F393572

General Info

Members Datasets Scaffolds Average Seq Length
297 176 289 163

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_101195560|Ga0070674_1011955601
Length 183
Sequence MNNLLFDFTVDKATKTVSITREFDAELSLVWDAFTKKEILDQWWAPKPFASKTKVMDFKVGGRRFYAMVSPEGQERWVIQKYTSISPKTNFKFFNAFADENENPELPGSEWDHTFSEQNGMTKVSVTIYNESLERMEKQIEMGFKEGFTMTLNYLDELLETLSKMIPLPIGIVFKISLKFLRK

Samples

Sample ID Description Type Environment
1 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
140 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
144 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
145 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
159 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
162 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
163 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
164 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
167 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
168 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
176 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 1.35
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1037558 3300002076 Unclassified 705
2 Ga0065704_10124968 3300005289 Bacteria 1710
3 Ga0065704_10440797 3300005289 Unclassified 714
4 Ga0065712_10321304 3300005290 Bacteria 801
5 Ga0065715_10341684 3300005293 Unclassified 966
6 Ga0070658_10027667 3300005327 Bacteria 4549
7 Ga0070676_10321524 3300005328 Bacteria 1055
8 Ga0070683_101046925 3300005329 Bacteria 784
9 Ga0070683_101161632 3300005329 Bacteria 742
10 Ga0070670_100121058 3300005331 Unclassified 2257
11 Ga0070670_100127367 3300005331 Bacteria 2198
12 Ga0070670_100351490 3300005331 Bacteria 1295
13 Ga0068869_100228817 3300005334 Bacteria 1477
14 Ga0068869_100512852 3300005334 Bacteria 1003
15 Ga0068869_100738697 3300005334 Bacteria 842
16 Ga0070666_10250792 3300005335 Bacteria 1253
17 Ga0070680_100083143 3300005336 Bacteria 2643
18 Ga0070680_100086766 3300005336 Unclassified 2587
19 Ga0070680_100532181 3300005336 Bacteria 1006
20 Ga0068868_100873236 3300005338 Bacteria 816
21 Ga0070689_100781375 3300005340 Bacteria 839
22 Ga0070661_100059917 3300005344 Unclassified 2793
23 Ga0070661_100796456 3300005344 Unclassified 775
24 Ga0070668_101527210 3300005347 Bacteria 611
25 Ga0070669_100256196 3300005353 Bacteria 1395
26 Ga0070671_100435536 3300005355 Bacteria 1124
27 Ga0070674_101195560 3300005356 Bacteria 675
28 Ga0070673_100178909 3300005364 Bacteria 1815
29 Ga0070673_100514721 3300005364 Bacteria 1084
30 Ga0070673_100626248 3300005364 Bacteria 983
31 Ga0070673_100981337 3300005364 Bacteria 786
32 Ga0070688_100998654 3300005365 Bacteria 665
33 Ga0070659_100023933 3300005366 Unclassified 4678
34 Ga0070659_100600489 3300005366 Bacteria 946
35 Ga0070667_100119452 3300005367 Bacteria 2292
36 Ga0070667_100240369 3300005367 Bacteria 1617
37 Ga0070694_100169909 3300005444 Bacteria 1605
38 Ga0070663_100683725 3300005455 Bacteria 871
39 Ga0070678_100066441 3300005456 Bacteria 2681
40 Ga0070678_100907791 3300005456 Bacteria 806
41 Ga0070662_100167799 3300005457 Bacteria 1721
42 Ga0070662_100366851 3300005457 Bacteria 1183
43 Ga0070662_100925262 3300005457 Bacteria 745
44 Ga0070662_100943442 3300005457 Bacteria 737
45 Ga0070681_10141920 3300005458 Bacteria 2331
46 Ga0070681_10228557 3300005458 Bacteria 1775
47 Ga0068867_100293407 3300005459 Bacteria 1338
48 Ga0068867_100301602 3300005459 Bacteria 1321
49 Ga0068867_101221022 3300005459 Bacteria 691
50 Ga0070707_100157563 3300005468 Bacteria 2212
51 Ga0070698_100006677 3300005471 Bacteria 12513
52 Ga0070698_100368055 3300005471 Bacteria 1369
53 Ga0070699_100381311 3300005518 Bacteria 1273
54 Ga0070679_100061836 3300005530 Bacteria 3733
55 Ga0070679_100939911 3300005530 Bacteria 808
56 Ga0070684_100698596 3300005535 Bacteria 946
57 Ga0068853_100016182 3300005539 Bacteria 6135
58 Ga0068853_100023893 3300005539 Bacteria 5122
59 Ga0068853_100033399 3300005539 Bacteria 4365
60 Ga0068853_100045747 3300005539 Bacteria 3750
61 Ga0068853_100925002 3300005539 Bacteria 838
62 Ga0070672_100790106 3300005543 Bacteria 835
63 Ga0070686_100171183 3300005544 Bacteria 1536
64 Ga0070686_100214058 3300005544 Bacteria 1389
65 Ga0070695_100097670 3300005545 Bacteria 1972
66 Ga0070696_100135122 3300005546 Bacteria 1797
67 Ga0070704_100562697 3300005549 Bacteria 997
68 Ga0068855_100167212 3300005563 Bacteria 2492
69 Ga0068855_101000275 3300005563 Bacteria 879
70 Ga0068857_100049348 3300005577 Bacteria 3734
71 Ga0068854_100074863 3300005578 Bacteria 2484
72 Ga0068854_100124670 3300005578 Bacteria 1960
73 Ga0068854_101558466 3300005578 Bacteria 601
74 Ga0068856_100270434 3300005614 Bacteria 1715
75 Ga0068852_100094229 3300005616 Bacteria 2685
76 Ga0068852_100741408 3300005616 Bacteria 994
77 Ga0068852_101272040 3300005616 Bacteria 757
78 Ga0068859_100000128 3300005617 Bacteria 72119
79 Ga0068859_100051894 3300005617 Bacteria 4123
80 Ga0068851_10068343 3300005834 Bacteria 1834
81 Ga0068870_10161949 3300005840 Bacteria 1328
82 Ga0068870_11078036 3300005840 Bacteria 577
83 Ga0068863_100035033 3300005841 Bacteria 4782
84 Ga0068858_100140749 3300005842 Bacteria 2265
85 Ga0068860_100000218 3300005843 Bacteria 90001
86 Ga0068862_100174682 3300005844 Bacteria 1925
87 Ga0097621_100112299 3300006237 Bacteria 2304
88 Ga0075428_100102014 3300006844 Bacteria 3128
89 Ga0075430_100006345 3300006846 Bacteria 9974
90 Ga0075431_100105332 3300006847 Bacteria 2910
91 Ga0075433_10960811 3300006852 Bacteria 745
92 Ga0097620_100000128 3300006931 Bacteria 72119
93 Ga0097620_100051893 3300006931 Bacteria 4123
94 Ga0105240_10009185 3300009093 Bacteria 14021
95 Ga0105240_10039076 3300009093 Bacteria 6080
96 Ga0105240_10812663 3300009093 Bacteria 1012
97 Ga0111539_11398288 3300009094 Bacteria 812
98 Ga0114129_10200659 3300009147 Bacteria 2702
99 Ga0105243_10314154 3300009148 Bacteria 1425
100 Ga0105241_10149296 3300009174 Bacteria 1910
101 Ga0105237_10051778 3300009545 Bacteria 4124
102 Ga0105237_10061861 3300009545 Bacteria 3742
103 Ga0105238_10033177 3300009551 Bacteria 5254
104 Ga0105249_10010246 3300009553 Bacteria 8232
105 Ga0105239_10000146 3300010375 Bacteria 101177
106 Ga0105239_10031586 3300010375 Bacteria 5822
107 Ga0157373_10027671 3300013100 Bacteria 4090
108 Ga0157371_10170911 3300013102 Bacteria 1553
109 Ga0157371_10717692 3300013102 Bacteria 749
110 Ga0157369_10293525 3300013105 Unclassified 1692
111 Ga0157369_10663988 3300013105 Bacteria 1075
112 Ga0157374_10048982 3300013296 Bacteria 3922
113 Ga0157374_10192317 3300013296 Bacteria 1996
114 Ga0157374_10447333 3300013296 Bacteria 1293
115 Ga0157378_10048916 3300013297 Bacteria 3761
116 Ga0163162_10001254 3300013306 Bacteria 23756
117 Ga0163162_10082817 3300013306 Bacteria 3281
118 Ga0157372_10327163 3300013307 Bacteria 1784
119 Ga0157372_10489284 3300013307 Bacteria 1434
120 Ga0157372_11709654 3300013307 Unclassified 724
121 Ga0157372_12443419 3300013307 Bacteria 600
122 Ga0157375_10027534 3300013308 Bacteria 5314
123 Ga0157375_10191982 3300013308 Bacteria 2197
124 Ga0157375_10478143 3300013308 Bacteria 1411
125 Ga0163163_10339308 3300014325 Bacteria 1558
126 Ga0163163_10711298 3300014325 Bacteria 1068
127 Ga0163163_11036311 3300014325 Bacteria 884
128 Ga0157380_10093576 3300014326 Bacteria 2485
129 Ga0157380_10771919 3300014326 Bacteria 975
130 Ga0157380_11308140 3300014326 Bacteria 772
131 Ga0157377_10333381 3300014745 Bacteria 1012
132 Ga0157379_10328207 3300014968 Bacteria 1398
133 Ga0163161_10426129 3300017792 Bacteria 1068
134 Ga0163161_11625089 3300017792 Unclassified 570
135 Ga0209148_1044118 3300025254 Bacteria 603
136 Ga0209455_1012474 3300025272 Bacteria 2033
137 Ga0207656_10108139 3300025321 Bacteria 1282
138 Ga0207642_10138388 3300025899 Bacteria 1280
139 Ga0207680_10210224 3300025903 Bacteria 1330
140 Ga0207680_10477651 3300025903 Bacteria 886
141 Ga0207680_10565820 3300025903 Bacteria 812
142 Ga0207680_10566605 3300025903 Bacteria 811
143 Ga0207647_10158900 3300025904 Bacteria 1319
144 Ga0207645_10300818 3300025907 Bacteria 1068
145 Ga0207645_10402260 3300025907 Bacteria 921
146 Ga0207705_10116403 3300025909 Bacteria 1979
147 Ga0207707_10004351 3300025912 Bacteria 12529
148 Ga0207707_10054355 3300025912 Bacteria 3486
149 Ga0207695_10008488 3300025913 Bacteria 12845
150 Ga0207695_10045285 3300025913 Bacteria 4671
151 Ga0207671_10003314 3300025914 Bacteria 16185
152 Ga0207671_10015750 3300025914 Bacteria 5906
153 Ga0207671_10126173 3300025914 Bacteria 1961
154 Ga0207660_10217004 3300025917 Bacteria 1500
155 Ga0207657_10126602 3300025919 Bacteria 2098
156 Ga0207649_10192085 3300025920 Bacteria 1437
157 Ga0207649_10969097 3300025920 Unclassified 668
158 Ga0207652_10217436 3300025921 Bacteria 1721
159 Ga0207652_11052428 3300025921 Bacteria 713
160 Ga0207646_10324718 3300025922 Bacteria 1390
161 Ga0207646_10592786 3300025922 Bacteria 995
162 Ga0207681_10229393 3300025923 Bacteria 1440
163 Ga0207694_10092889 3300025924 Bacteria 2382
164 Ga0207650_10558534 3300025925 Bacteria 960
165 Ga0207650_10580939 3300025925 Unclassified 941
166 Ga0207659_11153221 3300025926 Bacteria 666
167 Ga0207706_10137714 3300025933 Bacteria 2147
168 Ga0207706_10874593 3300025933 Bacteria 760
169 Ga0207706_11098010 3300025933 Bacteria 665
170 Ga0207686_10165571 3300025934 Bacteria 1554
171 Ga0207691_10143217 3300025940 Bacteria 2105
172 Ga0207691_10438984 3300025940 Bacteria 1111
173 Ga0207691_10688414 3300025940 Bacteria 862
174 Ga0207711_10058541 3300025941 Plasmid 3316
175 Ga0207689_10088190 3300025942 Bacteria 2549
176 Ga0207689_10197403 3300025942 Bacteria 1661
177 Ga0207689_10664703 3300025942 Bacteria 878
178 Ga0207661_10199908 3300025944 Bacteria 1757
179 Ga0207679_10631868 3300025945 Bacteria 967
180 Ga0207667_10043383 3300025949 Bacteria 4773
181 Ga0207667_10536834 3300025949 Bacteria 1184
182 Ga0207651_10267121 3300025960 Bacteria 1407
183 Ga0207651_10322165 3300025960 Bacteria 1292
184 Ga0207712_10006327 3300025961 Bacteria 7469
185 Ga0207712_10519514 3300025961 Bacteria 1020
186 Ga0207640_10604524 3300025981 Bacteria 929
187 Ga0207640_10979420 3300025981 Bacteria 743
188 Ga0207658_10140865 3300025986 Bacteria 1951
189 Ga0207658_10377237 3300025986 Bacteria 1241
190 Ga0207703_10185681 3300026035 Bacteria 1838
191 Ga0207639_10055215 3300026041 Bacteria 3039
192 Ga0207639_10472807 3300026041 Bacteria 1141
193 Ga0207708_10177086 3300026075 Bacteria 1692
194 Ga0207641_10369928 3300026088 Bacteria 1370
195 Ga0207648_10207934 3300026089 Bacteria 1737
196 Ga0207648_10646450 3300026089 Bacteria 977
197 Ga0207674_10034538 3300026116 Bacteria 5284
198 Ga0207675_100243520 3300026118 Bacteria 1738
199 Ga0207675_100390755 3300026118 Bacteria 1369
200 Ga0207683_10141153 3300026121 Bacteria 2171
201 Ga0209968_1036611 3300027526 Bacteria 831
202 Ga0268266_10157107 3300028379 Bacteria 2055
203 Ga0268265_10388340 3300028380 Bacteria 1286
204 Ga0268265_10761454 3300028380 Bacteria 941
205 Ga0268265_11885674 3300028380 Bacteria 604
206 Ga0268264_10000015 3300028381 Bacteria 508501
207 Ga0268264_10000019 3300028381 Bacteria 488112
208 Ga0268264_10000054 3300028381 Bacteria 317048
209 Ga0268264_10563124 3300028381 Bacteria 1119
210 Ga0265327_10002463 3300031251 Bacteria 19492
211 Ga0307513_10147908 3300031456 Bacteria 2264
212 Ga0307408_100008172 3300031548 Bacteria 6911
213 Ga0307408_100910530 3300031548 Unclassified 805
214 Ga0307516_10268537 3300031730 Bacteria 1393
215 Ga0307413_10072299 3300031824 Bacteria 2177
216 Ga0307413_10161578 3300031824 Unclassified 1574
217 Ga0307413_10210952 3300031824 Bacteria 1410
218 Ga0307410_10031968 3300031852 Unclassified 3381
219 Ga0307410_10040110 3300031852 Bacteria 3079
220 Ga0307410_10086505 3300031852 Bacteria 2214
221 Ga0307406_10015702 3300031901 Bacteria 4389
222 Ga0307406_10078261 3300031901 Bacteria 2190
223 Ga0307407_10047029 3300031903 Bacteria 2446
224 Ga0307407_10066811 3300031903 Bacteria 2122
225 Ga0307407_10373232 3300031903 Bacteria 1016
226 Ga0307412_10136438 3300031911 Bacteria 1791
227 Ga0307412_10429055 3300031911 Bacteria 1083
228 Ga0307409_100047040 3300031995 Bacteria 3271
229 Ga0307409_100200814 3300031995 Unclassified 1783
230 Ga0307409_100348385 3300031995 Bacteria 1397
231 Ga0307409_100513991 3300031995 Bacteria 1169
232 Ga0307409_100820637 3300031995 Bacteria 939
233 Ga0307409_101381385 3300031995 Unclassified 730
234 Ga0307416_100592587 3300032002 Bacteria 1187
235 Ga0307416_100987863 3300032002 Unclassified 944
236 Ga0307414_10319277 3300032004 Bacteria 1321
237 Ga0307414_10378953 3300032004 Bacteria 1222
238 Ga0307411_10003392 3300032005 Bacteria 7380
239 Ga0307411_10096653 3300032005 Bacteria 2077
240 Ga0307411_10102941 3300032005 Unclassified 2024
241 Ga0307411_10558348 3300032005 Bacteria 978
242 Ga0307415_100035964 3300032126 Unclassified 3240
243 Ga0307415_100439810 3300032126 Unclassified 1124
244 Ga0307510_10006020 3300033180 Bacteria 14470
245 Ga0373950_0061321 3300034818 Bacteria 756
246 Ga0395900_0700163 3300037418 Bacteria 947
247 Ga0395905_0000003 3300037471 Bacteria 1347396
248 Ga0395905_0669924 3300037471 Bacteria 940
249 Ga0395905_0740722 3300037471 Bacteria 885
250 Ga0395905_1278226 3300037471 Bacteria 637
251 Ga0451789_0574475 3300041443 Bacteria 657
252 Ga0451798_1133423 3300041458 Bacteria 781
253 Ga0451804_0672434 3300041463 Bacteria 969
254 Ga0451807_1345623 3300041486 Bacteria 629
255 Ga0451835_0679064 3300041492 Bacteria 789
256 Ga0439449_0122647 3300042007 Bacteria 965
257 Ga0439457_013242 3300042014 Bacteria 1854
258 Ga0439462_0007020 3300042015 Bacteria 2815
259 Ga0466957_0001789 3300044842 Bacteria 11316
260 Ga0466957_1075175 3300044842 Bacteria 580
261 Ga0495638_0102001 3300046460 Bacteria 1715
262 Ga0495650_0025828 3300046471 Bacteria 2744
263 Ga0495598_0220329 3300046537 Bacteria 692
264 Ga0495621_0095139 3300046539 Bacteria 1128
265 Ga0495625_0001321 3300046660 Bacteria 30823
266 Ga0495672_0033756 3300047320 Bacteria 3168
267 Ga0495672_0100640 3300047320 Bacteria 1568
268 Ga0501207_086726 3300049654 Unclassified 610
269 Ga0501217_054548 3300049661 Bacteria 1053
270 Ga0501233_058171 3300049668 Bacteria 953
271 Ga0501233_071716 3300049668 Unclassified 878
272 Ga0501235_012398 3300049669 Bacteria 1875
273 Ga0501239_007378 3300049672 Bacteria 1151
274 Ga0501260_028651 3300049689 Bacteria 633
275 Ga0501221_188472 3300049704 Unclassified 568
276 Ga0501225_0003849 3300049705 Unclassified 4503
277 Ga0501225_0101102 3300049705 Unclassified 842
278 Ga0501245_051691 3300049708 Unclassified 730
279 Ga0501268_017538 3300049765 Bacteria 1195
280 Ga0501270_014610 3300049767 Unclassified 1108
281 nmdc:mga05p37_428031_c1 3300050507 Bacteria 1538
282 nmdc:mga09592_232197_c1 3300050508 Bacteria 1599
283 nmdc:mga0qj67_77243_c1 3300050509 Bacteria 2664
284 nmdc:mga06r32_103035_c1 3300050510 Bacteria 2802
285 nmdc:mga08y16_1026237_c1 3300050511 Bacteria 803
286 nmdc:mga08y16_289801_c1 3300050511 Bacteria 1688
287 Ga0500578_0131115 3300053086 Bacteria 1572
288 Ga0500628_099568 3300053129 Bacteria 768
289 Ga0500611_000037 3300053727 Bacteria 72513

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_101046925 Ga0070683_1010469251 150
2 3300005344 Ga0070661_100796456 Ga0070661_1007964561 150
3 3300005355 Ga0070671_100435536 Ga0070671_1004355362 150
4 3300005364 Ga0070673_100981337 Ga0070673_1009813372 150
5 3300005535 Ga0070684_100698596 Ga0070684_1006985961 150
6 3300005578 Ga0068854_101558466 Ga0068854_1015584661 150
7 3300013296 Ga0157374_10192317 Ga0157374_101923173 150
8 3300013306 Ga0163162_10082817 Ga0163162_100828173 150
9 3300025920 Ga0207649_10969097 Ga0207649_109690971 150
10 3300025926 Ga0207659_11153221 Ga0207659_111532212 150
11 3300025940 Ga0207691_10143217 Ga0207691_101432175 150
12 3300025944 Ga0207661_10199908 Ga0207661_101999082 150
13 3300025945 Ga0207679_10631868 Ga0207679_106318681 150
14 3300025981 Ga0207640_10979420 Ga0207640_109794201 150
15 3300005329 Ga0070683_101161632 Ga0070683_1011616321 152
16 3300005336 Ga0070680_100086766 Ga0070680_1000867664 152
17 3300005344 Ga0070661_100059917 Ga0070661_1000599173 152
18 3300005366 Ga0070659_100023933 Ga0070659_1000239333 152
19 3300005458 Ga0070681_10228557 Ga0070681_102285572 152
20 3300005577 Ga0068857_100049348 Ga0068857_1000493486 152
21 3300005578 Ga0068854_100124670 Ga0068854_1001246701 152
22 3300005834 Ga0068851_10068343 Ga0068851_100683431 152
23 3300009093 Ga0105240_10812663 Ga0105240_108126632 152
24 3300013105 Ga0157369_10293525 Ga0157369_102935251 152
25 3300013307 Ga0157372_10327163 Ga0157372_103271633 152
26 3300025321 Ga0207656_10108139 Ga0207656_101081391 152
27 3300025912 Ga0207707_10054355 Ga0207707_100543552 152
28 3300025919 Ga0207657_10126602 Ga0207657_101266022 152
29 3300025920 Ga0207649_10192085 Ga0207649_101920852 152
30 3300025921 Ga0207652_11052428 Ga0207652_110524281 152
31 3300025981 Ga0207640_10604524 Ga0207640_106045241 152
32 3300026116 Ga0207674_10034538 Ga0207674_100345386 152
33 3300031995 Ga0307409_100820637 Ga0307409_1008206372 152
34 3300049767 Ga0501270_014610 Ga0501270_014610_26_487 152
35 3300005290 Ga0065712_10321304 Ga0065712_103213042 153
36 3300005293 Ga0065715_10341684 Ga0065715_103416842 153
37 3300005328 Ga0070676_10321524 Ga0070676_103215242 153
38 3300005331 Ga0070670_100121058 Ga0070670_1001210583 153
39 3300005331 Ga0070670_100351490 Ga0070670_1003514902 153
40 3300005364 Ga0070673_100626248 Ga0070673_1006262482 153
41 3300005455 Ga0070663_100683725 Ga0070663_1006837251 153
42 3300005457 Ga0070662_100366851 Ga0070662_1003668511 153
43 3300005457 Ga0070662_100925262 Ga0070662_1009252621 153
44 3300005457 Ga0070662_100943442 Ga0070662_1009434421 153
45 3300005539 Ga0068853_100023893 Ga0068853_1000238932 153
46 3300025903 Ga0207680_10477651 Ga0207680_104776511 153
47 3300025903 Ga0207680_10565820 Ga0207680_105658201 153
48 3300025907 Ga0207645_10300818 Ga0207645_103008182 153
49 3300025925 Ga0207650_10580939 Ga0207650_105809392 153
50 3300025933 Ga0207706_10874593 Ga0207706_108745931 153
51 3300031903 Ga0307407_10373232 Ga0307407_103732322 153
52 3300031911 Ga0307412_10429055 Ga0307412_104290552 153
53 3300037471 Ga0395905_0669924 Ga0395905_0669924_376_885 153
54 3300049668 Ga0501233_071716 Ga0501233_071716_229_741 153
55 3300005563 Ga0068855_101000275 Ga0068855_1010002752 154
56 3300005614 Ga0068856_100270434 Ga0068856_1002704342 154
57 3300005616 Ga0068852_100094229 Ga0068852_1000942294 154
58 3300025914 Ga0207671_10126173 Ga0207671_101261734 154
59 3300005366 Ga0070659_100600489 Ga0070659_1006004892 155
60 3300017792 Ga0163161_10426129 Ga0163161_104261292 155
61 3300025933 Ga0207706_11098010 Ga0207706_110980101 155
62 3300005539 Ga0068853_100033399 Ga0068853_1000333996 156
63 3300009174 Ga0105241_10149296 Ga0105241_101492964 156
64 3300013307 Ga0157372_10489284 Ga0157372_104892842 156
65 3300014326 Ga0157380_11308140 Ga0157380_113081402 156
66 3300005468 Ga0070707_100157563 Ga0070707_1001575634 157
67 3300032126 Ga0307415_100439810 Ga0307415_1004398102 157
68 iso_pu_bacteria 2585428187 2588231919 157
69 3300046660 Ga0495625_0001321 Ga0495625_0001321_16333_16818 158
70 3300005336 Ga0070680_100083143 Ga0070680_1000831433 159
71 3300005338 Ga0068868_100873236 Ga0068868_1008732361 159
72 3300005364 Ga0070673_100514721 Ga0070673_1005147212 159
73 3300005365 Ga0070688_100998654 Ga0070688_1009986541 159
74 3300005367 Ga0070667_100119452 Ga0070667_1001194522 159
75 3300005444 Ga0070694_100169909 Ga0070694_1001699092 159
76 3300005456 Ga0070678_100907791 Ga0070678_1009077911 159
77 3300005457 Ga0070662_100167799 Ga0070662_1001677993 159
78 3300005459 Ga0068867_100293407 Ga0068867_1002934072 159
79 3300005545 Ga0070695_100097670 Ga0070695_1000976702 159
80 3300005546 Ga0070696_100135122 Ga0070696_1001351222 159
81 3300005549 Ga0070704_100562697 Ga0070704_1005626971 159
82 3300005578 Ga0068854_100074863 Ga0068854_1000748632 159
83 3300005617 Ga0068859_100051894 Ga0068859_1000518943 159
84 3300005840 Ga0068870_11078036 Ga0068870_110780361 159
85 3300006931 Ga0097620_100051893 Ga0097620_1000518932 159
86 3300013100 Ga0157373_10027671 Ga0157373_100276713 159
87 3300013308 Ga0157375_10027534 Ga0157375_100275343 159
88 3300013308 Ga0157375_10191982 Ga0157375_101919823 159
89 3300014325 Ga0163163_10339308 Ga0163163_103393081 159
90 3300014326 Ga0157380_10771919 Ga0157380_107719191 159
91 3300025903 Ga0207680_10566605 Ga0207680_105666051 159
92 3300025904 Ga0207647_10158900 Ga0207647_101589002 159
93 3300025907 Ga0207645_10402260 Ga0207645_104022601 159
94 3300025917 Ga0207660_10217004 Ga0207660_102170042 159
95 3300025933 Ga0207706_10137714 Ga0207706_101377142 159
96 3300025940 Ga0207691_10438984 Ga0207691_104389841 159
97 3300025960 Ga0207651_10322165 Ga0207651_103221652 159
98 3300025986 Ga0207658_10140865 Ga0207658_101408652 159
99 3300026089 Ga0207648_10207934 Ga0207648_102079342 159
100 3300026118 Ga0207675_100390755 Ga0207675_1003907552 159
101 3300026121 Ga0207683_10141153 Ga0207683_101411533 159
102 3300028381 Ga0268264_10563124 Ga0268264_105631242 159
103 3300031824 Ga0307413_10072299 Ga0307413_100722993 159
104 3300031995 Ga0307409_100348385 Ga0307409_1003483851 159
105 3300032004 Ga0307414_10319277 Ga0307414_103192772 159
106 3300032005 Ga0307411_10558348 Ga0307411_105583482 159
107 3300037471 Ga0395905_0000003 Ga0395905_0000003_866880_867377 159
108 3300037471 Ga0395905_0740722 Ga0395905_0740722_193_684 159
109 3300005331 Ga0070670_100127367 Ga0070670_1001273672 160
110 3300005456 Ga0070678_100066441 Ga0070678_1000664411 160
111 3300005530 Ga0070679_100939911 Ga0070679_1009399111 160
112 3300005539 Ga0068853_100925002 Ga0068853_1009250021 160
113 3300005563 Ga0068855_100167212 Ga0068855_1001672123 160
114 3300005616 Ga0068852_101272040 Ga0068852_1012720402 160
115 3300009093 Ga0105240_10009185 Ga0105240_1000918513 160
116 3300009148 Ga0105243_10314154 Ga0105243_103141543 160
117 3300009545 Ga0105237_10061861 Ga0105237_100618612 160
118 3300010375 Ga0105239_10031586 Ga0105239_100315864 160
119 3300013308 Ga0157375_10478143 Ga0157375_104781431 160
120 3300025254 Ga0209148_1044118 Ga0209148_10441181 160
121 3300025272 Ga0209455_1012474 Ga0209455_10124743 160
122 3300025913 Ga0207695_10008488 Ga0207695_1000848813 160
123 3300025914 Ga0207671_10015750 Ga0207671_100157507 160
124 3300025925 Ga0207650_10558534 Ga0207650_105585341 160
125 3300025949 Ga0207667_10536834 Ga0207667_105368341 160
126 3300031251 Ga0265327_10002463 Ga0265327_1000246318 160
127 3300042014 Ga0439457_013242 Ga0439457_013242_688_1182 160
128 3300042015 Ga0439462_0007020 Ga0439462_0007020_962_1456 160
129 3300044842 Ga0466957_0001789 Ga0466957_0001789_5865_6359 160
130 3300005335 Ga0070666_10250792 Ga0070666_102507922 161
131 3300005336 Ga0070680_100532181 Ga0070680_1005321812 161
132 3300005347 Ga0070668_101527210 Ga0070668_1015272101 161
133 3300005364 Ga0070673_100178909 Ga0070673_1001789093 161
134 3300005459 Ga0068867_100301602 Ga0068867_1003016021 161
135 3300005471 Ga0070698_100006677 Ga0070698_10000667713 161
136 3300005471 Ga0070698_100368055 Ga0070698_1003680553 161
137 3300005530 Ga0070679_100061836 Ga0070679_1000618364 161
138 3300005841 Ga0068863_100035033 Ga0068863_1000350337 161
139 3300006237 Ga0097621_100112299 Ga0097621_1001122994 161
140 3300009093 Ga0105240_10039076 Ga0105240_100390765 161
141 3300009553 Ga0105249_10010246 Ga0105249_1001024613 161
142 3300013307 Ga0157372_11709654 Ga0157372_117096542 161
143 3300014325 Ga0163163_11036311 Ga0163163_110363112 161
144 3300025903 Ga0207680_10210224 Ga0207680_102102242 161
145 3300025913 Ga0207695_10045285 Ga0207695_100452853 161
146 3300025960 Ga0207651_10267121 Ga0207651_102671212 161
147 3300025961 Ga0207712_10006327 Ga0207712_1000632712 161
148 3300026088 Ga0207641_10369928 Ga0207641_103699282 161
149 3300026089 Ga0207648_10646450 Ga0207648_106464502 161
150 3300028380 Ga0268265_11885674 Ga0268265_118856741 161
151 3300031730 Ga0307516_10268537 Ga0307516_102685372 161
152 3300031852 Ga0307410_10040110 Ga0307410_100401102 161
153 3300031901 Ga0307406_10015702 Ga0307406_100157022 161
154 3300031903 Ga0307407_10047029 Ga0307407_100470294 161
155 3300031995 Ga0307409_100047040 Ga0307409_1000470403 161
156 3300031995 Ga0307409_100513991 Ga0307409_1005139913 161
157 3300033180 Ga0307510_10006020 Ga0307510_100060204 161
158 3300046471 Ga0495650_0025828 Ga0495650_0025828_409_906 161
159 3300047320 Ga0495672_0033756 Ga0495672_0033756_1428_1925 161
160 3300050511 nmdc:mga08y16_1026237_c1 nmdc:mga08y16_1026237_c1_276_773 161
161 3300005289 Ga0065704_10440797 Ga0065704_104407971 162
162 3300005334 Ga0068869_100228817 Ga0068869_1002288173 162
163 3300005340 Ga0070689_100781375 Ga0070689_1007813752 162
164 3300005367 Ga0070667_100240369 Ga0070667_1002403692 162
165 3300005459 Ga0068867_100301602 Ga0068867_1003016022 162
166 3300005468 Ga0070707_100157563 Ga0070707_1001575632 162
167 3300005518 Ga0070699_100381311 Ga0070699_1003813112 162
168 3300005539 Ga0068853_100016182 Ga0068853_1000161827 162
169 3300005539 Ga0068853_100045747 Ga0068853_1000457474 162
170 3300005544 Ga0070686_100171183 Ga0070686_1001711832 162
171 3300005544 Ga0070686_100214058 Ga0070686_1002140583 162
172 3300005616 Ga0068852_100741408 Ga0068852_1007414082 162
173 3300005840 Ga0068870_10161949 Ga0068870_101619491 162
174 3300005842 Ga0068858_100140749 Ga0068858_1001407495 162
175 3300005843 Ga0068860_100000218 Ga0068860_10000021836 162
176 3300005844 Ga0068862_100174682 Ga0068862_1001746822 162
177 3300006844 Ga0075428_100102014 Ga0075428_1001020145 162
178 3300006846 Ga0075430_100006345 Ga0075430_1000063452 162
179 3300006847 Ga0075431_100105332 Ga0075431_1001053324 162
180 3300006852 Ga0075433_10960811 Ga0075433_109608112 162
181 3300009094 Ga0111539_11398288 Ga0111539_113982882 162
182 3300009147 Ga0114129_10200659 Ga0114129_102006594 162
183 3300009545 Ga0105237_10051778 Ga0105237_100517785 162
184 3300009551 Ga0105238_10033177 Ga0105238_100331774 162
185 3300010375 Ga0105239_10000146 Ga0105239_100001468 162
186 3300013102 Ga0157371_10717692 Ga0157371_107176922 162
187 3300013306 Ga0163162_10001254 Ga0163162_100012547 162
188 3300014326 Ga0157380_10093576 Ga0157380_100935763 162
189 3300014745 Ga0157377_10333381 Ga0157377_103333812 162
190 3300025914 Ga0207671_10003314 Ga0207671_1000331425 162
191 3300025922 Ga0207646_10592786 Ga0207646_105927862 162
192 3300025924 Ga0207694_10092889 Ga0207694_100928893 162
193 3300025942 Ga0207689_10088190 Ga0207689_100881903 162
194 3300025942 Ga0207689_10197403 Ga0207689_101974032 162
195 3300025949 Ga0207667_10043383 Ga0207667_100433835 162
196 3300025961 Ga0207712_10519514 Ga0207712_105195142 162
197 3300025986 Ga0207658_10377237 Ga0207658_103772372 162
198 3300026035 Ga0207703_10185681 Ga0207703_101856813 162
199 3300026041 Ga0207639_10055215 Ga0207639_100552154 162
200 3300026041 Ga0207639_10472807 Ga0207639_104728071 162
201 3300026075 Ga0207708_10177086 Ga0207708_101770862 162
202 3300027526 Ga0209968_1036611 Ga0209968_10366111 162
203 3300028379 Ga0268266_10157107 Ga0268266_101571073 162
204 3300028380 Ga0268265_10388340 Ga0268265_103883402 162
205 3300028380 Ga0268265_10761454 Ga0268265_107614542 162
206 3300028381 Ga0268264_10000015 Ga0268264_10000015216 162
207 3300028381 Ga0268264_10000019 Ga0268264_10000019312 162
208 3300028381 Ga0268264_10000054 Ga0268264_1000005461 162
209 3300031456 Ga0307513_10147908 Ga0307513_101479082 162
210 3300031548 Ga0307408_100008172 Ga0307408_1000081722 162
211 3300031548 Ga0307408_100910530 Ga0307408_1009105302 162
212 3300031824 Ga0307413_10161578 Ga0307413_101615781 162
213 3300031824 Ga0307413_10210952 Ga0307413_102109522 162
214 3300031852 Ga0307410_10031968 Ga0307410_100319684 162
215 3300031852 Ga0307410_10086505 Ga0307410_100865053 162
216 3300031901 Ga0307406_10078261 Ga0307406_100782612 162
217 3300031903 Ga0307407_10066811 Ga0307407_100668112 162
218 3300031995 Ga0307409_100200814 Ga0307409_1002008143 162
219 3300031995 Ga0307409_101381385 Ga0307409_1013813852 162
220 3300032002 Ga0307416_100592587 Ga0307416_1005925872 162
221 3300032002 Ga0307416_100987863 Ga0307416_1009878632 162
222 3300032005 Ga0307411_10003392 Ga0307411_1000339215 162
223 3300032005 Ga0307411_10102941 Ga0307411_101029413 162
224 3300032126 Ga0307415_100035964 Ga0307415_1000359642 162
225 3300034818 Ga0373950_0061321 Ga0373950_0061321_19_507 162
226 3300037418 Ga0395900_0700163 Ga0395900_0700163_415_909 162
227 3300041443 Ga0451789_0574475 Ga0451789_0574475_104_604 162
228 3300041458 Ga0451798_1133423 Ga0451798_1133423_20_520 162
229 3300041463 Ga0451804_0672434 Ga0451804_0672434_24_524 162
230 3300041492 Ga0451835_0679064 Ga0451835_0679064_250_747 162
231 3300042007 Ga0439449_0122647 Ga0439449_0122647_183_683 162
232 3300046460 Ga0495638_0102001 Ga0495638_0102001_651_1157 162
233 3300046537 Ga0495598_0220329 Ga0495598_0220329_10_510 162
234 3300046539 Ga0495621_0095139 Ga0495621_0095139_192_692 162
235 3300047320 Ga0495672_0033756 Ga0495672_0033756_1985_2491 162
236 3300049654 Ga0501207_086726 Ga0501207_086726_88_579 162
237 3300049661 Ga0501217_054548 Ga0501217_054548_455_946 162
238 3300049668 Ga0501233_058171 Ga0501233_058171_22_513 162
239 3300049669 Ga0501235_012398 Ga0501235_012398_366_857 162
240 3300049672 Ga0501239_007378 Ga0501239_007378_25_516 162
241 3300049704 Ga0501221_188472 Ga0501221_188472_17_508 162
242 3300049705 Ga0501225_0101102 Ga0501225_0101102_318_809 162
243 3300049708 Ga0501245_051691 Ga0501245_051691_197_688 162
244 3300049765 Ga0501268_017538 Ga0501268_017538_163_654 162
245 3300050507 nmdc:mga05p37_428031_c1 nmdc:mga05p37_428031_c1_488_988 162
246 3300050508 nmdc:mga09592_232197_c1 nmdc:mga09592_232197_c1_268_768 162
247 3300050509 nmdc:mga0qj67_77243_c1 nmdc:mga0qj67_77243_c1_1600_2100 162
248 3300050510 nmdc:mga06r32_103035_c1 nmdc:mga06r32_103035_c1_1807_2307 162
249 3300053129 Ga0500628_099568 Ga0500628_099568_124_651 162
250 3300053727 Ga0500611_000037 Ga0500611_000037_9972_10478 162
251 3300005289 Ga0065704_10124968 Ga0065704_101249683 163
252 3300005327 Ga0070658_10027667 Ga0070658_100276675 163
253 3300005334 Ga0068869_100738697 Ga0068869_1007386971 163
254 3300005356 Ga0070674_101195560 Ga0070674_1011955601 163
255 3300005458 Ga0070681_10141920 Ga0070681_101419202 163
256 3300013102 Ga0157371_10170911 Ga0157371_101709112 163
257 3300013105 Ga0157369_10663988 Ga0157369_106639882 163
258 3300013307 Ga0157372_12443419 Ga0157372_124434191 163
259 3300014326 Ga0157380_10093576 Ga0157380_100935764 163
260 3300014968 Ga0157379_10328207 Ga0157379_103282072 163
261 3300025909 Ga0207705_10116403 Ga0207705_101164033 163
262 3300025922 Ga0207646_10324718 Ga0207646_103247182 163
263 3300025942 Ga0207689_10664703 Ga0207689_106647032 163
264 3300031911 Ga0307412_10136438 Ga0307412_101364382 163
265 3300032004 Ga0307414_10378953 Ga0307414_103789531 163
266 3300032005 Ga0307411_10096653 Ga0307411_100966533 163
267 3300041486 Ga0451807_1345623 Ga0451807_1345623_52_543 163
268 3300044842 Ga0466957_1075175 Ga0466957_1075175_41_550 163
269 3300053086 Ga0500578_0131115 Ga0500578_0131115_244_747 163
270 3300002076 JGI24749J21850_1037558 JGI24749J21850_10375581 164
271 3300005334 Ga0068869_100512852 Ga0068869_1005128522 164
272 3300005353 Ga0070669_100256196 Ga0070669_1002561963 164
273 3300005367 Ga0070667_100119452 Ga0070667_1001194523 164
274 3300005459 Ga0068867_101221022 Ga0068867_1012210222 164
275 3300005543 Ga0070672_100790106 Ga0070672_1007901062 164
276 3300005617 Ga0068859_100000128 Ga0068859_1000001283 164
277 3300006931 Ga0097620_100000128 Ga0097620_10000012856 164
278 3300013296 Ga0157374_10048982 Ga0157374_100489822 164
279 3300013296 Ga0157374_10447333 Ga0157374_104473333 164
280 3300013297 Ga0157378_10048916 Ga0157378_100489164 164
281 3300013308 Ga0157375_10027534 Ga0157375_100275342 164
282 3300014325 Ga0163163_10711298 Ga0163163_107112982 164
283 3300017792 Ga0163161_11625089 Ga0163161_116250891 164
284 3300025899 Ga0207642_10138388 Ga0207642_101383883 164
285 3300025912 Ga0207707_10004351 Ga0207707_100043519 164
286 3300025921 Ga0207652_10217436 Ga0207652_102174362 164
287 3300025923 Ga0207681_10229393 Ga0207681_102293933 164
288 3300025934 Ga0207686_10165571 Ga0207686_101655712 164
289 3300025940 Ga0207691_10688414 Ga0207691_106884142 164
290 3300025941 Ga0207711_10058541 Ga0207711_100585415 164
291 3300025986 Ga0207658_10140865 Ga0207658_101408653 164
292 3300026118 Ga0207675_100243520 Ga0207675_1002435203 164
293 3300037471 Ga0395905_1278226 Ga0395905_1278226_49_549 164
294 3300047320 Ga0495672_0100640 Ga0495672_0100640_547_1071 164
295 3300049689 Ga0501260_028651 Ga0501260_028651_101_601 164
296 3300049705 Ga0501225_0003849 Ga0501225_0003849_1383_1883 164
297 3300050511 nmdc:mga08y16_289801_c1 nmdc:mga08y16_289801_c1_943_1455 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

24

160

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.9394 4 158
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9282 2 159
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9187 1 164
3pu2-assembly3.cif.gz_C crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9183 2 159
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9169 2 159
ID Description Score Start End Superfamily
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9394 4 158 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9282 2 159 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.918 1 156 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9169 2 159 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9094 1 162 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V8RZT3-F1-model_v4 ATPase 1.001 1 161
AF-A0A519TKH9-F1-model_v4 SRPBCC domain-containing protein 0.9961 2 160
AF-A0A0C1G306-F1-model_v4 deleted 0.9921 2 161
AF-L0G2K8-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9898 2 157
AF-A0A1Z5SK56-F1-model_v4 ATPase 0.9895 2 156

Feature Viewer

pLDDT pTM Quality
95.07 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map