_188472 | Ga0501221_188472_17_508 | 162 |
| 242 | 3300049705 | Ga0501225_0101102 | Ga0501225_0101102_318_809 | 162 |
| 243 | 3300049708 | Ga0501245_051691 | Ga0501245_051691_197_688 | 162 |
| 244 | 3300049765 | Ga0501268_017538 | Ga0501268_017538_163_654 | 162 |
| 245 | 3300050507 | nmdc:mga05p37_428031_c1 | nmdc:mga05p37_428031_c1_488_988 | 162 |
| 246 | 3300050508 | nmdc:mga09592_232197_c1 | nmdc:mga09592_232197_c1_268_768 | 162 |
| 247 | 3300050509 | nmdc:mga0qj67_77243_c1 | nmdc:mga0qj67_77243_c1_1600_2100 | 162 |
| 248 | 3300050510 | nmdc:mga06r32_103035_c1 | nmdc:mga06r32_103035_c1_1807_2307 | 162 |
| 249 | 3300053129 | Ga0500628_099568 | Ga0500628_099568_124_651 | 162 |
| 250 | 3300053727 | Ga0500611_000037 | Ga0500611_000037_9972_10478 | 162 |
| 251 | 3300005289 | Ga0065704_10124968 | Ga0065704_101249683 | 163 |
| 252 | 3300005327 | Ga0070658_10027667 | Ga0070658_100276675 | 163 |
| 253 | 3300005334 | Ga0068869_100738697 | Ga0068869_1007386971 | 163 |
| 254 | 3300005356 | Ga0070674_101195560 | Ga0070674_1011955601 | 163 |
| 255 | 3300005458 | Ga0070681_10141920 | Ga0070681_101419202 | 163 |
| 256 | 3300013102 | Ga0157371_10170911 | Ga0157371_101709112 | 163 |
| 257 | 3300013105 | Ga0157369_10663988 | Ga0157369_106639882 | 163 |
| 258 | 3300013307 | Ga0157372_12443419 | Ga0157372_124434191 | 163 |
| 259 | 3300014326 | Ga0157380_10093576 | Ga0157380_100935764 | 163 |
| 260 | 3300014968 | Ga0157379_10328207 | Ga0157379_103282072 | 163 |
| 261 | 3300025909 | Ga0207705_10116403 | Ga0207705_101164033 | 163 |
| 262 | 3300025922 | Ga0207646_10324718 | Ga0207646_103247182 | 163 |
| 263 | 3300025942 | Ga0207689_10664703 | Ga0207689_106647032 | 163 |
| 264 | 3300031911 | Ga0307412_10136438 | Ga0307412_101364382 | 163 |
| 265 | 3300032004 | Ga0307414_10378953 | Ga0307414_103789531 | 163 |
| 266 | 3300032005 | Ga0307411_10096653 | Ga0307411_100966533 | 163 |
| 267 | 3300041486 | Ga0451807_1345623 | Ga0451807_1345623_52_543 | 163 |
| 268 | 3300044842 | Ga0466957_1075175 | Ga0466957_1075175_41_550 | 163 |
| 269 | 3300053086 | Ga0500578_0131115 | Ga0500578_0131115_244_747 | 163 |
| 270 | 3300002076 | JGI24749J21850_1037558 | JGI24749J21850_10375581 | 164 |
| 271 | 3300005334 | Ga0068869_100512852 | Ga0068869_1005128522 | 164 |
| 272 | 3300005353 | Ga0070669_100256196 | Ga0070669_1002561963 | 164 |
| 273 | 3300005367 | Ga0070667_100119452 | Ga0070667_1001194523 | 164 |
| 274 | 3300005459 | Ga0068867_101221022 | Ga0068867_1012210222 | 164 |
| 275 | 3300005543 | Ga0070672_100790106 | Ga0070672_1007901062 | 164 |
| 276 | 3300005617 | Ga0068859_100000128 | Ga0068859_1000001283 | 164 |
| 277 | 3300006931 | Ga0097620_100000128 | Ga0097620_10000012856 | 164 |
| 278 | 3300013296 | Ga0157374_10048982 | Ga0157374_100489822 | 164 |
| 279 | 3300013296 | Ga0157374_10447333 | Ga0157374_104473333 | 164 |
| 280 | 3300013297 | Ga0157378_10048916 | Ga0157378_100489164 | 164 |
| 281 | 3300013308 | Ga0157375_10027534 | Ga0157375_100275342 | 164 |
| 282 | 3300014325 | Ga0163163_10711298 | Ga0163163_107112982 | 164 |
| 283 | 3300017792 | Ga0163161_11625089 | Ga0163161_116250891 | 164 |
| 284 | 3300025899 | Ga0207642_10138388 | Ga0207642_101383883 | 164 |
| 285 | 3300025912 | Ga0207707_10004351 | Ga0207707_100043519 | 164 |
| 286 | 3300025921 | Ga0207652_10217436 | Ga0207652_102174362 | 164 |
| 287 | 3300025923 | Ga0207681_10229393 | Ga0207681_102293933 | 164 |
| 288 | 3300025934 | Ga0207686_10165571 | Ga0207686_101655712 | 164 |
| 289 | 3300025940 | Ga0207691_10688414 | Ga0207691_106884142 | 164 |
| 290 | 3300025941 | Ga0207711_10058541 | Ga0207711_100585415 | 164 |
| 291 | 3300025986 | Ga0207658_10140865 | Ga0207658_101408653 | 164 |
| 292 | 3300026118 | Ga0207675_100243520 | Ga0207675_1002435203 | 164 |
| 293 | 3300037471 | Ga0395905_1278226 | Ga0395905_1278226_49_549 | 164 |
| 294 | 3300047320 | Ga0495672_0100640 | Ga0495672_0100640_547_1071 | 164 |
| 295 | 3300049689 | Ga0501260_028651 | Ga0501260_028651_101_601 | 164 |
| 296 | 3300049705 | Ga0501225_0003849 | Ga0501225_0003849_1383_1883 | 164 |
| 297 | 3300050511 | nmdc:mga08y16_289801_c1 | nmdc:mga08y16_289801_c1_943_1455 | 164 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ldk-assembly1.cif.gz_A | solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 | 0.9394 | 4 | 158 |
| 3uid-assembly2.cif.gz_B | crystal structure of protein ms6760 from mycobacterium smegmatis | 0.9282 | 2 | 159 |
| 1xuv-assembly2.cif.gz_B-2 | x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. | 0.9187 | 1 | 164 |
| 3pu2-assembly3.cif.gz_C | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9183 | 2 | 159 |
| 3uid-assembly2.cif.gz_B | crystal structure of protein ms6760 from mycobacterium smegmatis | 0.9169 | 2 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ldkA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9394 | 4 | 158 | 3.30.530.20 |
| 3uidB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9282 | 2 | 159 | 3.30.530.20 |
| af_Q2G1U9_1_155_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.918 | 1 | 156 | 3.30.530.20 |
| 3uidB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9169 | 2 | 159 | 3.30.530.20 |
| 1xuvB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9094 | 1 | 162 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8RZT3-F1-model_v4 | ATPase | 1.001 | 1 | 161 |
|
| AF-A0A519TKH9-F1-model_v4 | SRPBCC domain-containing protein | 0.9961 | 2 | 160 |
|
| AF-A0A0C1G306-F1-model_v4 | deleted | 0.9921 | 2 | 161 |
|
| AF-L0G2K8-F1-model_v4 | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein | 0.9898 | 2 | 157 |
|
| AF-A0A1Z5SK56-F1-model_v4 | ATPase | 0.9895 | 2 | 156 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar