F394238
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 176 | 298 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10039759|Ga0114129_100397598 |
| Length | 271 |
| Sequence | MRIKVHGRQWLTMIIRKSKLEIERMRASGRIVAEVLKRLSEMIEPGMTTLDLDHEAERMIVGAGAYPTFKGYHGFPRSICASINDEVVHGIPSKRKVRDGDIVGIDCGATYMGYVGDAAVTVPVGSRVRDDVWKLINATRRSLYAAIEKCRVGNRLGDVCNAVQSYIEPLGYSVVKNYCGHGVGRAMHEEPQVPNYGKPGTGPVLREGLVIAIEPMINLGHEDVKVLSDGWTVITLDGQPSAHFEHTVAITRDGPQILTMLDNGAAAVEVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 120 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 121 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 123 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 132 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 133 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 134 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 135 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 136 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 137 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 140 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 141 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 142 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 143 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 147 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 159 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 160 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 163 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 174 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 175 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.34 |
| Nodule | 0 |
| Rhizoplane | 0.67 |
| Rhizosphere | 97.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000049 | 3300000549 | Bacteria | 19104 |
| 2 | JGI25406J46586_10011631 | 3300003203 | Bacteria | 3853 |
| 3 | Ga0065704_10273450 | 3300005289 | Unclassified | 938 |
| 4 | Ga0065715_10109109 | 3300005293 | Unclassified | 2684 |
| 5 | Ga0065707_10217109 | 3300005295 | Bacteria | 1240 |
| 6 | Ga0070658_10027002 | 3300005327 | Bacteria | 4610 |
| 7 | Ga0070683_100038343 | 3300005329 | Bacteria | 4392 |
| 8 | Ga0070683_100091259 | 3300005329 | Bacteria | 2860 |
| 9 | Ga0070683_100276727 | 3300005329 | Bacteria | 1597 |
| 10 | Ga0070690_100004138 | 3300005330 | Bacteria | 8025 |
| 11 | Ga0070670_100171829 | 3300005331 | Unclassified | 1880 |
| 12 | Ga0070670_100469406 | 3300005331 | Bacteria | 1117 |
| 13 | Ga0070677_10051105 | 3300005333 | Bacteria | 1672 |
| 14 | Ga0068869_100009193 | 3300005334 | Bacteria | 6404 |
| 15 | Ga0070680_100659837 | 3300005336 | Bacteria | 899 |
| 16 | Ga0068868_100039004 | 3300005338 | Bacteria | 3688 |
| 17 | Ga0070660_100158991 | 3300005339 | Bacteria | 1820 |
| 18 | Ga0070689_100006561 | 3300005340 | Bacteria | 8069 |
| 19 | Ga0070689_100314015 | 3300005340 | Unclassified | 1307 |
| 20 | Ga0070687_100205592 | 3300005343 | Bacteria | 1196 |
| 21 | Ga0070692_10076976 | 3300005345 | Bacteria | 1789 |
| 22 | Ga0070668_100360288 | 3300005347 | Bacteria | 1233 |
| 23 | Ga0070669_100004976 | 3300005353 | Bacteria | 9602 |
| 24 | Ga0070675_100591551 | 3300005354 | Bacteria | 1006 |
| 25 | Ga0070671_100096601 | 3300005355 | Bacteria | 2478 |
| 26 | Ga0070667_100068904 | 3300005367 | Unclassified | 3011 |
| 27 | Ga0070703_10001166 | 3300005406 | Bacteria | 8102 |
| 28 | Ga0070709_10000098 | 3300005434 | Bacteria | 61823 |
| 29 | Ga0070713_100368944 | 3300005436 | Unclassified | 1335 |
| 30 | Ga0070711_100000059 | 3300005439 | Bacteria | 65064 |
| 31 | Ga0070705_100000819 | 3300005440 | Bacteria | 17502 |
| 32 | Ga0070700_100169569 | 3300005441 | Unclassified | 1510 |
| 33 | Ga0070694_100004228 | 3300005444 | Bacteria | 8635 |
| 34 | Ga0070694_100043235 | 3300005444 | Bacteria | 3012 |
| 35 | Ga0070694_100167277 | 3300005444 | Unclassified | 1617 |
| 36 | Ga0070694_100211232 | 3300005444 | Bacteria | 1451 |
| 37 | Ga0070708_100019994 | 3300005445 | Bacteria | 5638 |
| 38 | Ga0070663_100012394 | 3300005455 | Bacteria | 5392 |
| 39 | Ga0070678_100032442 | 3300005456 | Bacteria | 3615 |
| 40 | Ga0070678_100072961 | 3300005456 | Bacteria | 2574 |
| 41 | Ga0070681_10380821 | 3300005458 | Bacteria | 1321 |
| 42 | Ga0068867_100302612 | 3300005459 | Unclassified | 1319 |
| 43 | Ga0070706_100001316 | 3300005467 | Bacteria | 26391 |
| 44 | Ga0070707_100000343 | 3300005468 | Bacteria | 45816 |
| 45 | Ga0070707_100155076 | 3300005468 | Bacteria | 2231 |
| 46 | Ga0070698_100211950 | 3300005471 | Bacteria | 1872 |
| 47 | Ga0070699_100000009 | 3300005518 | Bacteria | 272902 |
| 48 | Ga0070699_100073212 | 3300005518 | Bacteria | 2980 |
| 49 | Ga0070699_100182026 | 3300005518 | Unclassified | 1865 |
| 50 | Ga0070684_100038575 | 3300005535 | Bacteria | 4104 |
| 51 | Ga0068853_100123131 | 3300005539 | Bacteria | 2315 |
| 52 | Ga0070672_100451048 | 3300005543 | Unclassified | 1108 |
| 53 | Ga0070695_100118343 | 3300005545 | Bacteria | 1809 |
| 54 | Ga0070695_100119375 | 3300005545 | Bacteria | 1802 |
| 55 | Ga0070695_100146270 | 3300005545 | Unclassified | 1644 |
| 56 | Ga0070696_100008083 | 3300005546 | Bacteria | 7031 |
| 57 | Ga0070696_100117307 | 3300005546 | Unclassified | 1923 |
| 58 | Ga0070696_100320948 | 3300005546 | Bacteria | 1192 |
| 59 | Ga0068855_100140350 | 3300005563 | Bacteria | 2755 |
| 60 | Ga0070664_100351502 | 3300005564 | Unclassified | 1341 |
| 61 | Ga0068852_100179826 | 3300005616 | Bacteria | 1988 |
| 62 | Ga0068852_100677580 | 3300005616 | Unclassified | 1040 |
| 63 | Ga0068859_100032699 | 3300005617 | Bacteria | 5225 |
| 64 | Ga0068859_100089173 | 3300005617 | Bacteria | 3134 |
| 65 | Ga0068870_10067217 | 3300005840 | Bacteria | 1944 |
| 66 | Ga0068858_100041490 | 3300005842 | Bacteria | 4266 |
| 67 | Ga0068858_100517242 | 3300005842 | Bacteria | 1154 |
| 68 | Ga0068860_100608939 | 3300005843 | Bacteria | 1098 |
| 69 | Ga0068862_100030367 | 3300005844 | Bacteria | 4554 |
| 70 | Ga0068862_100918688 | 3300005844 | Unclassified | 861 |
| 71 | Ga0081455_10016012 | 3300005937 | Bacteria | 7255 |
| 72 | Ga0081455_10124015 | 3300005937 | Unclassified | 2031 |
| 73 | Ga0081539_10000660 | 3300005985 | Bacteria | 69312 |
| 74 | Ga0081539_10004359 | 3300005985 | Bacteria | 15776 |
| 75 | Ga0075364_10021843 | 3300006051 | Bacteria | 4035 |
| 76 | Ga0070712_100112532 | 3300006175 | Bacteria | 2034 |
| 77 | Ga0075428_100097922 | 3300006844 | Bacteria | 3198 |
| 78 | Ga0075428_100208964 | 3300006844 | Bacteria | 2109 |
| 79 | Ga0075431_100289816 | 3300006847 | Unclassified | 1656 |
| 80 | Ga0075431_100556137 | 3300006847 | Unclassified | 1134 |
| 81 | Ga0075431_100808359 | 3300006847 | Bacteria | 910 |
| 82 | Ga0075433_10055651 | 3300006852 | Bacteria | 3454 |
| 83 | Ga0075433_10124327 | 3300006852 | Bacteria | 2291 |
| 84 | Ga0075433_10402773 | 3300006852 | Unclassified | 1207 |
| 85 | Ga0075434_100038752 | 3300006871 | Bacteria | 4722 |
| 86 | Ga0075429_100054487 | 3300006880 | Bacteria | 3479 |
| 87 | Ga0075429_100343685 | 3300006880 | Unclassified | 1306 |
| 88 | Ga0075436_100009167 | 3300006914 | Bacteria | 6771 |
| 89 | Ga0075436_100018363 | 3300006914 | Bacteria | 4789 |
| 90 | Ga0075436_100314070 | 3300006914 | Bacteria | 1125 |
| 91 | Ga0097620_100032698 | 3300006931 | Bacteria | 5225 |
| 92 | Ga0097620_100089174 | 3300006931 | Bacteria | 3134 |
| 93 | Ga0075435_100177550 | 3300007076 | Bacteria | 1799 |
| 94 | Ga0075435_100515174 | 3300007076 | Bacteria | 1035 |
| 95 | Ga0105240_10283216 | 3300009093 | Bacteria | 1903 |
| 96 | Ga0111539_10006016 | 3300009094 | Bacteria | 15679 |
| 97 | Ga0111539_10021314 | 3300009094 | Bacteria | 7979 |
| 98 | Ga0105245_10052848 | 3300009098 | Bacteria | 3645 |
| 99 | Ga0114129_10039759 | 3300009147 | Bacteria | 6634 |
| 100 | Ga0114129_10171818 | 3300009147 | Bacteria | 2954 |
| 101 | Ga0114129_10192548 | 3300009147 | Bacteria | 2768 |
| 102 | Ga0114129_10251553 | 3300009147 | Bacteria | 2372 |
| 103 | Ga0114129_10621869 | 3300009147 | Unclassified | 1397 |
| 104 | Ga0114129_11300260 | 3300009147 | Bacteria | 901 |
| 105 | Ga0105243_10320443 | 3300009148 | Unclassified | 1412 |
| 106 | Ga0105248_10058064 | 3300009177 | Bacteria | 4344 |
| 107 | Ga0105249_10353967 | 3300009553 | Bacteria | 1488 |
| 108 | Ga0157370_10146755 | 3300013104 | Bacteria | 2196 |
| 109 | Ga0157369_10876951 | 3300013105 | Bacteria | 921 |
| 110 | Ga0157374_10014284 | 3300013296 | Bacteria | 6947 |
| 111 | Ga0157378_10275113 | 3300013297 | Bacteria | 1621 |
| 112 | Ga0157378_10530497 | 3300013297 | Bacteria | 1180 |
| 113 | Ga0163162_10037304 | 3300013306 | Bacteria | 4850 |
| 114 | Ga0163162_10048001 | 3300013306 | Bacteria | 4278 |
| 115 | Ga0163162_10240409 | 3300013306 | Bacteria | 1942 |
| 116 | Ga0163162_10345337 | 3300013306 | Bacteria | 1621 |
| 117 | Ga0163162_10384769 | 3300013306 | Bacteria | 1536 |
| 118 | Ga0163162_10509163 | 3300013306 | Unclassified | 1334 |
| 119 | Ga0157372_10160469 | 3300013307 | Bacteria | 2598 |
| 120 | Ga0157375_10065790 | 3300013308 | Bacteria | 3615 |
| 121 | Ga0157375_10360340 | 3300013308 | Bacteria | 1620 |
| 122 | Ga0163163_10631134 | 3300014325 | Bacteria | 1135 |
| 123 | Ga0157380_10061623 | 3300014326 | Bacteria | 3002 |
| 124 | Ga0157380_10117692 | 3300014326 | Bacteria | 2245 |
| 125 | Ga0163161_10001314 | 3300017792 | Bacteria | 18504 |
| 126 | Ga0213876_10129864 | 3300021384 | Unclassified | 1339 |
| 127 | Ga0207653_10000020 | 3300025885 | Bacteria | 136681 |
| 128 | Ga0207682_10024177 | 3300025893 | Bacteria | 2404 |
| 129 | Ga0207682_10047113 | 3300025893 | Bacteria | 1774 |
| 130 | Ga0207699_10000005 | 3300025906 | Bacteria | 534560 |
| 131 | Ga0207705_10009427 | 3300025909 | Bacteria | 7100 |
| 132 | Ga0207705_10076361 | 3300025909 | Bacteria | 2435 |
| 133 | Ga0207684_10002118 | 3300025910 | Bacteria | 20347 |
| 134 | Ga0207695_10099743 | 3300025913 | Bacteria | 2901 |
| 135 | Ga0207695_10340972 | 3300025913 | Bacteria | 1386 |
| 136 | Ga0207693_10382300 | 3300025915 | Bacteria | 1101 |
| 137 | Ga0207663_10000004 | 3300025916 | Bacteria | 294638 |
| 138 | Ga0207660_10382827 | 3300025917 | Bacteria | 1131 |
| 139 | Ga0207657_10136159 | 3300025919 | Bacteria | 2009 |
| 140 | Ga0207652_10313139 | 3300025921 | Bacteria | 1417 |
| 141 | Ga0207646_10000630 | 3300025922 | Bacteria | 45810 |
| 142 | Ga0207646_10164654 | 3300025922 | Bacteria | 2002 |
| 143 | Ga0207681_10031775 | 3300025923 | Bacteria | 3450 |
| 144 | Ga0207670_10004441 | 3300025936 | Bacteria | 7554 |
| 145 | Ga0207669_10342971 | 3300025937 | Bacteria | 1151 |
| 146 | Ga0207665_10013618 | 3300025939 | Bacteria | 5351 |
| 147 | Ga0207665_10288031 | 3300025939 | Bacteria | 1224 |
| 148 | Ga0207689_10040210 | 3300025942 | Bacteria | 3871 |
| 149 | Ga0207689_10110941 | 3300025942 | Bacteria | 2254 |
| 150 | Ga0207661_10121629 | 3300025944 | Bacteria | 2223 |
| 151 | Ga0207667_10051060 | 3300025949 | Bacteria | 4361 |
| 152 | Ga0207712_10071624 | 3300025961 | Unclassified | 2493 |
| 153 | Ga0207712_10167815 | 3300025961 | Bacteria | 1713 |
| 154 | Ga0207668_10366160 | 3300025972 | Unclassified | 1209 |
| 155 | Ga0207658_10106651 | 3300025986 | Unclassified | 2206 |
| 156 | Ga0207677_10032062 | 3300026023 | Bacteria | 3374 |
| 157 | Ga0207639_10005292 | 3300026041 | Bacteria | 8708 |
| 158 | Ga0207678_10004699 | 3300026067 | Bacteria | 12252 |
| 159 | Ga0207702_10659912 | 3300026078 | Bacteria | 1029 |
| 160 | Ga0207641_10151206 | 3300026088 | Bacteria | 2102 |
| 161 | Ga0207641_10410325 | 3300026088 | Bacteria | 1302 |
| 162 | Ga0207648_10063668 | 3300026089 | Bacteria | 3214 |
| 163 | Ga0207648_10501191 | 3300026089 | Unclassified | 1111 |
| 164 | Ga0207675_100426503 | 3300026118 | Bacteria | 1310 |
| 165 | Ga0207698_10148596 | 3300026142 | Bacteria | 2030 |
| 166 | Ga0207698_10167371 | 3300026142 | Bacteria | 1931 |
| 167 | Ga0207428_10003841 | 3300027907 | Bacteria | 14414 |
| 168 | Ga0207428_10136519 | 3300027907 | Bacteria | 1875 |
| 169 | Ga0268265_10048930 | 3300028380 | Unclassified | 3177 |
| 170 | Ga0268265_10848299 | 3300028380 | Bacteria | 894 |
| 171 | Ga0268265_10968544 | 3300028380 | Bacteria | 839 |
| 172 | Ga0268264_10090358 | 3300028381 | Bacteria | 2639 |
| 173 | Ga0268264_10111165 | 3300028381 | Bacteria | 2400 |
| 174 | Ga0265327_10004738 | 3300031251 | Bacteria | 11868 |
| 175 | Ga0307408_100115742 | 3300031548 | Bacteria | 2068 |
| 176 | Ga0316575_10181460 | 3300031665 | Bacteria | 874 |
| 177 | Ga0265314_10139771 | 3300031711 | Bacteria | 1499 |
| 178 | Ga0316576_10165467 | 3300031727 | Bacteria | 1669 |
| 179 | Ga0316576_10319279 | 3300031727 | Bacteria | 1159 |
| 180 | Ga0316576_10494909 | 3300031727 | Bacteria | 900 |
| 181 | Ga0316578_10225155 | 3300031728 | Bacteria | 1127 |
| 182 | Ga0307405_10030085 | 3300031731 | Bacteria | 3181 |
| 183 | Ga0316577_10000095 | 3300031733 | Bacteria | 24134 |
| 184 | Ga0316577_10007180 | 3300031733 | Bacteria | 5928 |
| 185 | Ga0316577_10034555 | 3300031733 | Bacteria | 2824 |
| 186 | Ga0316577_10040949 | 3300031733 | Bacteria | 2591 |
| 187 | Ga0316577_10053677 | 3300031733 | Bacteria | 2249 |
| 188 | Ga0316577_10061403 | 3300031733 | Bacteria | 2097 |
| 189 | Ga0316577_10170344 | 3300031733 | Bacteria | 1229 |
| 190 | Ga0316577_10289873 | 3300031733 | Unclassified | 927 |
| 191 | Ga0307413_10009014 | 3300031824 | Bacteria | 4749 |
| 192 | Ga0307413_10028020 | 3300031824 | Bacteria | 3130 |
| 193 | Ga0307413_10063952 | 3300031824 | Bacteria | 2283 |
| 194 | Ga0307410_10003296 | 3300031852 | Bacteria | 8066 |
| 195 | Ga0307410_10022865 | 3300031852 | Bacteria | 3873 |
| 196 | Ga0307406_10007671 | 3300031901 | Bacteria | 5991 |
| 197 | Ga0307406_10075401 | 3300031901 | Bacteria | 2225 |
| 198 | Ga0307407_10001523 | 3300031903 | Bacteria | 8493 |
| 199 | Ga0307407_10103321 | 3300031903 | Unclassified | 1773 |
| 200 | Ga0307407_10104299 | 3300031903 | Bacteria | 1766 |
| 201 | Ga0307409_100003592 | 3300031995 | Bacteria | 8474 |
| 202 | Ga0307409_100011828 | 3300031995 | Bacteria | 5526 |
| 203 | Ga0307409_100064238 | 3300031995 | Bacteria | 2882 |
| 204 | Ga0307409_100072416 | 3300031995 | Bacteria | 2744 |
| 205 | Ga0307409_100457790 | 3300031995 | Bacteria | 1233 |
| 206 | Ga0307416_100022413 | 3300032002 | Bacteria | 4559 |
| 207 | Ga0307416_100032900 | 3300032002 | Bacteria | 3925 |
| 208 | Ga0307411_10186633 | 3300032005 | Bacteria | 1579 |
| 209 | Ga0307415_100325822 | 3300032126 | Unclassified | 1283 |
| 210 | Ga0316585_10004351 | 3300032137 | Bacteria | 3939 |
| 211 | Ga0316585_10017603 | 3300032137 | Bacteria | 2162 |
| 212 | Ga0373951_0002079 | 3300035091 | Bacteria | 5130 |
| 213 | Ga0373923_0306422 | 3300035111 | Bacteria | 752 |
| 214 | Ga0316574_0008761 | 3300035398 | Bacteria | 5634 |
| 215 | Ga0316582_0019246 | 3300036647 | Bacteria | 3992 |
| 216 | Ga0316582_0038242 | 3300036647 | Bacteria | 2980 |
| 217 | Ga0316582_0105634 | 3300036647 | Bacteria | 1869 |
| 218 | Ga0316582_0146386 | 3300036647 | Bacteria | 1595 |
| 219 | Ga0316582_0242674 | 3300036647 | Bacteria | 1234 |
| 220 | Ga0316584_0003848 | 3300036712 | Bacteria | 9841 |
| 221 | Ga0316584_0008456 | 3300036712 | Bacteria | 7094 |
| 222 | Ga0316584_0011968 | 3300036712 | Bacteria | 6112 |
| 223 | Ga0316584_0032481 | 3300036712 | Bacteria | 3864 |
| 224 | Ga0316584_0047179 | 3300036712 | Bacteria | 3217 |
| 225 | Ga0316584_0122179 | 3300036712 | Bacteria | 1946 |
| 226 | Ga0316584_0180208 | 3300036712 | Bacteria | 1564 |
| 227 | Ga0316584_0194783 | 3300036712 | Bacteria | 1497 |
| 228 | Ga0316581_0002334 | 3300037588 | Bacteria | 4514 |
| 229 | Ga0436365_0405598 | 3300039437 | Bacteria | 969 |
| 230 | Ga0439434_0090500 | 3300042435 | Bacteria | 978 |
| 231 | Ga0451577_0000148 | 3300042876 | Bacteria | 155541 |
| 232 | Ga0451577_0000155 | 3300042876 | Bacteria | 152745 |
| 233 | Ga0451577_0000673 | 3300042876 | Bacteria | 53786 |
| 234 | Ga0451577_0003353 | 3300042876 | Bacteria | 17943 |
| 235 | Ga0451577_0094059 | 3300042876 | Bacteria | 2676 |
| 236 | Ga0451577_0250111 | 3300042876 | Bacteria | 1604 |
| 237 | Ga0451577_0319726 | 3300042876 | Bacteria | 1407 |
| 238 | Ga0453683_0038212 | 3300044673 | Bacteria | 3018 |
| 239 | Ga0453683_0149618 | 3300044673 | Bacteria | 1475 |
| 240 | Ga0453684_0001648 | 3300044712 | Bacteria | 60626 |
| 241 | Ga0453684_0006814 | 3300044712 | Bacteria | 21484 |
| 242 | Ga0453684_0017321 | 3300044712 | Bacteria | 11171 |
| 243 | Ga0453684_0043193 | 3300044712 | Bacteria | 6063 |
| 244 | Ga0453684_0124499 | 3300044712 | Bacteria | 3105 |
| 245 | Ga0453684_0723667 | 3300044712 | Bacteria | 1079 |
| 246 | Ga0451576_0001406 | 3300045051 | Bacteria | 41324 |
| 247 | Ga0451576_0002648 | 3300045051 | Bacteria | 26154 |
| 248 | Ga0451576_0130704 | 3300045051 | Bacteria | 2617 |
| 249 | Ga0495585_0041903 | 3300046492 | Bacteria | 2567 |
| 250 | Ga0496109_0001176 | 3300048912 | Bacteria | 21761 |
| 251 | Ga0496112_0563907 | 3300048915 | Bacteria | 1072 |
| 252 | Ga0501031_0035914 | 3300049568 | Bacteria | 3233 |
| 253 | Ga0501034_0002859 | 3300049571 | Bacteria | 20118 |
| 254 | Ga0501039_0254318 | 3300049575 | Bacteria | 1381 |
| 255 | Ga0501039_0475636 | 3300049575 | Bacteria | 981 |
| 256 | Ga0501040_0003158 | 3300049576 | Bacteria | 10676 |
| 257 | Ga0501040_0208887 | 3300049576 | Bacteria | 1388 |
| 258 | Ga0501041_0029976 | 3300049577 | Bacteria | 3283 |
| 259 | Ga0501046_0112173 | 3300049580 | Bacteria | 2082 |
| 260 | Ga0501046_0421655 | 3300049580 | Bacteria | 962 |
| 261 | Ga0501047_0264223 | 3300049581 | Bacteria | 1568 |
| 262 | Ga0501072_0001823 | 3300049588 | Bacteria | 15857 |
| 263 | Ga0501075_0071018 | 3300049591 | Bacteria | 2631 |
| 264 | Ga0501076_0387523 | 3300049592 | Bacteria | 1149 |
| 265 | Ga0501077_0111150 | 3300049593 | Bacteria | 1737 |
| 266 | Ga0501077_0129710 | 3300049593 | Bacteria | 1598 |
| 267 | Ga0501247_002574 | 3300049677 | Bacteria | 1893 |
| 268 | Ga0501249_007083 | 3300049679 | Bacteria | 2311 |
| 269 | Ga0501080_0737107 | 3300049742 | Bacteria | 867 |
| 270 | Ga0501081_0181237 | 3300049743 | Bacteria | 1524 |
| 271 | Ga0501268_001764 | 3300049765 | Bacteria | 2753 |
| 272 | Ga0501045_0168090 | 3300049824 | Bacteria | 1633 |
| 273 | nmdc:mga00v17_10629_c1 | 3300050491 | Bacteria | 5033 |
| 274 | nmdc:mga05p37_186678_c1 | 3300050507 | Bacteria | 2520 |
| 275 | nmdc:mga05p37_194346_c1 | 3300050507 | Bacteria | 2461 |
| 276 | nmdc:mga05p37_330570_c1 | 3300050507 | Unclassified | 1801 |
| 277 | nmdc:mga05p37_6327_c1 | 3300050507 | Bacteria | 13947 |
| 278 | nmdc:mga09592_52756_c1 | 3300050508 | Bacteria | 3432 |
| 279 | nmdc:mga06r32_216507_c1 | 3300050510 | Bacteria | 1903 |
| 280 | nmdc:mga06r32_223547_c1 | 3300050510 | Bacteria | 1871 |
| 281 | nmdc:mga06r32_26948_c1 | 3300050510 | Bacteria | 5363 |
| 282 | nmdc:mga06r32_468927_c1 | 3300050510 | Unclassified | 1238 |
| 283 | nmdc:mga08y16_199464_c1 | 3300050511 | Bacteria | 2074 |
| 284 | nmdc:mga08y16_29517_c1 | 3300050511 | Bacteria | 5777 |
| 285 | nmdc:mga0n895_215183_c1 | 3300050512 | Bacteria | 1951 |
| 286 | nmdc:mga0n895_422699_c1 | 3300050512 | Bacteria | 1347 |
| 287 | nmdc:mga0n895_46871_c1 | 3300050512 | Bacteria | 4224 |
| 288 | nmdc:mga0n895_773428_c1 | 3300050512 | Bacteria | 952 |
| 289 | nmdc:mga0rr50_333159_c1 | 3300050513 | Bacteria | 1274 |
| 290 | nmdc:mga08x19_17_c1 | 3300050514 | Bacteria | 313678 |
| 291 | nmdc:mga0a205_157377_c1 | 3300050515 | Bacteria | 2170 |
| 292 | nmdc:mga0a205_193109_c1 | 3300050515 | Bacteria | 1927 |
| 293 | nmdc:mga0a205_360697_c1 | 3300050515 | Unclassified | 1320 |
| 294 | nmdc:mga0a205_7607_c1 | 3300050515 | Bacteria | 9821 |
| 295 | Ga0500641_0003978 | 3300053096 | Bacteria | 5225 |
| 296 | Ga0500555_002364 | 3300053103 | Bacteria | 5491 |
| 297 | Ga0501084_0043129 | 3300054114 | Bacteria | 3774 |
| 298 | Ga0530510_0188451 | 3300061734 | Bacteria | 1531 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_100039004 | Ga0068868_1000390046 | 198 |
| 2 | 3300035111 | Ga0373923_0306422 | Ga0373923_0306422_73_711 | 210 |
| 3 | 3300050515 | nmdc:mga0a205_193109_c1 | nmdc:mga0a205_193109_c1_680_1375 | 218 |
| 4 | 3300005563 | Ga0068855_100140350 | Ga0068855_1001403503 | 219 |
| 5 | 3300014326 | Ga0157380_10117692 | Ga0157380_101176923 | 219 |
| 6 | 3300025909 | Ga0207705_10076361 | Ga0207705_100763612 | 219 |
| 7 | 3300025919 | Ga0207657_10136159 | Ga0207657_101361592 | 219 |
| 8 | 3300025921 | Ga0207652_10313139 | Ga0207652_103131392 | 219 |
| 9 | 3300025949 | Ga0207667_10051060 | Ga0207667_100510604 | 219 |
| 10 | 3300049575 | Ga0501039_0475636 | Ga0501039_0475636_11_676 | 221 |
| 11 | 3300005331 | Ga0070670_100469406 | Ga0070670_1004694062 | 223 |
| 12 | 3300031251 | Ga0265327_10004738 | Ga0265327_100047387 | 223 |
| 13 | 3300035091 | Ga0373951_0002079 | Ga0373951_0002079_442_1119 | 223 |
| 14 | 3300049592 | Ga0501076_0387523 | Ga0501076_0387523_35_715 | 226 |
| 15 | 3300050511 | nmdc:mga08y16_29517_c1 | nmdc:mga08y16_29517_c1_5074_5754 | 226 |
| 16 | 3300053096 | Ga0500641_0003978 | Ga0500641_0003978_4513_5193 | 226 |
| 17 | 3300006844 | Ga0075428_100097922 | Ga0075428_1000979225 | 228 |
| 18 | 3300049580 | Ga0501046_0112173 | Ga0501046_0112173_40_729 | 229 |
| 19 | 3300049593 | Ga0501077_0129710 | Ga0501077_0129710_79_768 | 229 |
| 20 | 3300049742 | Ga0501080_0737107 | Ga0501080_0737107_132_821 | 229 |
| 21 | 3300050512 | nmdc:mga0n895_422699_c1 | nmdc:mga0n895_422699_c1_80_772 | 229 |
| 22 | 3300031733 | Ga0316577_10289873 | Ga0316577_102898732 | 230 |
| 23 | 3300005339 | Ga0070660_100158991 | Ga0070660_1001589911 | 231 |
| 24 | 3300005455 | Ga0070663_100012394 | Ga0070663_1000123948 | 231 |
| 25 | 3300005458 | Ga0070681_10380821 | Ga0070681_103808212 | 231 |
| 26 | 3300013104 | Ga0157370_10146755 | Ga0157370_101467553 | 231 |
| 27 | 3300025913 | Ga0207695_10099743 | Ga0207695_100997431 | 231 |
| 28 | 3300026067 | Ga0207678_10004699 | Ga0207678_100046999 | 231 |
| 29 | 3300005347 | Ga0070668_100360288 | Ga0070668_1003602882 | 235 |
| 30 | 3300005843 | Ga0068860_100608939 | Ga0068860_1006089392 | 235 |
| 31 | 3300009098 | Ga0105245_10052848 | Ga0105245_100528485 | 235 |
| 32 | 3300013296 | Ga0157374_10014284 | Ga0157374_100142846 | 235 |
| 33 | 3300013306 | Ga0163162_10240409 | Ga0163162_102404091 | 235 |
| 34 | 3300013307 | Ga0157372_10160469 | Ga0157372_101604693 | 235 |
| 35 | 3300014325 | Ga0163163_10631134 | Ga0163163_106311341 | 235 |
| 36 | 3300025915 | Ga0207693_10382300 | Ga0207693_103823002 | 235 |
| 37 | 3300026023 | Ga0207677_10032062 | Ga0207677_100320625 | 235 |
| 38 | 3300026088 | Ga0207641_10151206 | Ga0207641_101512064 | 235 |
| 39 | 3300028381 | Ga0268264_10111165 | Ga0268264_101111652 | 235 |
| 40 | 3300048915 | Ga0496112_0563907 | Ga0496112_0563907_238_990 | 235 |
| 41 | 3300031824 | Ga0307413_10063952 | Ga0307413_100639523 | 236 |
| 42 | 3300031852 | Ga0307410_10022865 | Ga0307410_100228656 | 236 |
| 43 | 3300031901 | Ga0307406_10007671 | Ga0307406_100076713 | 236 |
| 44 | 3300031903 | Ga0307407_10103321 | Ga0307407_101033213 | 236 |
| 45 | 3300032002 | Ga0307416_100022413 | Ga0307416_1000224133 | 236 |
| 46 | 3300036712 | Ga0316584_0122179 | Ga0316584_0122179_24_743 | 236 |
| 47 | 3300049677 | Ga0501247_002574 | Ga0501247_002574_435_1298 | 236 |
| 48 | 3300049679 | Ga0501249_007083 | Ga0501249_007083_49_912 | 236 |
| 49 | 3300049765 | Ga0501268_001764 | Ga0501268_001764_1188_2051 | 236 |
| 50 | 3300061734 | Ga0530510_0188451 | Ga0530510_0188451_115_828 | 237 |
| 51 | 3300005937 | Ga0081455_10124015 | Ga0081455_101240152 | 238 |
| 52 | 3300005545 | Ga0070695_100118343 | Ga0070695_1001183431 | 241 |
| 53 | 3300026118 | Ga0207675_100426503 | Ga0207675_1004265031 | 241 |
| 54 | 3300026078 | Ga0207702_10659912 | Ga0207702_106599122 | 242 |
| 55 | 3300005468 | Ga0070707_100000343 | Ga0070707_10000034324 | 243 |
| 56 | 3300005937 | Ga0081455_10016012 | Ga0081455_100160123 | 243 |
| 57 | 3300006847 | Ga0075431_100289816 | Ga0075431_1002898162 | 243 |
| 58 | 3300006847 | Ga0075431_100556137 | Ga0075431_1005561372 | 243 |
| 59 | 3300006847 | Ga0075431_100808359 | Ga0075431_1008083591 | 243 |
| 60 | 3300006852 | Ga0075433_10124327 | Ga0075433_101243272 | 243 |
| 61 | 3300006914 | Ga0075436_100314070 | Ga0075436_1003140702 | 243 |
| 62 | 3300009094 | Ga0111539_10021314 | Ga0111539_100213149 | 243 |
| 63 | 3300009147 | Ga0114129_10251553 | Ga0114129_102515534 | 243 |
| 64 | 3300025922 | Ga0207646_10000630 | Ga0207646_1000063025 | 243 |
| 65 | 3300027907 | Ga0207428_10003841 | Ga0207428_1000384111 | 243 |
| 66 | 3300050507 | nmdc:mga05p37_194346_c1 | nmdc:mga05p37_194346_c1_235_1011 | 243 |
| 67 | 3300053103 | Ga0500555_002364 | Ga0500555_002364_2651_3382 | 243 |
| 68 | 3300006852 | Ga0075433_10402773 | Ga0075433_104027731 | 245 |
| 69 | 3300006175 | Ga0070712_100112532 | Ga0070712_1001125322 | 246 |
| 70 | 3300025939 | Ga0207665_10013618 | Ga0207665_100136183 | 246 |
| 71 | 3300049591 | Ga0501075_0071018 | Ga0501075_0071018_28_768 | 246 |
| 72 | 3300005436 | Ga0070713_100368944 | Ga0070713_1003689441 | 247 |
| 73 | 3300046492 | Ga0495585_0041903 | Ga0495585_0041903_1382_2131 | 247 |
| 74 | 3300005331 | Ga0070670_100171829 | Ga0070670_1001718292 | 248 |
| 75 | 3300005459 | Ga0068867_100302612 | Ga0068867_1003026121 | 248 |
| 76 | 3300005543 | Ga0070672_100451048 | Ga0070672_1004510482 | 248 |
| 77 | 3300005564 | Ga0070664_100351502 | Ga0070664_1003515021 | 248 |
| 78 | 3300026089 | Ga0207648_10501191 | Ga0207648_105011911 | 248 |
| 79 | 3300031665 | Ga0316575_10181460 | Ga0316575_101814601 | 248 |
| 80 | 3300031711 | Ga0265314_10139771 | Ga0265314_101397712 | 248 |
| 81 | 3300031727 | Ga0316576_10165467 | Ga0316576_101654672 | 248 |
| 82 | 3300031727 | Ga0316576_10319279 | Ga0316576_103192792 | 248 |
| 83 | 3300031727 | Ga0316576_10494909 | Ga0316576_104949091 | 248 |
| 84 | 3300031728 | Ga0316578_10225155 | Ga0316578_102251551 | 248 |
| 85 | 3300031733 | Ga0316577_10000095 | Ga0316577_1000009522 | 248 |
| 86 | 3300031733 | Ga0316577_10007180 | Ga0316577_100071809 | 248 |
| 87 | 3300031733 | Ga0316577_10034555 | Ga0316577_100345553 | 248 |
| 88 | 3300031733 | Ga0316577_10040949 | Ga0316577_100409491 | 248 |
| 89 | 3300031733 | Ga0316577_10053677 | Ga0316577_100536774 | 248 |
| 90 | 3300031733 | Ga0316577_10061403 | Ga0316577_100614034 | 248 |
| 91 | 3300031733 | Ga0316577_10170344 | Ga0316577_101703442 | 248 |
| 92 | 3300032137 | Ga0316585_10004351 | Ga0316585_100043513 | 248 |
| 93 | 3300032137 | Ga0316585_10017603 | Ga0316585_100176034 | 248 |
| 94 | 3300035398 | Ga0316574_0008761 | Ga0316574_0008761_475_1230 | 248 |
| 95 | 3300036647 | Ga0316582_0019246 | Ga0316582_0019246_1419_2174 | 248 |
| 96 | 3300036647 | Ga0316582_0038242 | Ga0316582_0038242_1915_2670 | 248 |
| 97 | 3300036647 | Ga0316582_0105634 | Ga0316582_0105634_792_1547 | 248 |
| 98 | 3300036647 | Ga0316582_0146386 | Ga0316582_0146386_473_1219 | 248 |
| 99 | 3300036647 | Ga0316582_0242674 | Ga0316582_0242674_274_1029 | 248 |
| 100 | 3300036712 | Ga0316584_0003848 | Ga0316584_0003848_4981_5736 | 248 |
| 101 | 3300036712 | Ga0316584_0008456 | Ga0316584_0008456_6196_6951 | 248 |
| 102 | 3300036712 | Ga0316584_0011968 | Ga0316584_0011968_3011_3766 | 248 |
| 103 | 3300036712 | Ga0316584_0032481 | Ga0316584_0032481_1050_1805 | 248 |
| 104 | 3300036712 | Ga0316584_0047179 | Ga0316584_0047179_457_1212 | 248 |
| 105 | 3300036712 | Ga0316584_0180208 | Ga0316584_0180208_563_1318 | 248 |
| 106 | 3300036712 | Ga0316584_0194783 | Ga0316584_0194783_205_960 | 248 |
| 107 | 3300037588 | Ga0316581_0002334 | Ga0316581_0002334_2967_3722 | 248 |
| 108 | 3300042876 | Ga0451577_0000155 | Ga0451577_0000155_140745_141494 | 248 |
| 109 | 3300042876 | Ga0451577_0000673 | Ga0451577_0000673_49944_50693 | 248 |
| 110 | 3300042876 | Ga0451577_0094059 | Ga0451577_0094059_1618_2367 | 248 |
| 111 | 3300044673 | Ga0453683_0149618 | Ga0453683_0149618_339_1088 | 248 |
| 112 | 3300044712 | Ga0453684_0001648 | Ga0453684_0001648_48625_49374 | 248 |
| 113 | 3300044712 | Ga0453684_0017321 | Ga0453684_0017321_340_1089 | 248 |
| 114 | 3300044712 | Ga0453684_0124499 | Ga0453684_0124499_340_1089 | 248 |
| 115 | 3300045051 | Ga0451576_0001406 | Ga0451576_0001406_11253_12002 | 248 |
| 116 | 3300049593 | Ga0501077_0111150 | Ga0501077_0111150_782_1531 | 248 |
| 117 | 3300042435 | Ga0439434_0090500 | Ga0439434_0090500_26_775 | 249 |
| 118 | 3300049581 | Ga0501047_0264223 | Ga0501047_0264223_117_866 | 249 |
| 119 | 3300003203 | JGI25406J46586_10011631 | JGI25406J46586_100116313 | 250 |
| 120 | 3300005985 | Ga0081539_10000660 | Ga0081539_1000066025 | 250 |
| 121 | 3300049743 | Ga0501081_0181237 | Ga0501081_0181237_584_1339 | 251 |
| 122 | 3300005329 | Ga0070683_100038343 | Ga0070683_1000383435 | 252 |
| 123 | 3300013306 | Ga0163162_10509163 | Ga0163162_105091632 | 252 |
| 124 | 3300042876 | Ga0451577_0319726 | Ga0451577_0319726_81_893 | 252 |
| 125 | 3300045051 | Ga0451576_0002648 | Ga0451576_0002648_23714_24526 | 252 |
| 126 | 3300005293 | Ga0065715_10109109 | Ga0065715_101091092 | 253 |
| 127 | 3300005343 | Ga0070687_100205592 | Ga0070687_1002055921 | 253 |
| 128 | 3300005355 | Ga0070671_100096601 | Ga0070671_1000966013 | 253 |
| 129 | 3300005406 | Ga0070703_10001166 | Ga0070703_100011661 | 253 |
| 130 | 3300005440 | Ga0070705_100000819 | Ga0070705_1000008197 | 253 |
| 131 | 3300005441 | Ga0070700_100169569 | Ga0070700_1001695692 | 253 |
| 132 | 3300005444 | Ga0070694_100043235 | Ga0070694_1000432353 | 253 |
| 133 | 3300005444 | Ga0070694_100167277 | Ga0070694_1001672771 | 253 |
| 134 | 3300005467 | Ga0070706_100001316 | Ga0070706_10000131627 | 253 |
| 135 | 3300005518 | Ga0070699_100000009 | Ga0070699_100000009234 | 253 |
| 136 | 3300005518 | Ga0070699_100182026 | Ga0070699_1001820261 | 253 |
| 137 | 3300005535 | Ga0070684_100038575 | Ga0070684_1000385756 | 253 |
| 138 | 3300005545 | Ga0070695_100146270 | Ga0070695_1001462701 | 253 |
| 139 | 3300005546 | Ga0070696_100008083 | Ga0070696_10000808311 | 253 |
| 140 | 3300005546 | Ga0070696_100117307 | Ga0070696_1001173073 | 253 |
| 141 | 3300006852 | Ga0075433_10055651 | Ga0075433_100556513 | 253 |
| 142 | 3300006871 | Ga0075434_100038752 | Ga0075434_1000387523 | 253 |
| 143 | 3300006880 | Ga0075429_100343685 | Ga0075429_1003436851 | 253 |
| 144 | 3300009147 | Ga0114129_11300260 | Ga0114129_113002601 | 253 |
| 145 | 3300009148 | Ga0105243_10320443 | Ga0105243_103204431 | 253 |
| 146 | 3300013297 | Ga0157378_10275113 | Ga0157378_102751131 | 253 |
| 147 | 3300025885 | Ga0207653_10000020 | Ga0207653_1000002025 | 253 |
| 148 | 3300025893 | Ga0207682_10024177 | Ga0207682_100241774 | 253 |
| 149 | 3300025910 | Ga0207684_10002118 | Ga0207684_1000211825 | 253 |
| 150 | 3300025942 | Ga0207689_10110941 | Ga0207689_101109411 | 253 |
| 151 | 3300026088 | Ga0207641_10410325 | Ga0207641_104103252 | 253 |
| 152 | 3300028380 | Ga0268265_10848299 | Ga0268265_108482992 | 253 |
| 153 | 3300031548 | Ga0307408_100115742 | Ga0307408_1001157421 | 253 |
| 154 | 3300031731 | Ga0307405_10030085 | Ga0307405_100300852 | 253 |
| 155 | 3300031824 | Ga0307413_10009014 | Ga0307413_100090144 | 253 |
| 156 | 3300031824 | Ga0307413_10028020 | Ga0307413_100280204 | 253 |
| 157 | 3300031901 | Ga0307406_10075401 | Ga0307406_100754013 | 253 |
| 158 | 3300031995 | Ga0307409_100064238 | Ga0307409_1000642382 | 253 |
| 159 | 3300049571 | Ga0501034_0002859 | Ga0501034_0002859_15313_16074 | 253 |
| 160 | 3300049580 | Ga0501046_0421655 | Ga0501046_0421655_174_935 | 253 |
| 161 | 3300050512 | nmdc:mga0n895_46871_c1 | nmdc:mga0n895_46871_c1_239_1003 | 253 |
| 162 | 3300050515 | nmdc:mga0a205_7607_c1 | nmdc:mga0a205_7607_c1_990_1754 | 253 |
| 163 | 3300005289 | Ga0065704_10273450 | Ga0065704_102734501 | 255 |
| 164 | 3300005329 | Ga0070683_100091259 | Ga0070683_1000912593 | 255 |
| 165 | 3300005330 | Ga0070690_100004138 | Ga0070690_1000041389 | 255 |
| 166 | 3300005334 | Ga0068869_100009193 | Ga0068869_1000091936 | 255 |
| 167 | 3300005340 | Ga0070689_100314015 | Ga0070689_1003140152 | 255 |
| 168 | 3300005345 | Ga0070692_10076976 | Ga0070692_100769761 | 255 |
| 169 | 3300005353 | Ga0070669_100004976 | Ga0070669_1000049766 | 255 |
| 170 | 3300005444 | Ga0070694_100004228 | Ga0070694_10000422810 | 255 |
| 171 | 3300005444 | Ga0070694_100211232 | Ga0070694_1002112321 | 255 |
| 172 | 3300005445 | Ga0070708_100019994 | Ga0070708_1000199943 | 255 |
| 173 | 3300005468 | Ga0070707_100155076 | Ga0070707_1001550763 | 255 |
| 174 | 3300005471 | Ga0070698_100211950 | Ga0070698_1002119502 | 255 |
| 175 | 3300005518 | Ga0070699_100073212 | Ga0070699_1000732122 | 255 |
| 176 | 3300005545 | Ga0070695_100119375 | Ga0070695_1001193753 | 255 |
| 177 | 3300005617 | Ga0068859_100032699 | Ga0068859_1000326992 | 255 |
| 178 | 3300005844 | Ga0068862_100030367 | Ga0068862_1000303673 | 255 |
| 179 | 3300005844 | Ga0068862_100918688 | Ga0068862_1009186881 | 255 |
| 180 | 3300005985 | Ga0081539_10004359 | Ga0081539_1000435924 | 255 |
| 181 | 3300006051 | Ga0075364_10021843 | Ga0075364_100218437 | 255 |
| 182 | 3300006931 | Ga0097620_100032698 | Ga0097620_1000326989 | 255 |
| 183 | 3300009093 | Ga0105240_10283216 | Ga0105240_102832163 | 255 |
| 184 | 3300009147 | Ga0114129_10621869 | Ga0114129_106218691 | 255 |
| 185 | 3300009553 | Ga0105249_10353967 | Ga0105249_103539673 | 255 |
| 186 | 3300014326 | Ga0157380_10061623 | Ga0157380_100616234 | 255 |
| 187 | 3300025913 | Ga0207695_10340972 | Ga0207695_103409722 | 255 |
| 188 | 3300025922 | Ga0207646_10164654 | Ga0207646_101646542 | 255 |
| 189 | 3300025923 | Ga0207681_10031775 | Ga0207681_100317751 | 255 |
| 190 | 3300025942 | Ga0207689_10040210 | Ga0207689_100402102 | 255 |
| 191 | 3300025944 | Ga0207661_10121629 | Ga0207661_101216293 | 255 |
| 192 | 3300025961 | Ga0207712_10167815 | Ga0207712_101678151 | 255 |
| 193 | 3300025972 | Ga0207668_10366160 | Ga0207668_103661602 | 255 |
| 194 | 3300048912 | Ga0496109_0001176 | Ga0496109_0001176_8911_9678 | 255 |
| 195 | 3300049576 | Ga0501040_0208887 | Ga0501040_0208887_128_895 | 255 |
| 196 | 3300050491 | nmdc:mga00v17_10629_c1 | nmdc:mga00v17_10629_c1_2518_3285 | 255 |
| 197 | 3300050507 | nmdc:mga05p37_330570_c1 | nmdc:mga05p37_330570_c1_182_949 | 255 |
| 198 | 3300050510 | nmdc:mga06r32_216507_c1 | nmdc:mga06r32_216507_c1_265_1032 | 255 |
| 199 | 3300050510 | nmdc:mga06r32_223547_c1 | nmdc:mga06r32_223547_c1_32_799 | 255 |
| 200 | 3300050510 | nmdc:mga06r32_26948_c1 | nmdc:mga06r32_26948_c1_4444_5211 | 255 |
| 201 | 3300050510 | nmdc:mga06r32_468927_c1 | nmdc:mga06r32_468927_c1_380_1147 | 255 |
| 202 | 3300050512 | nmdc:mga0n895_215183_c1 | nmdc:mga0n895_215183_c1_628_1395 | 255 |
| 203 | 3300050512 | nmdc:mga0n895_773428_c1 | nmdc:mga0n895_773428_c1_28_795 | 255 |
| 204 | 3300050513 | nmdc:mga0rr50_333159_c1 | nmdc:mga0rr50_333159_c1_255_1022 | 255 |
| 205 | 3300050515 | nmdc:mga0a205_157377_c1 | nmdc:mga0a205_157377_c1_633_1400 | 255 |
| 206 | 3300054114 | Ga0501084_0043129 | Ga0501084_0043129_502_1269 | 255 |
| 207 | 3300013306 | Ga0163162_10384769 | Ga0163162_103847691 | 256 |
| 208 | 3300005295 | Ga0065707_10217109 | Ga0065707_102171091 | 257 |
| 209 | 3300005336 | Ga0070680_100659837 | Ga0070680_1006598371 | 257 |
| 210 | 3300009094 | Ga0111539_10006016 | Ga0111539_100060167 | 257 |
| 211 | 3300009147 | Ga0114129_10192548 | Ga0114129_101925482 | 257 |
| 212 | 3300025917 | Ga0207660_10382827 | Ga0207660_103828271 | 257 |
| 213 | 3300027907 | Ga0207428_10136519 | Ga0207428_101365192 | 257 |
| 214 | 3300028380 | Ga0268265_10968544 | Ga0268265_109685441 | 257 |
| 215 | 3300032126 | Ga0307415_100325822 | Ga0307415_1003258221 | 257 |
| 216 | 3300042876 | Ga0451577_0000148 | Ga0451577_0000148_36090_36884 | 257 |
| 217 | 3300042876 | Ga0451577_0003353 | Ga0451577_0003353_3642_4454 | 257 |
| 218 | 3300042876 | Ga0451577_0250111 | Ga0451577_0250111_725_1537 | 257 |
| 219 | 3300044673 | Ga0453683_0038212 | Ga0453683_0038212_1512_2324 | 257 |
| 220 | 3300044712 | Ga0453684_0006814 | Ga0453684_0006814_4584_5378 | 257 |
| 221 | 3300044712 | Ga0453684_0043193 | Ga0453684_0043193_3226_4023 | 257 |
| 222 | 3300044712 | Ga0453684_0723667 | Ga0453684_0723667_28_840 | 257 |
| 223 | 3300045051 | Ga0451576_0130704 | Ga0451576_0130704_1169_1966 | 257 |
| 224 | 3300050507 | nmdc:mga05p37_186678_c1 | nmdc:mga05p37_186678_c1_781_1554 | 257 |
| 225 | 3300050511 | nmdc:mga08y16_199464_c1 | nmdc:mga08y16_199464_c1_793_1566 | 257 |
| 226 | 3300005434 | Ga0070709_10000098 | Ga0070709_1000009825 | 258 |
| 227 | 3300005439 | Ga0070711_100000059 | Ga0070711_10000005925 | 258 |
| 228 | 3300005546 | Ga0070696_100320948 | Ga0070696_1003209481 | 258 |
| 229 | 3300006844 | Ga0075428_100208964 | Ga0075428_1002089641 | 258 |
| 230 | 3300006880 | Ga0075429_100054487 | Ga0075429_1000544873 | 258 |
| 231 | 3300006914 | Ga0075436_100009167 | Ga0075436_1000091672 | 258 |
| 232 | 3300006914 | Ga0075436_100018363 | Ga0075436_1000183636 | 258 |
| 233 | 3300007076 | Ga0075435_100177550 | Ga0075435_1001775502 | 258 |
| 234 | 3300007076 | Ga0075435_100515174 | Ga0075435_1005151742 | 258 |
| 235 | 3300009147 | Ga0114129_10039759 | Ga0114129_100397598 | 258 |
| 236 | 3300009147 | Ga0114129_10171818 | Ga0114129_101718183 | 258 |
| 237 | 3300025906 | Ga0207699_10000005 | Ga0207699_1000000525 | 258 |
| 238 | 3300025916 | Ga0207663_10000004 | Ga0207663_10000004122 | 258 |
| 239 | 3300025939 | Ga0207665_10288031 | Ga0207665_102880312 | 258 |
| 240 | 3300049568 | Ga0501031_0035914 | Ga0501031_0035914_1088_1864 | 258 |
| 241 | 3300049575 | Ga0501039_0254318 | Ga0501039_0254318_70_846 | 258 |
| 242 | 3300049576 | Ga0501040_0003158 | Ga0501040_0003158_2974_3750 | 258 |
| 243 | 3300049577 | Ga0501041_0029976 | Ga0501041_0029976_2481_3257 | 258 |
| 244 | 3300049824 | Ga0501045_0168090 | Ga0501045_0168090_123_899 | 258 |
| 245 | 3300050507 | nmdc:mga05p37_6327_c1 | nmdc:mga05p37_6327_c1_279_1094 | 258 |
| 246 | 3300050508 | nmdc:mga09592_52756_c1 | nmdc:mga09592_52756_c1_1366_2142 | 258 |
| 247 | 3300050514 | nmdc:mga08x19_17_c1 | nmdc:mga08x19_17_c1_25725_26501 | 258 |
| 248 | 3300050515 | nmdc:mga0a205_360697_c1 | nmdc:mga0a205_360697_c1_496_1272 | 258 |
| 249 | 3300005456 | Ga0070678_100072961 | Ga0070678_1000729614 | 264 |
| 250 | 3300000549 | LJQas_1000049 | LJQas_100004925 | 265 |
| 251 | 3300005327 | Ga0070658_10027002 | Ga0070658_100270026 | 265 |
| 252 | 3300005329 | Ga0070683_100276727 | Ga0070683_1002767272 | 265 |
| 253 | 3300005333 | Ga0070677_10051105 | Ga0070677_100511052 | 265 |
| 254 | 3300005340 | Ga0070689_100006561 | Ga0070689_1000065616 | 265 |
| 255 | 3300005354 | Ga0070675_100591551 | Ga0070675_1005915511 | 265 |
| 256 | 3300005367 | Ga0070667_100068904 | Ga0070667_1000689043 | 265 |
| 257 | 3300005456 | Ga0070678_100032442 | Ga0070678_1000324423 | 265 |
| 258 | 3300005539 | Ga0068853_100123131 | Ga0068853_1001231312 | 265 |
| 259 | 3300005616 | Ga0068852_100179826 | Ga0068852_1001798263 | 265 |
| 260 | 3300005616 | Ga0068852_100677580 | Ga0068852_1006775802 | 265 |
| 261 | 3300005617 | Ga0068859_100089173 | Ga0068859_1000891733 | 265 |
| 262 | 3300005840 | Ga0068870_10067217 | Ga0068870_100672171 | 265 |
| 263 | 3300005842 | Ga0068858_100041490 | Ga0068858_1000414904 | 265 |
| 264 | 3300005842 | Ga0068858_100517242 | Ga0068858_1005172422 | 265 |
| 265 | 3300006931 | Ga0097620_100089174 | Ga0097620_1000891743 | 265 |
| 266 | 3300009177 | Ga0105248_10058064 | Ga0105248_100580646 | 265 |
| 267 | 3300013105 | Ga0157369_10876951 | Ga0157369_108769511 | 265 |
| 268 | 3300013297 | Ga0157378_10530497 | Ga0157378_105304972 | 265 |
| 269 | 3300013306 | Ga0163162_10037304 | Ga0163162_100373043 | 265 |
| 270 | 3300013306 | Ga0163162_10048001 | Ga0163162_100480014 | 265 |
| 271 | 3300013306 | Ga0163162_10345337 | Ga0163162_103453373 | 265 |
| 272 | 3300013308 | Ga0157375_10065790 | Ga0157375_100657903 | 265 |
| 273 | 3300013308 | Ga0157375_10360340 | Ga0157375_103603402 | 265 |
| 274 | 3300017792 | Ga0163161_10001314 | Ga0163161_1000131425 | 265 |
| 275 | 3300021384 | Ga0213876_10129864 | Ga0213876_101298641 | 265 |
| 276 | 3300025893 | Ga0207682_10047113 | Ga0207682_100471134 | 265 |
| 277 | 3300025909 | Ga0207705_10009427 | Ga0207705_100094273 | 265 |
| 278 | 3300025936 | Ga0207670_10004441 | Ga0207670_100044416 | 265 |
| 279 | 3300025937 | Ga0207669_10342971 | Ga0207669_103429712 | 265 |
| 280 | 3300025961 | Ga0207712_10071624 | Ga0207712_100716244 | 265 |
| 281 | 3300025986 | Ga0207658_10106651 | Ga0207658_101066513 | 265 |
| 282 | 3300026041 | Ga0207639_10005292 | Ga0207639_1000529212 | 265 |
| 283 | 3300026089 | Ga0207648_10063668 | Ga0207648_100636686 | 265 |
| 284 | 3300026142 | Ga0207698_10148596 | Ga0207698_101485964 | 265 |
| 285 | 3300026142 | Ga0207698_10167371 | Ga0207698_101673712 | 265 |
| 286 | 3300028380 | Ga0268265_10048930 | Ga0268265_100489303 | 265 |
| 287 | 3300028381 | Ga0268264_10090358 | Ga0268264_100903582 | 265 |
| 288 | 3300031852 | Ga0307410_10003296 | Ga0307410_1000329611 | 265 |
| 289 | 3300031903 | Ga0307407_10001523 | Ga0307407_100015233 | 265 |
| 290 | 3300031903 | Ga0307407_10104299 | Ga0307407_101042991 | 265 |
| 291 | 3300031995 | Ga0307409_100003592 | Ga0307409_10000359210 | 265 |
| 292 | 3300031995 | Ga0307409_100011828 | Ga0307409_1000118282 | 265 |
| 293 | 3300031995 | Ga0307409_100072416 | Ga0307409_1000724165 | 265 |
| 294 | 3300031995 | Ga0307409_100457790 | Ga0307409_1004577902 | 265 |
| 295 | 3300032002 | Ga0307416_100032900 | Ga0307416_1000329006 | 265 |
| 296 | 3300032005 | Ga0307411_10186633 | Ga0307411_101866332 | 265 |
| 297 | 3300039437 | Ga0436365_0405598 | Ga0436365_0405598_153_950 | 265 |
| 298 | 3300049588 | Ga0501072_0001823 | Ga0501072_0001823_13452_14318 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tb5-assembly2.cif.gz_B | crystal structure of the enterococcus faecalis methionine aminopeptidase apo form | 0.9877 | 1 | 246 |
| 3mr1-assembly2.cif.gz_B | crystal structure of methionine aminopeptidase from rickettsia prowazekii | 0.9876 | 1 | 247 |
| 1o0x-assembly1.cif.gz_A | crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution | 0.986 | 1 | 247 |
| 4juq-assembly1.cif.gz_A | pseudomonas aeruginosa metap t2n mutant, in mn form | 0.9857 | 1 | 250 |
| 5yoh-assembly1.cif.gz_A | mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine | 0.9834 | 4 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4juqD00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9893 | 1 | 249 | 3.90.230.10 |
| af_Q4VBS4_53_336_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.986 | 1 | 249 | 3.90.230.10 |
| 1o0xA00 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.986 | 1 | 247 | 3.90.230.10 |
| af_P9WK19_6_284_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.985 | 4 | 246 | 3.90.230.10 |
| af_Q9VKV9_33_317_3.90.230.10 | Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily | 0.9849 | 1 | 246 | 3.90.230.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381NBN9-F1-model_v4 | Peptidase M24 domain-containing protein | 0.9988 | 14 | 246 |
GO:0005829
GO:0006508 GO:0070006 |
| AF-A0A7X7PQL7-F1-model_v4 | Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) | 0.9962 | 1 | 247 |
GO:0004239
GO:0005829 GO:0006508 GO:0046872 GO:0070006 |
| AF-A0A7K1IN49-F1-model_v4 | deleted | 0.9961 | 31 | 164 |
|
| AF-H9GMZ4-F1-model_v4 | Methionyl aminopeptidase type 1D, mitochondrial | 0.9958 | 35 | 137 |
|
| AF-K3YJQ4-F1-model_v4 | Peptidase M24 domain-containing protein | 0.9957 | 3 | 137 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar