F393757

General Info

Members Datasets Scaffolds Average Seq Length
297 182 594 278

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10045441|Ga0307515_100454412
Length 308
Sequence MSLLFDSFWRAAAYCLHPRVILLSLLPLLLMAALALGVGYFFWESALDAVRETFESWSILAAMIHWLEGIGLGSLKAVLAPMVVVFLSTPVIVXXXLLMVAAFMTPSMLGLVASRRFPLLERKQGGSFFGSALGALWATVLALVALLVSIPLWFVPPLVLVVPPLIWGWLTYRVMSYDVLAEHASADERHTLIRRHRVSLLGMGVLTGYLGAAPSLVWASGAIAIVFAPVLVPVAVWIYTLVFAFSALWFAHFALAALQALRRQTEAVEIVPAGTGPRATDVIEDARVIPLPPAEADGAPPSSPWAHP

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
137 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
138 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
165 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
171 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
172 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
175 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
180 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
181 2738541337 Pelomonas sp. BT06 Isolate Unclassified
182 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0
Isolates 1.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.82
Nodule 0
Rhizoplane 0.67
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10045441 3300028794 Bacteria 6747
2 JGI25152J39213_1001959 3300002773 Bacteria 8164
3 JGI25153J46596_10000769 3300003215 Bacteria 19653
4 rootL2_10043652 3300003322 Bacteria 3150
5 Ga0055526_1006176 3300003771 Bacteria 6589
6 Ga0055530_10001403 3300003791 Bacteria 17754
7 Ga0055540_1000002 3300003792 Bacteria 436954
8 Ga0065704_10080143 3300005289 Bacteria 4002
9 Ga0070658_10348254 3300005327 Bacteria 1268
10 Ga0070676_10000604 3300005328 Bacteria 17459
11 Ga0070670_100001968 3300005331 Bacteria 16801
12 Ga0070670_100065080 3300005331 Bacteria 3128
13 Ga0070670_100272492 3300005331 Bacteria 1477
14 Ga0070677_10085408 3300005333 Bacteria 1361
15 Ga0068869_100009082 3300005334 Bacteria 6442
16 Ga0068869_100036491 3300005334 Bacteria 3490
17 Ga0070682_100032985 3300005337 Bacteria 3143
18 Ga0068868_100000583 3300005338 Bacteria 24477
19 Ga0068868_100039152 3300005338 Bacteria 3683
20 Ga0068868_100090477 3300005338 Bacteria 2464
21 Ga0068868_100440095 3300005338 Bacteria 1132
22 Ga0070689_100035690 3300005340 Bacteria 3800
23 Ga0070668_100057529 3300005347 Bacteria 3005
24 Ga0070669_100022960 3300005353 Bacteria 4463
25 Ga0070675_100006731 3300005354 Bacteria 8837
26 Ga0070675_100008822 3300005354 Bacteria 7836
27 Ga0070671_100004635 3300005355 Bacteria 10904
28 Ga0070671_100058234 3300005355 Bacteria 3216
29 Ga0070671_100091769 3300005355 Bacteria 2544
30 Ga0070671_100122381 3300005355 Bacteria 2190
31 Ga0070674_100009491 3300005356 Bacteria 5826
32 Ga0070674_100016688 3300005356 Bacteria 4607
33 Ga0070673_100035603 3300005364 Bacteria 3776
34 Ga0070673_100062488 3300005364 Bacteria 2958
35 Ga0070673_100181218 3300005364 Bacteria 1803
36 Ga0070688_100247991 3300005365 Bacteria 1267
37 Ga0070688_100364492 3300005365 Bacteria 1061
38 Ga0070667_100001902 3300005367 Bacteria 18530
39 Ga0070667_100033402 3300005367 Bacteria 4300
40 Ga0070667_100115874 3300005367 Bacteria 2327
41 Ga0070667_100216486 3300005367 Bacteria 1704
42 Ga0070667_100510387 3300005367 Bacteria 1102
43 Ga0070701_10151177 3300005438 Bacteria 1337
44 Ga0070678_100006637 3300005456 Bacteria 6808
45 Ga0070678_100031053 3300005456 Bacteria 3680
46 Ga0070678_100103458 3300005456 Bacteria 2212
47 Ga0070662_100164890 3300005457 Bacteria 1736
48 Ga0070662_100186234 3300005457 Bacteria 1639
49 Ga0068867_100000062 3300005459 Bacteria 65188
50 Ga0068867_100001859 3300005459 Bacteria 14670
51 Ga0068867_100014316 3300005459 Bacteria 5618
52 Ga0068867_100034756 3300005459 Bacteria 3655
53 Ga0068867_100040457 3300005459 Bacteria 3402
54 Ga0070685_10124089 3300005466 Bacteria 1607
55 Ga0070706_100006359 3300005467 Bacteria 11157
56 Ga0070707_100172292 3300005468 Bacteria 2109
57 Ga0070699_100126095 3300005518 Bacteria 2254
58 Ga0070672_100006679 3300005543 Bacteria 7773
59 Ga0070672_100013492 3300005543 Bacteria 5774
60 Ga0070672_100016590 3300005543 Bacteria 5277
61 Ga0070672_100231123 3300005543 Bacteria 1554
62 Ga0070665_100028584 3300005548 Bacteria 5615
63 Ga0070665_100079703 3300005548 Bacteria 3280
64 Ga0070664_100227001 3300005564 Bacteria 1673
65 Ga0068857_100031678 3300005577 Bacteria 4674
66 Ga0070702_100122177 3300005615 Bacteria 1632
67 Ga0068852_100058439 3300005616 Bacteria 3341
68 Ga0068852_100151453 3300005616 Bacteria 2157
69 Ga0068859_100029647 3300005617 Bacteria 5491
70 Ga0068859_100044813 3300005617 Bacteria 4444
71 Ga0068864_100000351 3300005618 Bacteria 40447
72 Ga0068864_100055926 3300005618 Bacteria 3409
73 Ga0068864_100091120 3300005618 Bacteria 2689
74 Ga0068866_10156870 3300005718 Bacteria 1323
75 Ga0068870_10039287 3300005840 Bacteria 2448
76 Ga0068870_10187832 3300005840 Bacteria 1245
77 Ga0068863_100010333 3300005841 Bacteria 9069
78 Ga0068863_100145119 3300005841 Bacteria 2270
79 Ga0068863_100301311 3300005841 Bacteria 1555
80 Ga0068858_100005479 3300005842 Bacteria 12426
81 Ga0068860_100283869 3300005843 Bacteria 1619
82 Ga0068862_100470911 3300005844 Bacteria 1187
83 Ga0075368_10009543 3300006042 Bacteria 3488
84 Ga0075363_100201719 3300006048 Bacteria 1137
85 Ga0075362_10020840 3300006177 Bacteria 2743
86 Ga0075367_10005450 3300006178 Bacteria 6319
87 Ga0075366_10004973 3300006195 Bacteria 7173
88 Ga0075366_10019045 3300006195 Bacteria 3967
89 Ga0075366_10036415 3300006195 Bacteria 2901
90 Ga0075366_10049583 3300006195 Bacteria 2491
91 Ga0075366_10067454 3300006195 Bacteria 2129
92 Ga0075366_10115175 3300006195 Bacteria 1619
93 Ga0075366_10222077 3300006195 Bacteria 1151
94 Ga0075366_10229124 3300006195 Bacteria 1132
95 Ga0097621_100381064 3300006237 Bacteria 1260
96 Ga0075370_10000861 3300006353 Bacteria 12334
97 Ga0075370_10021534 3300006353 Bacteria 3532
98 Ga0075370_10041445 3300006353 Bacteria 2599
99 Ga0075370_10062065 3300006353 Bacteria 2129
100 Ga0068871_100026856 3300006358 Bacteria 4496
101 Ga0068865_100050562 3300006881 Bacteria 2872
102 Ga0097620_100029648 3300006931 Bacteria 5491
103 Ga0097620_100044813 3300006931 Bacteria 4444
104 Ga0105245_10167001 3300009098 Bacteria 2093
105 Ga0105243_10007373 3300009148 Bacteria 8456
106 Ga0105243_10218900 3300009148 Bacteria 1682
107 Ga0105242_10379717 3300009176 Bacteria 1313
108 Ga0105248_10078838 3300009177 Bacteria 3702
109 Ga0157374_10290727 3300013296 Bacteria 1615
110 Ga0157378_10075213 3300013297 Bacteria 3040
111 Ga0163162_10003894 3300013306 Bacteria 14330
112 Ga0163162_10159527 3300013306 Bacteria 2377
113 Ga0157375_10015848 3300013308 Bacteria 6754
114 Ga0157375_10074876 3300013308 Bacteria 3408
115 Ga0157375_10246731 3300013308 Bacteria 1946
116 Ga0157377_10000027 3300014745 Bacteria 135472
117 Ga0157379_10009960 3300014968 Bacteria 8280
118 Ga0157379_10134179 3300014968 Bacteria 2230
119 Ga0157376_10351892 3300014969 Bacteria 1410
120 Ga0163161_10032344 3300017792 Bacteria 3734
121 Ga0163161_10124183 3300017792 Bacteria 1942
122 Ga0213872_10012232 3300021361 Bacteria 4044
123 Ga0207425_1000158 3300025245 Bacteria 57310
124 Ga0209129_1000169 3300025258 Bacteria 96253
125 Ga0209673_1009380 3300025273 Bacteria 4246
126 Ga0209564_1000057 3300025295 Bacteria 340400
127 Ga0209758_1000174 3300025297 Bacteria 147347
128 Ga0209050_1000534 3300025298 Bacteria 63027
129 Ga0209256_1044596 3300025299 Bacteria 1107
130 Ga0209051_1000024 3300025303 Bacteria 437007
131 Ga0209257_1000079 3300025304 Bacteria 316420
132 Ga0207656_10093868 3300025321 Bacteria 1366
133 Ga0207682_10002433 3300025893 Bacteria 8353
134 Ga0207682_10011182 3300025893 Bacteria 3509
135 Ga0207680_10001055 3300025903 Bacteria 13024
136 Ga0207645_10001311 3300025907 Bacteria 20435
137 Ga0207645_10030189 3300025907 Bacteria 3493
138 Ga0207643_10038068 3300025908 Bacteria 2700
139 Ga0207643_10063202 3300025908 Bacteria 2116
140 Ga0207643_10203269 3300025908 Bacteria 1207
141 Ga0207684_10003796 3300025910 Bacteria 14581
142 Ga0207662_10062222 3300025918 Bacteria 2242
143 Ga0207646_10047692 3300025922 Bacteria 3842
144 Ga0207650_10008537 3300025925 Bacteria 6994
145 Ga0207650_10045527 3300025925 Bacteria 3228
146 Ga0207659_10003251 3300025926 Bacteria 9732
147 Ga0207659_10003410 3300025926 Bacteria 9518
148 Ga0207659_10062448 3300025926 Bacteria 2689
149 Ga0207659_10179172 3300025926 Bacteria 1677
150 Ga0207687_10045325 3300025927 Bacteria 3039
151 Ga0207644_10002934 3300025931 Bacteria 10986
152 Ga0207644_10010796 3300025931 Bacteria 6027
153 Ga0207644_10107362 3300025931 Bacteria 2106
154 Ga0207690_10202048 3300025932 Bacteria 1510
155 Ga0207706_10111229 3300025933 Bacteria 2410
156 Ga0207706_10242879 3300025933 Bacteria 1574
157 Ga0207709_10001223 3300025935 Bacteria 18456
158 Ga0207709_10135789 3300025935 Bacteria 1683
159 Ga0207670_10037203 3300025936 Bacteria 3171
160 Ga0207669_10003070 3300025937 Bacteria 7189
161 Ga0207704_10011751 3300025938 Bacteria 4323
162 Ga0207704_10020872 3300025938 Bacteria 3476
163 Ga0207704_10065110 3300025938 Bacteria 2280
164 Ga0207691_10000714 3300025940 Bacteria 32878
165 Ga0207691_10078345 3300025940 Bacteria 2975
166 Ga0207691_10089072 3300025940 Bacteria 2768
167 Ga0207691_10091503 3300025940 Bacteria 2726
168 Ga0207691_10147858 3300025940 Bacteria 2067
169 Ga0207711_10083433 3300025941 Bacteria 2795
170 Ga0207689_10015877 3300025942 Bacteria 6378
171 Ga0207689_10048630 3300025942 Bacteria 3499
172 Ga0207651_10005406 3300025960 Bacteria 6551
173 Ga0207651_10006874 3300025960 Bacteria 6007
174 Ga0207651_10022073 3300025960 Bacteria 3883
175 Ga0207712_10052878 3300025961 Bacteria 2847
176 Ga0207658_10000888 3300025986 Bacteria 24911
177 Ga0207658_10001572 3300025986 Bacteria 17671
178 Ga0207658_10035184 3300025986 Bacteria 3586
179 Ga0207658_10343964 3300025986 Bacteria 1297
180 Ga0207677_10006058 3300026023 Bacteria 6596
181 Ga0207677_10009897 3300026023 Bacteria 5375
182 Ga0207677_10029794 3300026023 Bacteria 3474
183 Ga0207677_10173575 3300026023 Bacteria 1688
184 Ga0207703_10002841 3300026035 Bacteria 14773
185 Ga0207641_10004175 3300026088 Bacteria 12583
186 Ga0207648_10000119 3300026089 Bacteria 76875
187 Ga0207648_10004062 3300026089 Bacteria 15174
188 Ga0207648_10004701 3300026089 Bacteria 13958
189 Ga0207648_10023445 3300026089 Bacteria 5528
190 Ga0207648_10160372 3300026089 Bacteria 1986
191 Ga0207676_10018529 3300026095 Bacteria 5062
192 Ga0207676_10072030 3300026095 Bacteria 2776
193 Ga0207676_10135611 3300026095 Bacteria 2099
194 Ga0207674_10241718 3300026116 Bacteria 1752
195 Ga0207675_100044720 3300026118 Bacteria 4139
196 Ga0207683_10005513 3300026121 Bacteria 10847
197 Ga0207683_10007348 3300026121 Bacteria 9441
198 Ga0207683_10019303 3300026121 Bacteria 5820
199 Ga0207698_10213541 3300026142 Bacteria 1738
200 Ga0268266_10054757 3300028379 Bacteria 3428
201 Ga0268264_10370090 3300028381 Bacteria 1369
202 Ga0307517_10002460 3300028786 Bacteria 29616
203 Ga0307517_10074844 3300028786 Bacteria 2979
204 Ga0307517_10079819 3300028786 Bacteria 2810
205 Ga0307515_10137169 3300028794 Bacteria 2651
206 Ga0307513_10041961 3300031456 Bacteria 5043
207 Ga0307509_10000092 3300031507 Bacteria 124019
208 Ga0307509_10027707 3300031507 Bacteria 6302
209 Ga0307509_10051875 3300031507 Bacteria 4381
210 Ga0307509_10088462 3300031507 Bacteria 3179
211 Ga0307408_100155735 3300031548 Bacteria 1809
212 Ga0307508_10001131 3300031616 Bacteria 30761
213 Ga0307508_10016226 3300031616 Bacteria 6779
214 Ga0307508_10043568 3300031616 Bacteria 4020
215 Ga0307405_10000621 3300031731 Bacteria 13616
216 Ga0307410_10048261 3300031852 Bacteria 2850
217 Ga0307407_10022593 3300031903 Bacteria 3267
218 Ga0307409_100098496 3300031995 Bacteria 2418
219 Ga0307416_100102731 3300032002 Bacteria 2493
220 Ga0307414_10143093 3300032004 Bacteria 1875
221 Ga0307414_10150376 3300032004 Bacteria 1836
222 Ga0307510_10001210 3300033180 Bacteria 27978
223 Ga0307510_10040719 3300033180 Bacteria 5095
224 Ga0307510_10137372 3300033180 Bacteria 2098
225 Ga0373948_0008839 3300034817 Bacteria 1725
226 Ga0373932_0081502 3300035112 Bacteria 1023
227 Ga0373939_0000008 3300035114 Bacteria 77597
228 Ga0373939_0096113 3300035114 Bacteria 1009
229 Ga0373960_0006940 3300035121 Bacteria 2669
230 Ga0373931_0000801 3300035691 Bacteria 13152
231 Ga0373925_0054354 3300037068 Bacteria 2995
232 Ga0373925_0202474 3300037068 Bacteria 1579
233 Ga0395900_0000378 3300037418 Bacteria 64374
234 Ga0395905_0002115 3300037471 Bacteria 22548
235 Ga0436361_1007250 3300039447 Bacteria 3185
236 Ga0439455_0007158 3300042012 Bacteria 2351
237 Ga0450911_000729 3300042115 Bacteria 9510
238 Ga0450919_003354 3300042121 Bacteria 2017
239 Ga0450907_018790 3300042146 Bacteria 1157
240 Ga0439464_0001871 3300042439 Bacteria 5087
241 Ga0450918_000027 3300042531 Bacteria 30256
242 Ga0451577_0013934 3300042876 Bacteria 7504
243 Ga0466969_0016929 3300044656 Bacteria 3810
244 Ga0466972_0000111 3300044658 Bacteria 70764
245 Ga0466972_0031861 3300044658 Bacteria 2591
246 Ga0466965_0012542 3300044683 Bacteria 3988
247 Ga0466964_0012173 3300044706 Bacteria 3254
248 Ga0466971_0009129 3300044719 Bacteria 4335
249 Ga0466970_0118981 3300044765 Bacteria 1446
250 Ga0495592_0000647 3300046454 Bacteria 24156
251 Ga0495650_0080255 3300046471 Bacteria 1260
252 Ga0495632_0010898 3300046519 Bacteria 5343
253 Ga0495666_0073312 3300046526 Bacteria 1625
254 Ga0495668_0041291 3300046616 Bacteria 2570
255 Ga0495660_0067726 3300046810 Bacteria 1901
256 Ga0495687_006029 3300047443 Bacteria 7550
257 Ga0495687_007832 3300047443 Bacteria 6216
258 Ga0495686_0004667 3300047472 Bacteria 11120
259 Ga0495593_0022037 3300047673 Bacteria 3555
260 Ga0496104_0028404 3300048907 Bacteria 5185
261 Ga0496108_0025362 3300048911 Bacteria 4885
262 Ga0496121_0002476 3300048924 Bacteria 28137
263 Ga0496122_0085796 3300048925 Bacteria 2170
264 Ga0496124_0000079 3300048927 Bacteria 212057
265 Ga0496124_0057481 3300048927 Bacteria 3277
266 Ga0496124_0457945 3300048927 Bacteria 868
267 Ga0496125_0001900 3300048928 Bacteria 28607
268 Ga0496125_0008925 3300048928 Bacteria 10409
269 Ga0496125_0010297 3300048928 Bacteria 9467
270 Ga0496125_0051218 3300048928 Bacteria 3407
271 Ga0496125_0055371 3300048928 Bacteria 3232
272 Ga0496126_0084549 3300048929 Bacteria 2798
273 Ga0496126_0162628 3300048929 Bacteria 1906
274 Ga0501206_002715 3300049653 Bacteria 2229
275 Ga0501265_000598 3300049762 Bacteria 3876
276 nmdc:mga03683_68387_c1 3300050489 Bacteria 1514
277 nmdc:mga0k408_117957_c1 3300050493 Bacteria 1571
278 nmdc:mga0k408_132858_c1 3300050493 Bacteria 1478
279 nmdc:mga0k408_138249_c1 3300050493 Bacteria 1448
280 nmdc:mga0k408_67679_c1 3300050493 Bacteria 2082
281 nmdc:mga0k408_7089_c1 3300050493 Bacteria 5987
282 nmdc:mga06z11_5502_c1 3300050494 Bacteria 5089
283 nmdc:mga07m45_46370_c1 3300050496 Bacteria 2442
284 Ga0500644_0003706 3300053088 Bacteria 3794
285 Ga0500651_0064780 3300053093 Bacteria 2278
286 Ga0500651_0190194 3300053093 Bacteria 1215
287 Ga0500594_0000495 3300053118 Bacteria 8560
288 Ga0500559_0000017 3300053136 Bacteria 143646
289 Ga0500604_0019114 3300053151 Bacteria 1916
290 Ga0500619_003495 3300053154 Bacteria 3230
291 Ga0500622_0007742 3300053156 Bacteria 6063
292 Ga0500587_003309 3300053739 Bacteria 2260
293 Ga0466962_0014231 3300061719 Bacteria 3833
294 2644246012 2643221644 Bacteria 6865017
295 2644305150 2643221654 Bacteria 5273570
296 2739056635 2738541337 Bacteria 6183410
297 2904481671 2904479285 Bacteria 5073931
298 Ga0307515_10045441
299 JGI25152J39213_1001959
300 JGI25153J46596_10000769
301 rootL2_10043652
302 Ga0055526_1006176
303 Ga0055530_10001403
304 Ga0055540_1000002
305 Ga0065704_10080143
306 Ga0070658_10348254
307 Ga0070676_10000604
308 Ga0070670_100001968
309 Ga0070670_100065080
310 Ga0070670_100272492
311 Ga0070677_10085408
312 Ga0068869_100009082
313 Ga0068869_100036491
314 Ga0070682_100032985
315 Ga0068868_100000583
316 Ga0068868_100039152
317 Ga0068868_100090477
318 Ga0068868_100440095
319 Ga0070689_100035690
320 Ga0070668_100057529
321 Ga0070669_100022960
322 Ga0070675_100006731
323 Ga0070675_100008822
324 Ga0070671_100004635
325 Ga0070671_100058234
326 Ga0070671_100091769
327 Ga0070671_100122381
328 Ga0070674_100009491
329 Ga0070674_100016688
330 Ga0070673_100035603
331 Ga0070673_100062488
332 Ga0070673_100181218
333 Ga0070688_100247991
334 Ga0070688_100364492
335 Ga0070667_100001902
336 Ga0070667_100033402
337 Ga0070667_100115874
338 Ga0070667_100216486
339 Ga0070667_100510387
340 Ga0070701_10151177
341 Ga0070678_100006637
342 Ga0070678_100031053
343 Ga0070678_100103458
344 Ga0070662_100164890
345 Ga0070662_100186234
346 Ga0068867_100000062
347 Ga0068867_100001859
348 Ga0068867_100014316
349 Ga0068867_100034756
350 Ga0068867_100040457
351 Ga0070685_10124089
352 Ga0070706_100006359
353 Ga0070707_100172292
354 Ga0070699_100126095
355 Ga0070672_100006679
356 Ga0070672_100013492
357 Ga0070672_100016590
358 Ga0070672_100231123
359 Ga0070665_100028584
360 Ga0070665_100079703
361 Ga0070664_100227001
362 Ga0068857_100031678
363 Ga0070702_100122177
364 Ga0068852_100058439
365 Ga0068852_100151453
366 Ga0068859_100029647
367 Ga0068859_100044813
368 Ga0068864_100000351
369 Ga0068864_100055926
370 Ga0068864_100091120
371 Ga0068866_10156870
372 Ga0068870_10039287
373 Ga0068870_10187832
374 Ga0068863_100010333
375 Ga0068863_100145119
376 Ga0068863_100301311
377 Ga0068858_100005479
378 Ga0068860_100283869
379 Ga0068862_100470911
380 Ga0075368_10009543
381 Ga0075363_100201719
382 Ga0075362_10020840
383 Ga0075367_10005450
384 Ga0075366_10004973
385 Ga0075366_10019045
386 Ga0075366_10036415
387 Ga0075366_10049583
388 Ga0075366_10067454
389 Ga0075366_10115175
390 Ga0075366_10222077
391 Ga0075366_10229124
392 Ga0097621_100381064
393 Ga0075370_10000861
394 Ga0075370_10021534
395 Ga0075370_10041445
396 Ga0075370_10062065
397 Ga0068871_100026856
398 Ga0068865_100050562
399 Ga0097620_100029648
400 Ga0097620_100044813
401 Ga0105245_10167001
402 Ga0105243_10007373
403 Ga0105243_10218900
404 Ga0105242_10379717
405 Ga0105248_10078838
406 Ga0157374_10290727
407 Ga0157378_10075213
408 Ga0163162_10003894
409 Ga0163162_10159527
410 Ga0157375_10015848
411 Ga0157375_10074876
412 Ga0157375_10246731
413 Ga0157377_10000027
414 Ga0157379_10009960
415 Ga0157379_10134179
416 Ga0157376_10351892
417 Ga0163161_10032344
418 Ga0163161_10124183
419 Ga0213872_10012232
420 Ga0207425_1000158
421 Ga0209129_1000169
422 Ga0209673_1009380
423 Ga0209564_1000057
424 Ga0209758_1000174
425 Ga0209050_1000534
426 Ga0209256_1044596
427 Ga0209051_1000024
428 Ga0209257_1000079
429 Ga0207656_10093868
430 Ga0207682_10002433
431 Ga0207682_10011182
432 Ga0207680_10001055
433 Ga0207645_10001311
434 Ga0207645_10030189
435 Ga0207643_10038068
436 Ga0207643_10063202
437 Ga0207643_10203269
438 Ga0207684_10003796
439 Ga0207662_10062222
440 Ga0207646_10047692
441 Ga0207650_10008537
442 Ga0207650_10045527
443 Ga0207659_10003251
444 Ga0207659_10003410
445 Ga0207659_10062448
446 Ga0207659_10179172
447 Ga0207687_10045325
448 Ga0207644_10002934
449 Ga0207644_10010796
450 Ga0207644_10107362
451 Ga0207690_10202048
452 Ga0207706_10111229
453 Ga0207706_10242879
454 Ga0207709_10001223
455 Ga0207709_10135789
456 Ga0207670_10037203
457 Ga0207669_10003070
458 Ga0207704_10011751
459 Ga0207704_10020872
460 Ga0207704_10065110
461 Ga0207691_10000714
462 Ga0207691_10078345
463 Ga0207691_10089072
464 Ga0207691_10091503
465 Ga0207691_10147858
466 Ga0207711_10083433
467 Ga0207689_10015877
468 Ga0207689_10048630
469 Ga0207651_10005406
470 Ga0207651_10006874
471 Ga0207651_10022073
472 Ga0207712_10052878
473 Ga0207658_10000888
474 Ga0207658_10001572
475 Ga0207658_10035184
476 Ga0207658_10343964
477 Ga0207677_10006058
478 Ga0207677_10009897
479 Ga0207677_10029794
480 Ga0207677_10173575
481 Ga0207703_10002841
482 Ga0207641_10004175
483 Ga0207648_10000119
484 Ga0207648_10004062
485 Ga0207648_10004701
486 Ga0207648_10023445
487 Ga0207648_10160372
488 Ga0207676_10018529
489 Ga0207676_10072030
490 Ga0207676_10135611
491 Ga0207674_10241718
492 Ga0207675_100044720
493 Ga0207683_10005513
494 Ga0207683_10007348
495 Ga0207683_10019303
496 Ga0207698_10213541
497 Ga0268266_10054757
498 Ga0268264_10370090
499 Ga0307517_10002460
500 Ga0307517_10074844
501 Ga0307517_10079819
502 Ga0307515_10137169
503 Ga0307513_10041961
504 Ga0307509_10000092
505 Ga0307509_10027707
506 Ga0307509_10051875
507 Ga0307509_10088462
508 Ga0307408_100155735
509 Ga0307508_10001131
510 Ga0307508_10016226
511 Ga0307508_10043568
512 Ga0307405_10000621
513 Ga0307410_10048261
514 Ga0307407_10022593
515 Ga0307409_100098496
516 Ga0307416_100102731
517 Ga0307414_10143093
518 Ga0307414_10150376
519 Ga0307510_10001210
520 Ga0307510_10040719
521 Ga0307510_10137372
522 Ga0373948_0008839
523 Ga0373932_0081502
524 Ga0373939_0000008
525 Ga0373939_0096113
526 Ga0373960_0006940
527 Ga0373931_0000801
528 Ga0373925_0054354
529 Ga0373925_0202474
530 Ga0395900_0000378
531 Ga0395905_0002115
532 Ga0436361_1007250
533 Ga0439455_0007158
534 Ga0450911_000729
535 Ga0450919_003354
536 Ga0450907_018790
537 Ga0439464_0001871
538 Ga0450918_000027
539 Ga0451577_0013934
540 Ga0466969_0016929
541 Ga0466972_0000111
542 Ga0466972_0031861
543 Ga0466965_0012542
544 Ga0466964_0012173
545 Ga0466971_0009129
546 Ga0466970_0118981
547 Ga0495592_0000647
548 Ga0495650_0080255
549 Ga0495632_0010898
550 Ga0495666_0073312
551 Ga0495668_0041291
552 Ga0495660_0067726
553 Ga0495687_006029
554 Ga0495687_007832
555 Ga0495686_0004667
556 Ga0495593_0022037
557 Ga0496104_0028404
558 Ga0496108_0025362
559 Ga0496121_0002476
560 Ga0496122_0085796
561 Ga0496124_0000079
562 Ga0496124_0057481
563 Ga0496124_0457945
564 Ga0496125_0001900
565 Ga0496125_0008925
566 Ga0496125_0010297
567 Ga0496125_0051218
568 Ga0496125_0055371
569 Ga0496126_0084549
570 Ga0496126_0162628
571 Ga0501206_002715
572 Ga0501265_000598
573 nmdc:mga03683_68387_c1
574 nmdc:mga0k408_117957_c1
575 nmdc:mga0k408_132858_c1
576 nmdc:mga0k408_138249_c1
577 nmdc:mga0k408_67679_c1
578 nmdc:mga0k408_7089_c1
579 nmdc:mga06z11_5502_c1
580 nmdc:mga07m45_46370_c1
581 Ga0500644_0003706
582 Ga0500651_0064780
583 Ga0500651_0190194
584 Ga0500594_0000495
585 Ga0500559_0000017
586 Ga0500604_0019114
587 Ga0500619_003495
588 Ga0500622_0007742
589 Ga0500587_003309
590 Ga0466962_0014231
591 2644246012
592 2644305150
593 2739056635
594 2904481671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07264

EI24

Sulfate transporter CysZ/Etoposide-induced protein 2.4

7

220

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d79-assembly1.cif.gz_A structure of cysz, a sulfate permease from pseudomonas fragi 0.4656 7 255
6d79-assembly1.cif.gz_A structure of cysz, a sulfate permease from pseudomonas fragi 0.4582 7 255
2y00-assembly2.cif.gz_B turkey beta1 adrenergic receptor with stabilising mutations and bound partial agonist dobutamine (crystal dob92) 0.4327 161 259
6n2d-assembly1.cif.gz_a bacillus ps3 atp synthase membrane region 0.3695 105 254
6d9z-assembly1.cif.gz_B structure of cysz, a sulfate permease from pseudomonas denitrificans 0.3605 8 242
ID Description Score Start End Superfamily
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4032 2 256 1.20.1070.10
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3921 2 256 1.20.1070.10
af_Q9UAX7_31_343_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3728 161 257 1.20.1070.10
af_Q4DPU2_313_522_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3542 105 257 1.20.1250.20
4zjlE01 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3531 102 262 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A554XC05-F1-model_v4 Etoposide-induced protein 2.4 (EI24) 0.9752 3 257 GO:0016020
AF-A0A259KIX7-F1-model_v4 EI24 domain-containing protein 0.9746 3 257 GO:0016020
AF-A0A4Q3QHB9-F1-model_v4 deleted 0.9737 3 258
AF-A0A542RVI5-F1-model_v4 deleted 0.9652 2 259
AF-A0A257DG04-F1-model_v4 EI24 domain-containing protein 0.9634 2 257 GO:0016020

Map