F393609

General Info

Members Datasets Scaffolds Average Seq Length
297 179 296 69

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_101568173|Ga0070696_1015681732
Length 74
Sequence MTTAQQHQNVSIFLNGTARQVPPGSVVDLLMFLDLDPRTVVVELNREIVRRPALESTYIKEGDEIELVHFVGGG

Samples

Sample ID Description Type Environment
1 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
2 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
108 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
155 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
156 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
157 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
163 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
164 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
165 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.71
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10151528 3300003316 Bacteria 2586
2 rootH1_10151528 3300003323 Bacteria 2347
3 Ga0070683_101747817 3300005329 Bacteria 598
4 Ga0070680_100037258 3300005336 Bacteria 3929
5 Ga0070680_100306983 3300005336 Bacteria 1346
6 Ga0070682_101139843 3300005337 Unclassified 655
7 Ga0070689_101536398 3300005340 Bacteria 603
8 Ga0070687_100071238 3300005343 Bacteria 1867
9 Ga0070659_100170876 3300005366 Unclassified 1780
10 Ga0070659_100587714 3300005366 Unclassified 956
11 Ga0070667_100280122 3300005367 Bacteria 1497
12 Ga0070667_101223162 3300005367 Bacteria 703
13 Ga0070713_100984341 3300005436 Unclassified 813
14 Ga0070705_100214066 3300005440 Bacteria 1330
15 Ga0070705_100408806 3300005440 Bacteria 1007
16 Ga0070700_101745173 3300005441 Unclassified 535
17 Ga0070694_100039570 3300005444 Bacteria 3139
18 Ga0070694_100224975 3300005444 Bacteria 1409
19 Ga0070694_100503581 3300005444 Bacteria 964
20 Ga0070694_100820956 3300005444 Bacteria 763
21 Ga0070694_100931877 3300005444 Unclassified 718
22 Ga0070708_100569384 3300005445 Bacteria 1068
23 Ga0070708_101366572 3300005445 Unclassified 661
24 Ga0070663_100421526 3300005455 Bacteria 1095
25 Ga0070678_101398046 3300005456 Unclassified 653
26 Ga0070662_100356048 3300005457 Bacteria 1200
27 Ga0070662_101116368 3300005457 Unclassified 677
28 Ga0070681_10285822 3300005458 Bacteria 1560
29 Ga0070681_10475950 3300005458 Bacteria 1161
30 Ga0070681_10881304 3300005458 Bacteria 813
31 Ga0068867_100299445 3300005459 Bacteria 1325
32 Ga0070706_100420968 3300005467 Bacteria 1243
33 Ga0070707_100249572 3300005468 Bacteria 1727
34 Ga0070707_100431009 3300005468 Bacteria 1279
35 Ga0070707_102306180 3300005468 Unclassified 506
36 Ga0070698_100871024 3300005471 Bacteria 846
37 Ga0070698_101295131 3300005471 Bacteria 679
38 Ga0070699_100008735 3300005518 Bacteria 8779
39 Ga0070679_100198103 3300005530 Bacteria 1975
40 Ga0070679_101133416 3300005530 Bacteria 727
41 Ga0070679_101502818 3300005530 Unclassified 620
42 Ga0070679_101851332 3300005530 Unclassified 552
43 Ga0070684_100135762 3300005535 Bacteria 2222
44 Ga0068853_100553250 3300005539 Bacteria 1090
45 Ga0070695_100020802 3300005545 Bacteria 4009
46 Ga0070695_100705107 3300005545 Bacteria 801
47 Ga0070695_101237908 3300005545 Bacteria 615
48 Ga0070696_100000609 3300005546 Bacteria 22984
49 Ga0070696_100068956 3300005546 Bacteria 2484
50 Ga0070696_101568173 3300005546 Bacteria 565
51 Ga0070696_101644228 3300005546 Unclassified 552
52 Ga0070693_100866544 3300005547 Unclassified 674
53 Ga0070693_101000793 3300005547 Unclassified 632
54 Ga0070704_100485937 3300005549 Bacteria 1069
55 Ga0070704_101967269 3300005549 Bacteria 542
56 Ga0070664_100122139 3300005564 Bacteria 2281
57 Ga0070664_100273507 3300005564 Bacteria 1522
58 Ga0068857_100244740 3300005577 Bacteria 1643
59 Ga0068854_102004990 3300005578 Bacteria 533
60 Ga0068859_100587698 3300005617 Bacteria 1207
61 Ga0068859_101351971 3300005617 Bacteria 785
62 Ga0068863_100052860 3300005841 Bacteria 3849
63 Ga0068858_101150701 3300005842 Bacteria 762
64 Ga0068860_100581586 3300005843 Bacteria 1124
65 Ga0068862_101687078 3300005844 Bacteria 642
66 Ga0081455_10447424 3300005937 Unclassified 883
67 Ga0075432_10243433 3300006058 Unclassified 727
68 Ga0070715_10902396 3300006163 Bacteria 544
69 Ga0075428_100429302 3300006844 Bacteria 1416
70 Ga0075430_100398947 3300006846 Bacteria 1135
71 Ga0075430_100638309 3300006846 Bacteria 878
72 Ga0075431_100087228 3300006847 Bacteria 3220
73 Ga0075431_100178209 3300006847 Bacteria 2182
74 Ga0075431_100382771 3300006847 Bacteria 1411
75 Ga0075431_100383266 3300006847 Bacteria 1410
76 Ga0075433_10027108 3300006852 Bacteria 4857
77 Ga0075433_10290975 3300006852 Bacteria 1447
78 Ga0075434_100011761 3300006871 Bacteria 8267
79 Ga0075434_100091337 3300006871 Bacteria 3047
80 Ga0075434_100486435 3300006871 Bacteria 1255
81 Ga0075436_100024879 3300006914 Bacteria 4117
82 Ga0097620_100587766 3300006931 Bacteria 1207
83 Ga0097620_101352212 3300006931 Bacteria 785
84 Ga0075435_100153721 3300007076 Bacteria 1935
85 Ga0075435_101907640 3300007076 Bacteria 522
86 Ga0111539_10429564 3300009094 Bacteria 1538
87 Ga0111539_10851152 3300009094 Unclassified 1061
88 Ga0105245_11585945 3300009098 Bacteria 706
89 Ga0105245_12726742 3300009098 Bacteria 547
90 Ga0105247_10406563 3300009101 Bacteria 971
91 Ga0114129_10333348 3300009147 Bacteria 2014
92 Ga0114129_10441163 3300009147 Bacteria 1709
93 Ga0114129_11186266 3300009147 Bacteria 952
94 Ga0114129_12247044 3300009147 Unclassified 656
95 Ga0114129_12857887 3300009147 Unclassified 572
96 Ga0105243_11582519 3300009148 Unclassified 681
97 Ga0105241_11506371 3300009174 Bacteria 648
98 Ga0105242_10805604 3300009176 Bacteria 930
99 Ga0105239_13626433 3300010375 Unclassified 502
100 Ga0105246_10187787 3300011119 Bacteria 1597
101 Ga0157378_10047827 3300013297 Bacteria 3803
102 Ga0157375_12387651 3300013308 Bacteria 631
103 Ga0157377_10235375 3300014745 Bacteria 1180
104 Ga0157377_10270217 3300014745 Bacteria 1110
105 Ga0157379_10286859 3300014968 Bacteria 1498
106 Ga0163161_11955897 3300017792 Unclassified 522
107 Ga0207710_10513077 3300025900 Bacteria 623
108 Ga0207688_10091516 3300025901 Bacteria 1747
109 Ga0207707_10044056 3300025912 Bacteria 3891
110 Ga0207707_10232113 3300025912 Bacteria 1605
111 Ga0207707_10779994 3300025912 Bacteria 797
112 Ga0207660_10107772 3300025917 Bacteria 2091
113 Ga0207660_10151907 3300025917 Bacteria 1780
114 Ga0207652_10202319 3300025921 Bacteria 1787
115 Ga0207652_10291871 3300025921 Bacteria 1471
116 Ga0207652_11128949 3300025921 Bacteria 685
117 Ga0207646_10308474 3300025922 Bacteria 1430
118 Ga0207646_10471121 3300025922 Bacteria 1133
119 Ga0207646_11084626 3300025922 Bacteria 705
120 Ga0207700_10025211 3300025928 Bacteria 4127
121 Ga0207690_11559561 3300025932 Bacteria 552
122 Ga0207706_10135592 3300025933 Bacteria 2165
123 Ga0207686_11290427 3300025934 Unclassified 599
124 Ga0207704_11859412 3300025938 Unclassified 518
125 Ga0207665_10304945 3300025939 Bacteria 1191
126 Ga0207661_10596340 3300025944 Bacteria 1014
127 Ga0207679_10125870 3300025945 Bacteria 2048
128 Ga0207679_10479237 3300025945 Bacteria 1107
129 Ga0207679_12077063 3300025945 Bacteria 516
130 Ga0207640_10251730 3300025981 Unclassified 1371
131 Ga0207658_10890797 3300025986 Bacteria 810
132 Ga0207703_10715658 3300026035 Bacteria 953
133 Ga0207639_10385417 3300026041 Bacteria 1260
134 Ga0207678_10219913 3300026067 Bacteria 1626
135 Ga0207678_11048006 3300026067 Unclassified 722
136 Ga0207708_10058423 3300026075 Bacteria 2943
137 Ga0207708_10654556 3300026075 Bacteria 894
138 Ga0207708_11341387 3300026075 Bacteria 627
139 Ga0207641_10037757 3300026088 Bacteria 4036
140 Ga0207674_10545559 3300026116 Bacteria 1120
141 Ga0207675_102525300 3300026118 Unclassified 524
142 Ga0209983_1136441 3300027665 Bacteria 561
143 Ga0209971_1102763 3300027682 Unclassified 700
144 Ga0209974_10014972 3300027876 Bacteria 2576
145 Ga0209974_10084583 3300027876 Unclassified 1095
146 Ga0207428_10210336 3300027907 Bacteria 1461
147 Ga0207428_10502023 3300027907 Bacteria 881
148 Ga0268265_10540427 3300028380 Unclassified 1105
149 Ga0268265_12045045 3300028380 Bacteria 580
150 Ga0307408_100012048 3300031548 Bacteria 5724
151 Ga0307408_100032930 3300031548 Bacteria 3617
152 Ga0316575_10005962 3300031665 Bacteria 4362
153 Ga0316579_10007827 3300031691 Bacteria 4429
154 Ga0316576_10016070 3300031727 Bacteria 5045
155 Ga0316578_10145100 3300031728 Bacteria 1429
156 Ga0316578_10237003 3300031728 Bacteria 1096
157 Ga0316578_10255656 3300031728 Bacteria 1051
158 Ga0307405_10178025 3300031731 Bacteria 1524
159 Ga0307405_11438559 3300031731 Unclassified 604
160 Ga0307413_10014198 3300031824 Bacteria 4035
161 Ga0307406_10007653 3300031901 Bacteria 5999
162 Ga0307406_10186904 3300031901 Bacteria 1513
163 Ga0307412_10030351 3300031911 Bacteria 3403
164 Ga0307409_100005823 3300031995 Bacteria 7151
165 Ga0307416_100000327 3300032002 Bacteria 24584
166 Ga0307416_101214412 3300032002 Bacteria 860
167 Ga0307414_10028643 3300032004 Bacteria 3615
168 Ga0307411_10024575 3300032005 Bacteria 3593
169 Ga0307411_10446298 3300032005 Bacteria 1081
170 Ga0307411_11823123 3300032005 Bacteria 565
171 Ga0307415_100038678 3300032126 Bacteria 3146
172 Ga0307415_100103846 3300032126 Bacteria 2092
173 Ga0307415_101220186 3300032126 Unclassified 709
174 Ga0316583_10033694 3300032133 Bacteria 1819
175 Ga0373948_0211482 3300034817 Bacteria 510
176 Ga0373926_0462273 3300035083 Bacteria 504
177 Ga0373944_0261156 3300035089 Bacteria 642
178 Ga0316574_0011238 3300035398 Bacteria 5083
179 Ga0316574_0173992 3300035398 Bacteria 1386
180 Ga0316582_0083572 3300036647 Bacteria 2089
181 Ga0395899_0689154 3300037312 Bacteria 642
182 Ga0395905_0426312 3300037471 Bacteria 1223
183 Ga0395905_1236737 3300037471 Bacteria 650
184 Ga0316581_0065555 3300037588 Bacteria 1115
185 Ga0451802_1230046 3300041460 Bacteria 785
186 Ga0439446_0169677 3300042156 Bacteria 725
187 Ga0439446_0344742 3300042156 Unclassified 530
188 Ga0439435_0198163 3300042436 Bacteria 661
189 Ga0451577_0335689 3300042876 Bacteria 1371
190 Ga0451577_0640109 3300042876 Bacteria 964
191 Ga0453683_1218770 3300044673 Unclassified 504
192 Ga0453684_1361871 3300044712 Unclassified 738
193 Ga0451576_0237741 3300045051 Bacteria 1902
194 Ga0451576_1939336 3300045051 Bacteria 607
195 Ga0495630_0487896 3300046517 Unclassified 945
196 Ga0495642_0082312 3300046528 Bacteria 1357
197 Ga0495647_0429670 3300046681 Bacteria 609
198 Ga0495614_0561450 3300048089 Unclassified 546
199 Ga0496101_0458998 3300048904 Bacteria 1005
200 Ga0496101_1532180 3300048904 Bacteria 519
201 Ga0496102_0056853 3300048905 Bacteria 3570
202 Ga0496102_1319770 3300048905 Bacteria 641
203 Ga0496104_0086958 3300048907 Bacteria 2985
204 Ga0496106_0529834 3300048909 Unclassified 946
205 Ga0496106_1200553 3300048909 Unclassified 592
206 Ga0496108_0070769 3300048911 Bacteria 2944
207 Ga0496108_0217633 3300048911 Bacteria 1659
208 Ga0496109_0163461 3300048912 Bacteria 2086
209 Ga0496110_0290560 3300048913 Unclassified 1489
210 Ga0496110_0399518 3300048913 Bacteria 1253
211 Ga0496114_0035278 3300048917 Bacteria 4130
212 Ga0501290_026480 3300049513 Bacteria 815
213 Ga0501031_0041781 3300049568 Bacteria 2994
214 Ga0501031_0045063 3300049568 Bacteria 2878
215 Ga0501033_0172369 3300049570 Bacteria 1554
216 Ga0501033_0875015 3300049570 Bacteria 605
217 Ga0501036_0302880 3300049572 Bacteria 1337
218 Ga0501036_0596452 3300049572 Bacteria 916
219 Ga0501036_1292962 3300049572 Bacteria 593
220 Ga0501038_0099446 3300049574 Bacteria 2425
221 Ga0501039_0161003 3300049575 Bacteria 1764
222 Ga0501039_1125817 3300049575 Bacteria 608
223 Ga0501040_0019620 3300049576 Bacteria 4500
224 Ga0501040_0033399 3300049576 Bacteria 3486
225 Ga0501040_0596036 3300049576 Unclassified 798
226 Ga0501040_0761912 3300049576 Bacteria 700
227 Ga0501041_0034302 3300049577 Bacteria 3072
228 Ga0501041_0105060 3300049577 Bacteria 1750
229 Ga0501042_0136958 3300049578 Bacteria 1765
230 Ga0501046_0079162 3300049580 Bacteria 2541
231 Ga0501048_0093651 3300049582 Bacteria 2119
232 Ga0501048_0265751 3300049582 Bacteria 1219
233 Ga0501048_0376724 3300049582 Bacteria 1013
234 Ga0501067_0098044 3300049583 Bacteria 1628
235 Ga0501068_0812016 3300049584 Bacteria 614
236 Ga0501069_0778923 3300049585 Bacteria 579
237 Ga0501072_0825514 3300049588 Bacteria 725
238 Ga0501074_0127233 3300049590 Bacteria 1823
239 Ga0501074_0590708 3300049590 Bacteria 785
240 Ga0501075_0186016 3300049591 Bacteria 1584
241 Ga0501075_0601851 3300049591 Bacteria 838
242 Ga0501076_0037341 3300049592 Bacteria 3809
243 Ga0501076_0358108 3300049592 Bacteria 1198
244 Ga0501076_0559088 3300049592 Bacteria 943
245 Ga0501077_0003427 3300049593 Bacteria 9537
246 Ga0501077_0008009 3300049593 Bacteria 6532
247 Ga0501207_121065 3300049654 Bacteria 543
248 Ga0501209_215401 3300049656 Bacteria 594
249 Ga0501221_256013 3300049704 Bacteria 504
250 Ga0501245_034763 3300049708 Bacteria 846
251 Ga0501079_0037419 3300049741 Bacteria 3740
252 Ga0501079_0859108 3300049741 Bacteria 714
253 Ga0501079_1494769 3300049741 Bacteria 531
254 Ga0501080_0072559 3300049742 Bacteria 3203
255 Ga0501080_1364793 3300049742 Bacteria 605
256 Ga0501081_0007914 3300049743 Bacteria 6895
257 Ga0501081_0020653 3300049743 Bacteria 4391
258 Ga0501081_0270811 3300049743 Bacteria 1242
259 Ga0501081_0670903 3300049743 Unclassified 778
260 Ga0501083_0087654 3300049744 Bacteria 2058
261 Ga0501271_024496 3300049768 Bacteria 716
262 Ga0501272_036973 3300049769 Bacteria 640
263 Ga0501273_014064 3300049770 Bacteria 1027
264 Ga0501283_043684 3300049779 Bacteria 781
265 Ga0501045_0007832 3300049824 Bacteria 7432
266 Ga0501045_0061636 3300049824 Bacteria 2752
267 nmdc:mga05p37_443640_c1 3300050507 Bacteria 1504
268 nmdc:mga05p37_549623_c1 3300050507 Bacteria 1315
269 nmdc:mga05p37_880842_c1 3300050507 Bacteria 968
270 nmdc:mga09592_408368_c1 3300050508 Bacteria 1173
271 nmdc:mga06r32_115761_c1 3300050510 Bacteria 2641
272 nmdc:mga06r32_1318024_c1 3300050510 Bacteria 665
273 nmdc:mga06r32_1430450_c1 3300050510 Bacteria 633
274 nmdc:mga06r32_2803_c1 3300050510 Bacteria 15622
275 nmdc:mga08y16_556122_c1 3300050511 Unclassified 1161
276 nmdc:mga08y16_627331_c1 3300050511 Bacteria 1081
277 nmdc:mga0n895_1141992_c1 3300050512 Bacteria 755
278 nmdc:mga0n895_84555_c1 3300050512 Bacteria 3166
279 nmdc:mga0n895_874126_c1 3300050512 Bacteria 886
280 nmdc:mga0n895_907472_c1 3300050512 Bacteria 866
281 nmdc:mga0rr50_343845_c1 3300050513 Bacteria 1254
282 nmdc:mga0rr50_990323_c1 3300050513 Unclassified 716
283 nmdc:mga08x19_39552_c1 3300050514 Bacteria 2998
284 nmdc:mga08x19_877795_c1 3300050514 Bacteria 637
285 nmdc:mga0a205_32621_c1 3300050515 Bacteria 4993
286 nmdc:mga0a205_41362_c1 3300050515 Bacteria 4438
287 nmdc:mga0a205_855986_c1 3300050515 Bacteria 756
288 Ga0501084_0016494 3300054114 Bacteria 6134
289 Ga0501084_0033866 3300054114 Bacteria 4273
290 Ga0501084_0106041 3300054114 Bacteria 2361
291 Ga0590075_026302 3300059424 Bacteria 1465
292 Ga0590077_057407 3300059426 Bacteria 880
293 Ga0501082_0020342 3300060353 Bacteria 5722
294 Ga0501082_0178281 3300060353 Bacteria 1848
295 Ga0501082_0936876 3300060353 Bacteria 757
296 Ga0530510_0212540 3300061734 Bacteria 1437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2881644220 2881647889 61
2 iso_pu_bacteria 3006978542 3006982981 61
3 3300049568 Ga0501031_0041781 Ga0501031_0041781_2609_2800 63
4 3300046528 Ga0495642_0082312 Ga0495642_0082312_563_760 65
5 3300050513 nmdc:mga0rr50_990323_c1 nmdc:mga0rr50_990323_c1_306_503 65
6 3300005367 Ga0070667_100280122 Ga0070667_1002801222 66
7 3300005445 Ga0070708_100569384 Ga0070708_1005693842 66
8 3300005467 Ga0070706_100420968 Ga0070706_1004209682 66
9 3300005468 Ga0070707_100249572 Ga0070707_1002495722 66
10 3300005549 Ga0070704_101967269 Ga0070704_1019672692 66
11 3300005617 Ga0068859_101351971 Ga0068859_1013519712 66
12 3300005841 Ga0068863_100052860 Ga0068863_1000528604 66
13 3300005842 Ga0068858_101150701 Ga0068858_1011507012 66
14 3300005843 Ga0068860_100581586 Ga0068860_1005815862 66
15 3300006844 Ga0075428_100429302 Ga0075428_1004293023 66
16 3300006846 Ga0075430_100398947 Ga0075430_1003989472 66
17 3300006847 Ga0075431_100382771 Ga0075431_1003827713 66
18 3300006847 Ga0075431_100383266 Ga0075431_1003832663 66
19 3300006914 Ga0075436_100024879 Ga0075436_1000248793 66
20 3300006931 Ga0097620_101352212 Ga0097620_1013522122 66
21 3300007076 Ga0075435_100153721 Ga0075435_1001537213 66
22 3300009101 Ga0105247_10406563 Ga0105247_104065631 66
23 3300009147 Ga0114129_10333348 Ga0114129_103333483 66
24 3300013297 Ga0157378_10047827 Ga0157378_100478275 66
25 3300014968 Ga0157379_10286859 Ga0157379_102868592 66
26 3300025900 Ga0207710_10513077 Ga0207710_105130771 66
27 3300025922 Ga0207646_11084626 Ga0207646_110846262 66
28 3300025986 Ga0207658_10890797 Ga0207658_108907972 66
29 3300026035 Ga0207703_10715658 Ga0207703_107156582 66
30 3300026088 Ga0207641_10037757 Ga0207641_100377572 66
31 3300035083 Ga0373926_0462273 Ga0373926_0462273_33_236 66
32 3300042876 Ga0451577_0640109 Ga0451577_0640109_157_360 66
33 3300045051 Ga0451576_0237741 Ga0451576_0237741_845_1048 66
34 3300050507 nmdc:mga05p37_549623_c1 nmdc:mga05p37_549623_c1_436_636 66
35 3300050510 nmdc:mga06r32_1430450_c1 nmdc:mga06r32_1430450_c1_37_237 66
36 3300050512 nmdc:mga0n895_874126_c1 nmdc:mga0n895_874126_c1_184_387 66
37 3300050513 nmdc:mga0rr50_343845_c1 nmdc:mga0rr50_343845_c1_772_975 66
38 3300050514 nmdc:mga08x19_39552_c1 nmdc:mga08x19_39552_c1_990_1193 66
39 3300005343 Ga0070687_100071238 Ga0070687_1000712383 68
40 3300005441 Ga0070700_101745173 Ga0070700_1017451732 68
41 3300005458 Ga0070681_10881304 Ga0070681_108813042 68
42 3300005530 Ga0070679_101502818 Ga0070679_1015028182 68
43 3300005545 Ga0070695_101237908 Ga0070695_1012379082 68
44 3300005546 Ga0070696_101568173 Ga0070696_1015681732 68
45 3300005617 Ga0068859_100587698 Ga0068859_1005876983 68
46 3300006871 Ga0075434_100486435 Ga0075434_1004864352 68
47 3300006931 Ga0097620_100587766 Ga0097620_1005877661 68
48 3300007076 Ga0075435_101907640 Ga0075435_1019076402 68
49 3300025921 Ga0207652_11128949 Ga0207652_111289492 68
50 3300026075 Ga0207708_11341387 Ga0207708_113413872 68
51 3300042876 Ga0451577_0335689 Ga0451577_0335689_866_1072 68
52 3300044673 Ga0453683_1218770 Ga0453683_1218770_200_421 68
53 3300045051 Ga0451576_1939336 Ga0451576_1939336_71_292 68
54 3300050512 nmdc:mga0n895_1141992_c1 nmdc:mga0n895_1141992_c1_265_486 68
55 3300003316 rootH1_10151528 rootH1_101515284 69
56 3300005329 Ga0070683_101747817 Ga0070683_1017478171 69
57 3300005336 Ga0070680_100037258 Ga0070680_1000372586 69
58 3300005336 Ga0070680_100306983 Ga0070680_1003069832 69
59 3300005337 Ga0070682_101139843 Ga0070682_1011398431 69
60 3300005340 Ga0070689_101536398 Ga0070689_1015363982 69
61 3300005366 Ga0070659_100170876 Ga0070659_1001708763 69
62 3300005366 Ga0070659_100587714 Ga0070659_1005877142 69
63 3300005367 Ga0070667_101223162 Ga0070667_1012231622 69
64 3300005436 Ga0070713_100984341 Ga0070713_1009843412 69
65 3300005440 Ga0070705_100214066 Ga0070705_1002140663 69
66 3300005440 Ga0070705_100408806 Ga0070705_1004088061 69
67 3300005444 Ga0070694_100039570 Ga0070694_1000395702 69
68 3300005444 Ga0070694_100224975 Ga0070694_1002249752 69
69 3300005444 Ga0070694_100503581 Ga0070694_1005035812 69
70 3300005444 Ga0070694_100820956 Ga0070694_1008209562 69
71 3300005444 Ga0070694_100931877 Ga0070694_1009318772 69
72 3300005445 Ga0070708_101366572 Ga0070708_1013665722 69
73 3300005455 Ga0070663_100421526 Ga0070663_1004215262 69
74 3300005456 Ga0070678_101398046 Ga0070678_1013980461 69
75 3300005457 Ga0070662_100356048 Ga0070662_1003560482 69
76 3300005457 Ga0070662_101116368 Ga0070662_1011163682 69
77 3300005458 Ga0070681_10285822 Ga0070681_102858223 69
78 3300005458 Ga0070681_10475950 Ga0070681_104759502 69
79 3300005459 Ga0068867_100299445 Ga0068867_1002994452 69
80 3300005468 Ga0070707_100431009 Ga0070707_1004310093 69
81 3300005468 Ga0070707_102306180 Ga0070707_1023061802 69
82 3300005471 Ga0070698_100871024 Ga0070698_1008710242 69
83 3300005471 Ga0070698_101295131 Ga0070698_1012951312 69
84 3300005518 Ga0070699_100008735 Ga0070699_1000087359 69
85 3300005530 Ga0070679_100198103 Ga0070679_1001981031 69
86 3300005530 Ga0070679_101133416 Ga0070679_1011334161 69
87 3300005530 Ga0070679_101851332 Ga0070679_1018513321 69
88 3300005535 Ga0070684_100135762 Ga0070684_1001357623 69
89 3300005539 Ga0068853_100553250 Ga0068853_1005532502 69
90 3300005545 Ga0070695_100020802 Ga0070695_1000208025 69
91 3300005545 Ga0070695_100705107 Ga0070695_1007051072 69
92 3300005546 Ga0070696_100000609 Ga0070696_10000060920 69
93 3300005546 Ga0070696_100068956 Ga0070696_1000689565 69
94 3300005546 Ga0070696_101644228 Ga0070696_1016442282 69
95 3300005547 Ga0070693_100866544 Ga0070693_1008665442 69
96 3300005547 Ga0070693_101000793 Ga0070693_1010007931 69
97 3300005549 Ga0070704_100485937 Ga0070704_1004859372 69
98 3300005564 Ga0070664_100122139 Ga0070664_1001221392 69
99 3300005564 Ga0070664_100273507 Ga0070664_1002735073 69
100 3300005577 Ga0068857_100244740 Ga0068857_1002447403 69
101 3300005578 Ga0068854_102004990 Ga0068854_1020049901 69
102 3300005844 Ga0068862_101687078 Ga0068862_1016870782 69
103 3300005937 Ga0081455_10447424 Ga0081455_104474242 69
104 3300006058 Ga0075432_10243433 Ga0075432_102434332 69
105 3300006163 Ga0070715_10902396 Ga0070715_109023962 69
106 3300006846 Ga0075430_100638309 Ga0075430_1006383092 69
107 3300006847 Ga0075431_100087228 Ga0075431_1000872282 69
108 3300006847 Ga0075431_100178209 Ga0075431_1001782092 69
109 3300006852 Ga0075433_10027108 Ga0075433_100271083 69
110 3300006852 Ga0075433_10290975 Ga0075433_102909753 69
111 3300006871 Ga0075434_100011761 Ga0075434_1000117612 69
112 3300006871 Ga0075434_100091337 Ga0075434_1000913374 69
113 3300009094 Ga0111539_10429564 Ga0111539_104295643 69
114 3300009094 Ga0111539_10851152 Ga0111539_108511522 69
115 3300009098 Ga0105245_11585945 Ga0105245_115859452 69
116 3300009098 Ga0105245_12726742 Ga0105245_127267422 69
117 3300009147 Ga0114129_10441163 Ga0114129_104411631 69
118 3300009147 Ga0114129_11186266 Ga0114129_111862662 69
119 3300009147 Ga0114129_12247044 Ga0114129_122470442 69
120 3300009147 Ga0114129_12857887 Ga0114129_128578872 69
121 3300009148 Ga0105243_11582519 Ga0105243_115825192 69
122 3300009174 Ga0105241_11506371 Ga0105241_115063712 69
123 3300009176 Ga0105242_10805604 Ga0105242_108056042 69
124 3300010375 Ga0105239_13626433 Ga0105239_136264332 69
125 3300011119 Ga0105246_10187787 Ga0105246_101877873 69
126 3300013308 Ga0157375_12387651 Ga0157375_123876512 69
127 3300014745 Ga0157377_10235375 Ga0157377_102353753 69
128 3300014745 Ga0157377_10270217 Ga0157377_102702172 69
129 3300017792 Ga0163161_11955897 Ga0163161_119558972 69
130 3300025901 Ga0207688_10091516 Ga0207688_100915162 69
131 3300025912 Ga0207707_10044056 Ga0207707_100440563 69
132 3300025912 Ga0207707_10232113 Ga0207707_102321132 69
133 3300025912 Ga0207707_10779994 Ga0207707_107799942 69
134 3300025917 Ga0207660_10107772 Ga0207660_101077722 69
135 3300025917 Ga0207660_10151907 Ga0207660_101519071 69
136 3300025921 Ga0207652_10202319 Ga0207652_102023192 69
137 3300025921 Ga0207652_10291871 Ga0207652_102918712 69
138 3300025922 Ga0207646_10308474 Ga0207646_103084742 69
139 3300025922 Ga0207646_10471121 Ga0207646_104711212 69
140 3300025928 Ga0207700_10025211 Ga0207700_100252111 69
141 3300025932 Ga0207690_11559561 Ga0207690_115595612 69
142 3300025933 Ga0207706_10135592 Ga0207706_101355922 69
143 3300025934 Ga0207686_11290427 Ga0207686_112904271 69
144 3300025938 Ga0207704_11859412 Ga0207704_118594121 69
145 3300025939 Ga0207665_10304945 Ga0207665_103049452 69
146 3300025944 Ga0207661_10596340 Ga0207661_105963402 69
147 3300025945 Ga0207679_10125870 Ga0207679_101258703 69
148 3300025945 Ga0207679_10479237 Ga0207679_104792372 69
149 3300025945 Ga0207679_12077063 Ga0207679_120770631 69
150 3300025981 Ga0207640_10251730 Ga0207640_102517303 69
151 3300026041 Ga0207639_10385417 Ga0207639_103854171 69
152 3300026067 Ga0207678_10219913 Ga0207678_102199132 69
153 3300026067 Ga0207678_11048006 Ga0207678_110480062 69
154 3300026075 Ga0207708_10058423 Ga0207708_100584232 69
155 3300026075 Ga0207708_10654556 Ga0207708_106545562 69
156 3300026116 Ga0207674_10545559 Ga0207674_105455592 69
157 3300026118 Ga0207675_102525300 Ga0207675_1025253001 69
158 3300027665 Ga0209983_1136441 Ga0209983_11364411 69
159 3300027682 Ga0209971_1102763 Ga0209971_11027632 69
160 3300027876 Ga0209974_10014972 Ga0209974_100149723 69
161 3300027876 Ga0209974_10084583 Ga0209974_100845832 69
162 3300027907 Ga0207428_10210336 Ga0207428_102103362 69
163 3300027907 Ga0207428_10502023 Ga0207428_105020232 69
164 3300028380 Ga0268265_10540427 Ga0268265_105404273 69
165 3300028380 Ga0268265_12045045 Ga0268265_120450452 69
166 3300031548 Ga0307408_100012048 Ga0307408_1000120486 69
167 3300031548 Ga0307408_100032930 Ga0307408_1000329302 69
168 3300031665 Ga0316575_10005962 Ga0316575_100059624 69
169 3300031691 Ga0316579_10007827 Ga0316579_100078273 69
170 3300031727 Ga0316576_10016070 Ga0316576_100160707 69
171 3300031728 Ga0316578_10145100 Ga0316578_101451001 69
172 3300031728 Ga0316578_10237003 Ga0316578_102370032 69
173 3300031728 Ga0316578_10255656 Ga0316578_102556562 69
174 3300031731 Ga0307405_10178025 Ga0307405_101780252 69
175 3300031731 Ga0307405_11438559 Ga0307405_114385592 69
176 3300031824 Ga0307413_10014198 Ga0307413_100141982 69
177 3300031901 Ga0307406_10007653 Ga0307406_100076533 69
178 3300031901 Ga0307406_10186904 Ga0307406_101869043 69
179 3300031911 Ga0307412_10030351 Ga0307412_100303515 69
180 3300031995 Ga0307409_100005823 Ga0307409_1000058233 69
181 3300032002 Ga0307416_100000327 Ga0307416_10000032710 69
182 3300032002 Ga0307416_101214412 Ga0307416_1012144121 69
183 3300032004 Ga0307414_10028643 Ga0307414_100286433 69
184 3300032005 Ga0307411_10024575 Ga0307411_100245752 69
185 3300032005 Ga0307411_10446298 Ga0307411_104462981 69
186 3300032005 Ga0307411_11823123 Ga0307411_118231232 69
187 3300032126 Ga0307415_100038678 Ga0307415_1000386782 69
188 3300032126 Ga0307415_100103846 Ga0307415_1001038463 69
189 3300032126 Ga0307415_101220186 Ga0307415_1012201862 69
190 3300032133 Ga0316583_10033694 Ga0316583_100336943 69
191 3300034817 Ga0373948_0211482 Ga0373948_0211482_249_458 69
192 3300035089 Ga0373944_0261156 Ga0373944_0261156_200_424 69
193 3300035398 Ga0316574_0011238 Ga0316574_0011238_2625_2837 69
194 3300035398 Ga0316574_0173992 Ga0316574_0173992_1035_1262 69
195 3300036647 Ga0316582_0083572 Ga0316582_0083572_1692_1904 69
196 3300037312 Ga0395899_0689154 Ga0395899_0689154_160_369 69
197 3300037471 Ga0395905_0426312 Ga0395905_0426312_642_851 69
198 3300037471 Ga0395905_1236737 Ga0395905_1236737_378_587 69
199 3300037588 Ga0316581_0065555 Ga0316581_0065555_519_731 69
200 3300041460 Ga0451802_1230046 Ga0451802_1230046_420_629 69
201 3300042156 Ga0439446_0169677 Ga0439446_0169677_82_291 69
202 3300042156 Ga0439446_0344742 Ga0439446_0344742_261_470 69
203 3300042436 Ga0439435_0198163 Ga0439435_0198163_35_244 69
204 3300044712 Ga0453684_1361871 Ga0453684_1361871_166_378 69
205 3300046517 Ga0495630_0487896 Ga0495630_0487896_647_859 69
206 3300046681 Ga0495647_0429670 Ga0495647_0429670_191_400 69
207 3300048089 Ga0495614_0561450 Ga0495614_0561450_253_465 69
208 3300048904 Ga0496101_0458998 Ga0496101_0458998_551_760 69
209 3300048904 Ga0496101_1532180 Ga0496101_1532180_164_373 69
210 3300048905 Ga0496102_0056853 Ga0496102_0056853_3099_3308 69
211 3300048905 Ga0496102_1319770 Ga0496102_1319770_99_308 69
212 3300048907 Ga0496104_0086958 Ga0496104_0086958_1123_1332 69
213 3300048909 Ga0496106_0529834 Ga0496106_0529834_177_386 69
214 3300048909 Ga0496106_1200553 Ga0496106_1200553_149_358 69
215 3300048911 Ga0496108_0070769 Ga0496108_0070769_2516_2725 69
216 3300048911 Ga0496108_0217633 Ga0496108_0217633_1363_1572 69
217 3300048912 Ga0496109_0163461 Ga0496109_0163461_863_1072 69
218 3300048913 Ga0496110_0290560 Ga0496110_0290560_1081_1290 69
219 3300048913 Ga0496110_0399518 Ga0496110_0399518_440_649 69
220 3300048917 Ga0496114_0035278 Ga0496114_0035278_2733_2942 69
221 3300049513 Ga0501290_026480 Ga0501290_026480_462_671 69
222 3300049568 Ga0501031_0045063 Ga0501031_0045063_845_1054 69
223 3300049570 Ga0501033_0172369 Ga0501033_0172369_195_404 69
224 3300049570 Ga0501033_0875015 Ga0501033_0875015_375_584 69
225 3300049572 Ga0501036_0302880 Ga0501036_0302880_844_1053 69
226 3300049572 Ga0501036_0596452 Ga0501036_0596452_652_861 69
227 3300049572 Ga0501036_1292962 Ga0501036_1292962_20_229 69
228 3300049574 Ga0501038_0099446 Ga0501038_0099446_1936_2145 69
229 3300049575 Ga0501039_0161003 Ga0501039_0161003_1457_1666 69
230 3300049575 Ga0501039_1125817 Ga0501039_1125817_153_362 69
231 3300049576 Ga0501040_0019620 Ga0501040_0019620_1380_1589 69
232 3300049576 Ga0501040_0033399 Ga0501040_0033399_1383_1592 69
233 3300049576 Ga0501040_0596036 Ga0501040_0596036_91_300 69
234 3300049576 Ga0501040_0761912 Ga0501040_0761912_401_625 69
235 3300049577 Ga0501041_0034302 Ga0501041_0034302_984_1193 69
236 3300049577 Ga0501041_0105060 Ga0501041_0105060_316_525 69
237 3300049578 Ga0501042_0136958 Ga0501042_0136958_1423_1632 69
238 3300049580 Ga0501046_0079162 Ga0501046_0079162_351_560 69
239 3300049582 Ga0501048_0093651 Ga0501048_0093651_648_857 69
240 3300049582 Ga0501048_0265751 Ga0501048_0265751_73_282 69
241 3300049582 Ga0501048_0376724 Ga0501048_0376724_635_844 69
242 3300049583 Ga0501067_0098044 Ga0501067_0098044_177_386 69
243 3300049584 Ga0501068_0812016 Ga0501068_0812016_322_531 69
244 3300049585 Ga0501069_0778923 Ga0501069_0778923_20_235 69
245 3300049588 Ga0501072_0825514 Ga0501072_0825514_193_402 69
246 3300049590 Ga0501074_0127233 Ga0501074_0127233_344_553 69
247 3300049590 Ga0501074_0590708 Ga0501074_0590708_384_593 69
248 3300049591 Ga0501075_0186016 Ga0501075_0186016_195_404 69
249 3300049591 Ga0501075_0601851 Ga0501075_0601851_332_541 69
250 3300049592 Ga0501076_0037341 Ga0501076_0037341_2271_2480 69
251 3300049592 Ga0501076_0358108 Ga0501076_0358108_381_590 69
252 3300049592 Ga0501076_0559088 Ga0501076_0559088_388_597 69
253 3300049593 Ga0501077_0003427 Ga0501077_0003427_6206_6415 69
254 3300049593 Ga0501077_0008009 Ga0501077_0008009_1610_1819 69
255 3300049654 Ga0501207_121065 Ga0501207_121065_102_311 69
256 3300049656 Ga0501209_215401 Ga0501209_215401_330_539 69
257 3300049704 Ga0501221_256013 Ga0501221_256013_215_424 69
258 3300049708 Ga0501245_034763 Ga0501245_034763_86_295 69
259 3300049741 Ga0501079_0037419 Ga0501079_0037419_1884_2093 69
260 3300049741 Ga0501079_0859108 Ga0501079_0859108_15_239 69
261 3300049741 Ga0501079_1494769 Ga0501079_1494769_100_309 69
262 3300049742 Ga0501080_0072559 Ga0501080_0072559_211_420 69
263 3300049742 Ga0501080_1364793 Ga0501080_1364793_50_274 69
264 3300049743 Ga0501081_0007914 Ga0501081_0007914_703_912 69
265 3300049743 Ga0501081_0020653 Ga0501081_0020653_4123_4347 69
266 3300049743 Ga0501081_0270811 Ga0501081_0270811_76_285 69
267 3300049743 Ga0501081_0670903 Ga0501081_0670903_91_300 69
268 3300049744 Ga0501083_0087654 Ga0501083_0087654_1062_1271 69
269 3300049768 Ga0501271_024496 Ga0501271_024496_406_615 69
270 3300049769 Ga0501272_036973 Ga0501272_036973_115_324 69
271 3300049770 Ga0501273_014064 Ga0501273_014064_145_354 69
272 3300049779 Ga0501283_043684 Ga0501283_043684_167_376 69
273 3300049824 Ga0501045_0007832 Ga0501045_0007832_6074_6283 69
274 3300049824 Ga0501045_0061636 Ga0501045_0061636_998_1207 69
275 3300050507 nmdc:mga05p37_443640_c1 nmdc:mga05p37_443640_c1_1167_1382 69
276 3300050507 nmdc:mga05p37_880842_c1 nmdc:mga05p37_880842_c1_741_953 69
277 3300050508 nmdc:mga09592_408368_c1 nmdc:mga09592_408368_c1_708_920 69
278 3300050510 nmdc:mga06r32_115761_c1 nmdc:mga06r32_115761_c1_489_701 69
279 3300050510 nmdc:mga06r32_1318024_c1 nmdc:mga06r32_1318024_c1_72_281 69
280 3300050510 nmdc:mga06r32_2803_c1 nmdc:mga06r32_2803_c1_2410_2619 69
281 3300050511 nmdc:mga08y16_556122_c1 nmdc:mga08y16_556122_c1_493_702 69
282 3300050511 nmdc:mga08y16_627331_c1 nmdc:mga08y16_627331_c1_379_588 69
283 3300050512 nmdc:mga0n895_84555_c1 nmdc:mga0n895_84555_c1_2372_2584 69
284 3300050512 nmdc:mga0n895_907472_c1 nmdc:mga0n895_907472_c1_523_738 69
285 3300050514 nmdc:mga08x19_877795_c1 nmdc:mga08x19_877795_c1_69_278 69
286 3300050515 nmdc:mga0a205_32621_c1 nmdc:mga0a205_32621_c1_354_569 69
287 3300050515 nmdc:mga0a205_41362_c1 nmdc:mga0a205_41362_c1_2773_2985 69
288 3300050515 nmdc:mga0a205_855986_c1 nmdc:mga0a205_855986_c1_399_608 69
289 3300054114 Ga0501084_0016494 Ga0501084_0016494_4474_4683 69
290 3300054114 Ga0501084_0033866 Ga0501084_0033866_3415_3624 69
291 3300054114 Ga0501084_0106041 Ga0501084_0106041_320_529 69
292 3300059424 Ga0590075_026302 Ga0590075_026302_988_1197 69
293 3300059426 Ga0590077_057407 Ga0590077_057407_233_457 69
294 3300060353 Ga0501082_0020342 Ga0501082_0020342_2868_3077 69
295 3300060353 Ga0501082_0178281 Ga0501082_0178281_1069_1278 69
296 3300060353 Ga0501082_0936876 Ga0501082_0936876_97_321 69
297 3300061734 Ga0530510_0212540 Ga0530510_0212540_372_581 69

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

12

74

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zud-assembly1.cif.gz_4 structure of this-thif protein complex 0.9004 4 69
1zud-assembly1.cif.gz_4 structure of this-thif protein complex 0.8879 4 69
2lek-assembly1.cif.gz_A solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325 0.8792 6 69
3cwi-assembly1.cif.gz_A crystal structure of thiamine biosynthesis protein (this) from geobacter metallireducens. northeast structural genomics consortium target gmr137 0.861 4 69
1tyg-assembly1.cif.gz_G-2 structure of the thiazole synthase/this complex 0.8145 6 67
ID Description Score Start End Superfamily
1zud200 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8857 6 69 3.10.20.30
2lekA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8792 6 69 3.10.20.30
3cwiA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8615 6 68 3.10.20.30
1zud200 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.861 6 69 3.10.20.30
af_P96262_1_68_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8427 4 69 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1G1LKC3-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9929 4 69
AF-A0A7C0UPL4-F1-model_v4 Sulfur carrier protein ThiS 0.9895 4 65
AF-A0A2V9YPX9-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9889 4 64
AF-A0A1W9UCK7-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9887 4 69
AF-A0A2V7TIJ2-F1-model_v4 Thiamine biosynthesis protein ThiS 0.9864 3 69 GO:0004789
GO:0005737
GO:0009228
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.3 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map