F394238

General Info

Members Datasets Scaffolds Average Seq Length
298 176 298 254

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10039759|Ga0114129_100397598
Length 271
Sequence MRIKVHGRQWLTMIIRKSKLEIERMRASGRIVAEVLKRLSEMIEPGMTTLDLDHEAERMIVGAGAYPTFKGYHGFPRSICASINDEVVHGIPSKRKVRDGDIVGIDCGATYMGYVGDAAVTVPVGSRVRDDVWKLINATRRSLYAAIEKCRVGNRLGDVCNAVQSYIEPLGYSVVKNYCGHGVGRAMHEEPQVPNYGKPGTGPVLREGLVIAIEPMINLGHEDVKVLSDGWTVITLDGQPSAHFEHTVAITRDGPQILTMLDNGAAAVEVA

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
132 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
159 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
174 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 0.67
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000049 3300000549 Bacteria 19104
2 JGI25406J46586_10011631 3300003203 Bacteria 3853
3 Ga0065704_10273450 3300005289 Unclassified 938
4 Ga0065715_10109109 3300005293 Unclassified 2684
5 Ga0065707_10217109 3300005295 Bacteria 1240
6 Ga0070658_10027002 3300005327 Bacteria 4610
7 Ga0070683_100038343 3300005329 Bacteria 4392
8 Ga0070683_100091259 3300005329 Bacteria 2860
9 Ga0070683_100276727 3300005329 Bacteria 1597
10 Ga0070690_100004138 3300005330 Bacteria 8025
11 Ga0070670_100171829 3300005331 Unclassified 1880
12 Ga0070670_100469406 3300005331 Bacteria 1117
13 Ga0070677_10051105 3300005333 Bacteria 1672
14 Ga0068869_100009193 3300005334 Bacteria 6404
15 Ga0070680_100659837 3300005336 Bacteria 899
16 Ga0068868_100039004 3300005338 Bacteria 3688
17 Ga0070660_100158991 3300005339 Bacteria 1820
18 Ga0070689_100006561 3300005340 Bacteria 8069
19 Ga0070689_100314015 3300005340 Unclassified 1307
20 Ga0070687_100205592 3300005343 Bacteria 1196
21 Ga0070692_10076976 3300005345 Bacteria 1789
22 Ga0070668_100360288 3300005347 Bacteria 1233
23 Ga0070669_100004976 3300005353 Bacteria 9602
24 Ga0070675_100591551 3300005354 Bacteria 1006
25 Ga0070671_100096601 3300005355 Bacteria 2478
26 Ga0070667_100068904 3300005367 Unclassified 3011
27 Ga0070703_10001166 3300005406 Bacteria 8102
28 Ga0070709_10000098 3300005434 Bacteria 61823
29 Ga0070713_100368944 3300005436 Unclassified 1335
30 Ga0070711_100000059 3300005439 Bacteria 65064
31 Ga0070705_100000819 3300005440 Bacteria 17502
32 Ga0070700_100169569 3300005441 Unclassified 1510
33 Ga0070694_100004228 3300005444 Bacteria 8635
34 Ga0070694_100043235 3300005444 Bacteria 3012
35 Ga0070694_100167277 3300005444 Unclassified 1617
36 Ga0070694_100211232 3300005444 Bacteria 1451
37 Ga0070708_100019994 3300005445 Bacteria 5638
38 Ga0070663_100012394 3300005455 Bacteria 5392
39 Ga0070678_100032442 3300005456 Bacteria 3615
40 Ga0070678_100072961 3300005456 Bacteria 2574
41 Ga0070681_10380821 3300005458 Bacteria 1321
42 Ga0068867_100302612 3300005459 Unclassified 1319
43 Ga0070706_100001316 3300005467 Bacteria 26391
44 Ga0070707_100000343 3300005468 Bacteria 45816
45 Ga0070707_100155076 3300005468 Bacteria 2231
46 Ga0070698_100211950 3300005471 Bacteria 1872
47 Ga0070699_100000009 3300005518 Bacteria 272902
48 Ga0070699_100073212 3300005518 Bacteria 2980
49 Ga0070699_100182026 3300005518 Unclassified 1865
50 Ga0070684_100038575 3300005535 Bacteria 4104
51 Ga0068853_100123131 3300005539 Bacteria 2315
52 Ga0070672_100451048 3300005543 Unclassified 1108
53 Ga0070695_100118343 3300005545 Bacteria 1809
54 Ga0070695_100119375 3300005545 Bacteria 1802
55 Ga0070695_100146270 3300005545 Unclassified 1644
56 Ga0070696_100008083 3300005546 Bacteria 7031
57 Ga0070696_100117307 3300005546 Unclassified 1923
58 Ga0070696_100320948 3300005546 Bacteria 1192
59 Ga0068855_100140350 3300005563 Bacteria 2755
60 Ga0070664_100351502 3300005564 Unclassified 1341
61 Ga0068852_100179826 3300005616 Bacteria 1988
62 Ga0068852_100677580 3300005616 Unclassified 1040
63 Ga0068859_100032699 3300005617 Bacteria 5225
64 Ga0068859_100089173 3300005617 Bacteria 3134
65 Ga0068870_10067217 3300005840 Bacteria 1944
66 Ga0068858_100041490 3300005842 Bacteria 4266
67 Ga0068858_100517242 3300005842 Bacteria 1154
68 Ga0068860_100608939 3300005843 Bacteria 1098
69 Ga0068862_100030367 3300005844 Bacteria 4554
70 Ga0068862_100918688 3300005844 Unclassified 861
71 Ga0081455_10016012 3300005937 Bacteria 7255
72 Ga0081455_10124015 3300005937 Unclassified 2031
73 Ga0081539_10000660 3300005985 Bacteria 69312
74 Ga0081539_10004359 3300005985 Bacteria 15776
75 Ga0075364_10021843 3300006051 Bacteria 4035
76 Ga0070712_100112532 3300006175 Bacteria 2034
77 Ga0075428_100097922 3300006844 Bacteria 3198
78 Ga0075428_100208964 3300006844 Bacteria 2109
79 Ga0075431_100289816 3300006847 Unclassified 1656
80 Ga0075431_100556137 3300006847 Unclassified 1134
81 Ga0075431_100808359 3300006847 Bacteria 910
82 Ga0075433_10055651 3300006852 Bacteria 3454
83 Ga0075433_10124327 3300006852 Bacteria 2291
84 Ga0075433_10402773 3300006852 Unclassified 1207
85 Ga0075434_100038752 3300006871 Bacteria 4722
86 Ga0075429_100054487 3300006880 Bacteria 3479
87 Ga0075429_100343685 3300006880 Unclassified 1306
88 Ga0075436_100009167 3300006914 Bacteria 6771
89 Ga0075436_100018363 3300006914 Bacteria 4789
90 Ga0075436_100314070 3300006914 Bacteria 1125
91 Ga0097620_100032698 3300006931 Bacteria 5225
92 Ga0097620_100089174 3300006931 Bacteria 3134
93 Ga0075435_100177550 3300007076 Bacteria 1799
94 Ga0075435_100515174 3300007076 Bacteria 1035
95 Ga0105240_10283216 3300009093 Bacteria 1903
96 Ga0111539_10006016 3300009094 Bacteria 15679
97 Ga0111539_10021314 3300009094 Bacteria 7979
98 Ga0105245_10052848 3300009098 Bacteria 3645
99 Ga0114129_10039759 3300009147 Bacteria 6634
100 Ga0114129_10171818 3300009147 Bacteria 2954
101 Ga0114129_10192548 3300009147 Bacteria 2768
102 Ga0114129_10251553 3300009147 Bacteria 2372
103 Ga0114129_10621869 3300009147 Unclassified 1397
104 Ga0114129_11300260 3300009147 Bacteria 901
105 Ga0105243_10320443 3300009148 Unclassified 1412
106 Ga0105248_10058064 3300009177 Bacteria 4344
107 Ga0105249_10353967 3300009553 Bacteria 1488
108 Ga0157370_10146755 3300013104 Bacteria 2196
109 Ga0157369_10876951 3300013105 Bacteria 921
110 Ga0157374_10014284 3300013296 Bacteria 6947
111 Ga0157378_10275113 3300013297 Bacteria 1621
112 Ga0157378_10530497 3300013297 Bacteria 1180
113 Ga0163162_10037304 3300013306 Bacteria 4850
114 Ga0163162_10048001 3300013306 Bacteria 4278
115 Ga0163162_10240409 3300013306 Bacteria 1942
116 Ga0163162_10345337 3300013306 Bacteria 1621
117 Ga0163162_10384769 3300013306 Bacteria 1536
118 Ga0163162_10509163 3300013306 Unclassified 1334
119 Ga0157372_10160469 3300013307 Bacteria 2598
120 Ga0157375_10065790 3300013308 Bacteria 3615
121 Ga0157375_10360340 3300013308 Bacteria 1620
122 Ga0163163_10631134 3300014325 Bacteria 1135
123 Ga0157380_10061623 3300014326 Bacteria 3002
124 Ga0157380_10117692 3300014326 Bacteria 2245
125 Ga0163161_10001314 3300017792 Bacteria 18504
126 Ga0213876_10129864 3300021384 Unclassified 1339
127 Ga0207653_10000020 3300025885 Bacteria 136681
128 Ga0207682_10024177 3300025893 Bacteria 2404
129 Ga0207682_10047113 3300025893 Bacteria 1774
130 Ga0207699_10000005 3300025906 Bacteria 534560
131 Ga0207705_10009427 3300025909 Bacteria 7100
132 Ga0207705_10076361 3300025909 Bacteria 2435
133 Ga0207684_10002118 3300025910 Bacteria 20347
134 Ga0207695_10099743 3300025913 Bacteria 2901
135 Ga0207695_10340972 3300025913 Bacteria 1386
136 Ga0207693_10382300 3300025915 Bacteria 1101
137 Ga0207663_10000004 3300025916 Bacteria 294638
138 Ga0207660_10382827 3300025917 Bacteria 1131
139 Ga0207657_10136159 3300025919 Bacteria 2009
140 Ga0207652_10313139 3300025921 Bacteria 1417
141 Ga0207646_10000630 3300025922 Bacteria 45810
142 Ga0207646_10164654 3300025922 Bacteria 2002
143 Ga0207681_10031775 3300025923 Bacteria 3450
144 Ga0207670_10004441 3300025936 Bacteria 7554
145 Ga0207669_10342971 3300025937 Bacteria 1151
146 Ga0207665_10013618 3300025939 Bacteria 5351
147 Ga0207665_10288031 3300025939 Bacteria 1224
148 Ga0207689_10040210 3300025942 Bacteria 3871
149 Ga0207689_10110941 3300025942 Bacteria 2254
150 Ga0207661_10121629 3300025944 Bacteria 2223
151 Ga0207667_10051060 3300025949 Bacteria 4361
152 Ga0207712_10071624 3300025961 Unclassified 2493
153 Ga0207712_10167815 3300025961 Bacteria 1713
154 Ga0207668_10366160 3300025972 Unclassified 1209
155 Ga0207658_10106651 3300025986 Unclassified 2206
156 Ga0207677_10032062 3300026023 Bacteria 3374
157 Ga0207639_10005292 3300026041 Bacteria 8708
158 Ga0207678_10004699 3300026067 Bacteria 12252
159 Ga0207702_10659912 3300026078 Bacteria 1029
160 Ga0207641_10151206 3300026088 Bacteria 2102
161 Ga0207641_10410325 3300026088 Bacteria 1302
162 Ga0207648_10063668 3300026089 Bacteria 3214
163 Ga0207648_10501191 3300026089 Unclassified 1111
164 Ga0207675_100426503 3300026118 Bacteria 1310
165 Ga0207698_10148596 3300026142 Bacteria 2030
166 Ga0207698_10167371 3300026142 Bacteria 1931
167 Ga0207428_10003841 3300027907 Bacteria 14414
168 Ga0207428_10136519 3300027907 Bacteria 1875
169 Ga0268265_10048930 3300028380 Unclassified 3177
170 Ga0268265_10848299 3300028380 Bacteria 894
171 Ga0268265_10968544 3300028380 Bacteria 839
172 Ga0268264_10090358 3300028381 Bacteria 2639
173 Ga0268264_10111165 3300028381 Bacteria 2400
174 Ga0265327_10004738 3300031251 Bacteria 11868
175 Ga0307408_100115742 3300031548 Bacteria 2068
176 Ga0316575_10181460 3300031665 Bacteria 874
177 Ga0265314_10139771 3300031711 Bacteria 1499
178 Ga0316576_10165467 3300031727 Bacteria 1669
179 Ga0316576_10319279 3300031727 Bacteria 1159
180 Ga0316576_10494909 3300031727 Bacteria 900
181 Ga0316578_10225155 3300031728 Bacteria 1127
182 Ga0307405_10030085 3300031731 Bacteria 3181
183 Ga0316577_10000095 3300031733 Bacteria 24134
184 Ga0316577_10007180 3300031733 Bacteria 5928
185 Ga0316577_10034555 3300031733 Bacteria 2824
186 Ga0316577_10040949 3300031733 Bacteria 2591
187 Ga0316577_10053677 3300031733 Bacteria 2249
188 Ga0316577_10061403 3300031733 Bacteria 2097
189 Ga0316577_10170344 3300031733 Bacteria 1229
190 Ga0316577_10289873 3300031733 Unclassified 927
191 Ga0307413_10009014 3300031824 Bacteria 4749
192 Ga0307413_10028020 3300031824 Bacteria 3130
193 Ga0307413_10063952 3300031824 Bacteria 2283
194 Ga0307410_10003296 3300031852 Bacteria 8066
195 Ga0307410_10022865 3300031852 Bacteria 3873
196 Ga0307406_10007671 3300031901 Bacteria 5991
197 Ga0307406_10075401 3300031901 Bacteria 2225
198 Ga0307407_10001523 3300031903 Bacteria 8493
199 Ga0307407_10103321 3300031903 Unclassified 1773
200 Ga0307407_10104299 3300031903 Bacteria 1766
201 Ga0307409_100003592 3300031995 Bacteria 8474
202 Ga0307409_100011828 3300031995 Bacteria 5526
203 Ga0307409_100064238 3300031995 Bacteria 2882
204 Ga0307409_100072416 3300031995 Bacteria 2744
205 Ga0307409_100457790 3300031995 Bacteria 1233
206 Ga0307416_100022413 3300032002 Bacteria 4559
207 Ga0307416_100032900 3300032002 Bacteria 3925
208 Ga0307411_10186633 3300032005 Bacteria 1579
209 Ga0307415_100325822 3300032126 Unclassified 1283
210 Ga0316585_10004351 3300032137 Bacteria 3939
211 Ga0316585_10017603 3300032137 Bacteria 2162
212 Ga0373951_0002079 3300035091 Bacteria 5130
213 Ga0373923_0306422 3300035111 Bacteria 752
214 Ga0316574_0008761 3300035398 Bacteria 5634
215 Ga0316582_0019246 3300036647 Bacteria 3992
216 Ga0316582_0038242 3300036647 Bacteria 2980
217 Ga0316582_0105634 3300036647 Bacteria 1869
218 Ga0316582_0146386 3300036647 Bacteria 1595
219 Ga0316582_0242674 3300036647 Bacteria 1234
220 Ga0316584_0003848 3300036712 Bacteria 9841
221 Ga0316584_0008456 3300036712 Bacteria 7094
222 Ga0316584_0011968 3300036712 Bacteria 6112
223 Ga0316584_0032481 3300036712 Bacteria 3864
224 Ga0316584_0047179 3300036712 Bacteria 3217
225 Ga0316584_0122179 3300036712 Bacteria 1946
226 Ga0316584_0180208 3300036712 Bacteria 1564
227 Ga0316584_0194783 3300036712 Bacteria 1497
228 Ga0316581_0002334 3300037588 Bacteria 4514
229 Ga0436365_0405598 3300039437 Bacteria 969
230 Ga0439434_0090500 3300042435 Bacteria 978
231 Ga0451577_0000148 3300042876 Bacteria 155541
232 Ga0451577_0000155 3300042876 Bacteria 152745
233 Ga0451577_0000673 3300042876 Bacteria 53786
234 Ga0451577_0003353 3300042876 Bacteria 17943
235 Ga0451577_0094059 3300042876 Bacteria 2676
236 Ga0451577_0250111 3300042876 Bacteria 1604
237 Ga0451577_0319726 3300042876 Bacteria 1407
238 Ga0453683_0038212 3300044673 Bacteria 3018
239 Ga0453683_0149618 3300044673 Bacteria 1475
240 Ga0453684_0001648 3300044712 Bacteria 60626
241 Ga0453684_0006814 3300044712 Bacteria 21484
242 Ga0453684_0017321 3300044712 Bacteria 11171
243 Ga0453684_0043193 3300044712 Bacteria 6063
244 Ga0453684_0124499 3300044712 Bacteria 3105
245 Ga0453684_0723667 3300044712 Bacteria 1079
246 Ga0451576_0001406 3300045051 Bacteria 41324
247 Ga0451576_0002648 3300045051 Bacteria 26154
248 Ga0451576_0130704 3300045051 Bacteria 2617
249 Ga0495585_0041903 3300046492 Bacteria 2567
250 Ga0496109_0001176 3300048912 Bacteria 21761
251 Ga0496112_0563907 3300048915 Bacteria 1072
252 Ga0501031_0035914 3300049568 Bacteria 3233
253 Ga0501034_0002859 3300049571 Bacteria 20118
254 Ga0501039_0254318 3300049575 Bacteria 1381
255 Ga0501039_0475636 3300049575 Bacteria 981
256 Ga0501040_0003158 3300049576 Bacteria 10676
257 Ga0501040_0208887 3300049576 Bacteria 1388
258 Ga0501041_0029976 3300049577 Bacteria 3283
259 Ga0501046_0112173 3300049580 Bacteria 2082
260 Ga0501046_0421655 3300049580 Bacteria 962
261 Ga0501047_0264223 3300049581 Bacteria 1568
262 Ga0501072_0001823 3300049588 Bacteria 15857
263 Ga0501075_0071018 3300049591 Bacteria 2631
264 Ga0501076_0387523 3300049592 Bacteria 1149
265 Ga0501077_0111150 3300049593 Bacteria 1737
266 Ga0501077_0129710 3300049593 Bacteria 1598
267 Ga0501247_002574 3300049677 Bacteria 1893
268 Ga0501249_007083 3300049679 Bacteria 2311
269 Ga0501080_0737107 3300049742 Bacteria 867
270 Ga0501081_0181237 3300049743 Bacteria 1524
271 Ga0501268_001764 3300049765 Bacteria 2753
272 Ga0501045_0168090 3300049824 Bacteria 1633
273 nmdc:mga00v17_10629_c1 3300050491 Bacteria 5033
274 nmdc:mga05p37_186678_c1 3300050507 Bacteria 2520
275 nmdc:mga05p37_194346_c1 3300050507 Bacteria 2461
276 nmdc:mga05p37_330570_c1 3300050507 Unclassified 1801
277 nmdc:mga05p37_6327_c1 3300050507 Bacteria 13947
278 nmdc:mga09592_52756_c1 3300050508 Bacteria 3432
279 nmdc:mga06r32_216507_c1 3300050510 Bacteria 1903
280 nmdc:mga06r32_223547_c1 3300050510 Bacteria 1871
281 nmdc:mga06r32_26948_c1 3300050510 Bacteria 5363
282 nmdc:mga06r32_468927_c1 3300050510 Unclassified 1238
283 nmdc:mga08y16_199464_c1 3300050511 Bacteria 2074
284 nmdc:mga08y16_29517_c1 3300050511 Bacteria 5777
285 nmdc:mga0n895_215183_c1 3300050512 Bacteria 1951
286 nmdc:mga0n895_422699_c1 3300050512 Bacteria 1347
287 nmdc:mga0n895_46871_c1 3300050512 Bacteria 4224
288 nmdc:mga0n895_773428_c1 3300050512 Bacteria 952
289 nmdc:mga0rr50_333159_c1 3300050513 Bacteria 1274
290 nmdc:mga08x19_17_c1 3300050514 Bacteria 313678
291 nmdc:mga0a205_157377_c1 3300050515 Bacteria 2170
292 nmdc:mga0a205_193109_c1 3300050515 Bacteria 1927
293 nmdc:mga0a205_360697_c1 3300050515 Unclassified 1320
294 nmdc:mga0a205_7607_c1 3300050515 Bacteria 9821
295 Ga0500641_0003978 3300053096 Bacteria 5225
296 Ga0500555_002364 3300053103 Bacteria 5491
297 Ga0501084_0043129 3300054114 Bacteria 3774
298 Ga0530510_0188451 3300061734 Bacteria 1531

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100039004 Ga0068868_1000390046 198
2 3300035111 Ga0373923_0306422 Ga0373923_0306422_73_711 210
3 3300050515 nmdc:mga0a205_193109_c1 nmdc:mga0a205_193109_c1_680_1375 218
4 3300005563 Ga0068855_100140350 Ga0068855_1001403503 219
5 3300014326 Ga0157380_10117692 Ga0157380_101176923 219
6 3300025909 Ga0207705_10076361 Ga0207705_100763612 219
7 3300025919 Ga0207657_10136159 Ga0207657_101361592 219
8 3300025921 Ga0207652_10313139 Ga0207652_103131392 219
9 3300025949 Ga0207667_10051060 Ga0207667_100510604 219
10 3300049575 Ga0501039_0475636 Ga0501039_0475636_11_676 221
11 3300005331 Ga0070670_100469406 Ga0070670_1004694062 223
12 3300031251 Ga0265327_10004738 Ga0265327_100047387 223
13 3300035091 Ga0373951_0002079 Ga0373951_0002079_442_1119 223
14 3300049592 Ga0501076_0387523 Ga0501076_0387523_35_715 226
15 3300050511 nmdc:mga08y16_29517_c1 nmdc:mga08y16_29517_c1_5074_5754 226
16 3300053096 Ga0500641_0003978 Ga0500641_0003978_4513_5193 226
17 3300006844 Ga0075428_100097922 Ga0075428_1000979225 228
18 3300049580 Ga0501046_0112173 Ga0501046_0112173_40_729 229
19 3300049593 Ga0501077_0129710 Ga0501077_0129710_79_768 229
20 3300049742 Ga0501080_0737107 Ga0501080_0737107_132_821 229
21 3300050512 nmdc:mga0n895_422699_c1 nmdc:mga0n895_422699_c1_80_772 229
22 3300031733 Ga0316577_10289873 Ga0316577_102898732 230
23 3300005339 Ga0070660_100158991 Ga0070660_1001589911 231
24 3300005455 Ga0070663_100012394 Ga0070663_1000123948 231
25 3300005458 Ga0070681_10380821 Ga0070681_103808212 231
26 3300013104 Ga0157370_10146755 Ga0157370_101467553 231
27 3300025913 Ga0207695_10099743 Ga0207695_100997431 231
28 3300026067 Ga0207678_10004699 Ga0207678_100046999 231
29 3300005347 Ga0070668_100360288 Ga0070668_1003602882 235
30 3300005843 Ga0068860_100608939 Ga0068860_1006089392 235
31 3300009098 Ga0105245_10052848 Ga0105245_100528485 235
32 3300013296 Ga0157374_10014284 Ga0157374_100142846 235
33 3300013306 Ga0163162_10240409 Ga0163162_102404091 235
34 3300013307 Ga0157372_10160469 Ga0157372_101604693 235
35 3300014325 Ga0163163_10631134 Ga0163163_106311341 235
36 3300025915 Ga0207693_10382300 Ga0207693_103823002 235
37 3300026023 Ga0207677_10032062 Ga0207677_100320625 235
38 3300026088 Ga0207641_10151206 Ga0207641_101512064 235
39 3300028381 Ga0268264_10111165 Ga0268264_101111652 235
40 3300048915 Ga0496112_0563907 Ga0496112_0563907_238_990 235
41 3300031824 Ga0307413_10063952 Ga0307413_100639523 236
42 3300031852 Ga0307410_10022865 Ga0307410_100228656 236
43 3300031901 Ga0307406_10007671 Ga0307406_100076713 236
44 3300031903 Ga0307407_10103321 Ga0307407_101033213 236
45 3300032002 Ga0307416_100022413 Ga0307416_1000224133 236
46 3300036712 Ga0316584_0122179 Ga0316584_0122179_24_743 236
47 3300049677 Ga0501247_002574 Ga0501247_002574_435_1298 236
48 3300049679 Ga0501249_007083 Ga0501249_007083_49_912 236
49 3300049765 Ga0501268_001764 Ga0501268_001764_1188_2051 236
50 3300061734 Ga0530510_0188451 Ga0530510_0188451_115_828 237
51 3300005937 Ga0081455_10124015 Ga0081455_101240152 238
52 3300005545 Ga0070695_100118343 Ga0070695_1001183431 241
53 3300026118 Ga0207675_100426503 Ga0207675_1004265031 241
54 3300026078 Ga0207702_10659912 Ga0207702_106599122 242
55 3300005468 Ga0070707_100000343 Ga0070707_10000034324 243
56 3300005937 Ga0081455_10016012 Ga0081455_100160123 243
57 3300006847 Ga0075431_100289816 Ga0075431_1002898162 243
58 3300006847 Ga0075431_100556137 Ga0075431_1005561372 243
59 3300006847 Ga0075431_100808359 Ga0075431_1008083591 243
60 3300006852 Ga0075433_10124327 Ga0075433_101243272 243
61 3300006914 Ga0075436_100314070 Ga0075436_1003140702 243
62 3300009094 Ga0111539_10021314 Ga0111539_100213149 243
63 3300009147 Ga0114129_10251553 Ga0114129_102515534 243
64 3300025922 Ga0207646_10000630 Ga0207646_1000063025 243
65 3300027907 Ga0207428_10003841 Ga0207428_1000384111 243
66 3300050507 nmdc:mga05p37_194346_c1 nmdc:mga05p37_194346_c1_235_1011 243
67 3300053103 Ga0500555_002364 Ga0500555_002364_2651_3382 243
68 3300006852 Ga0075433_10402773 Ga0075433_104027731 245
69 3300006175 Ga0070712_100112532 Ga0070712_1001125322 246
70 3300025939 Ga0207665_10013618 Ga0207665_100136183 246
71 3300049591 Ga0501075_0071018 Ga0501075_0071018_28_768 246
72 3300005436 Ga0070713_100368944 Ga0070713_1003689441 247
73 3300046492 Ga0495585_0041903 Ga0495585_0041903_1382_2131 247
74 3300005331 Ga0070670_100171829 Ga0070670_1001718292 248
75 3300005459 Ga0068867_100302612 Ga0068867_1003026121 248
76 3300005543 Ga0070672_100451048 Ga0070672_1004510482 248
77 3300005564 Ga0070664_100351502 Ga0070664_1003515021 248
78 3300026089 Ga0207648_10501191 Ga0207648_105011911 248
79 3300031665 Ga0316575_10181460 Ga0316575_101814601 248
80 3300031711 Ga0265314_10139771 Ga0265314_101397712 248
81 3300031727 Ga0316576_10165467 Ga0316576_101654672 248
82 3300031727 Ga0316576_10319279 Ga0316576_103192792 248
83 3300031727 Ga0316576_10494909 Ga0316576_104949091 248
84 3300031728 Ga0316578_10225155 Ga0316578_102251551 248
85 3300031733 Ga0316577_10000095 Ga0316577_1000009522 248
86 3300031733 Ga0316577_10007180 Ga0316577_100071809 248
87 3300031733 Ga0316577_10034555 Ga0316577_100345553 248
88 3300031733 Ga0316577_10040949 Ga0316577_100409491 248
89 3300031733 Ga0316577_10053677 Ga0316577_100536774 248
90 3300031733 Ga0316577_10061403 Ga0316577_100614034 248
91 3300031733 Ga0316577_10170344 Ga0316577_101703442 248
92 3300032137 Ga0316585_10004351 Ga0316585_100043513 248
93 3300032137 Ga0316585_10017603 Ga0316585_100176034 248
94 3300035398 Ga0316574_0008761 Ga0316574_0008761_475_1230 248
95 3300036647 Ga0316582_0019246 Ga0316582_0019246_1419_2174 248
96 3300036647 Ga0316582_0038242 Ga0316582_0038242_1915_2670 248
97 3300036647 Ga0316582_0105634 Ga0316582_0105634_792_1547 248
98 3300036647 Ga0316582_0146386 Ga0316582_0146386_473_1219 248
99 3300036647 Ga0316582_0242674 Ga0316582_0242674_274_1029 248
100 3300036712 Ga0316584_0003848 Ga0316584_0003848_4981_5736 248
101 3300036712 Ga0316584_0008456 Ga0316584_0008456_6196_6951 248
102 3300036712 Ga0316584_0011968 Ga0316584_0011968_3011_3766 248
103 3300036712 Ga0316584_0032481 Ga0316584_0032481_1050_1805 248
104 3300036712 Ga0316584_0047179 Ga0316584_0047179_457_1212 248
105 3300036712 Ga0316584_0180208 Ga0316584_0180208_563_1318 248
106 3300036712 Ga0316584_0194783 Ga0316584_0194783_205_960 248
107 3300037588 Ga0316581_0002334 Ga0316581_0002334_2967_3722 248
108 3300042876 Ga0451577_0000155 Ga0451577_0000155_140745_141494 248
109 3300042876 Ga0451577_0000673 Ga0451577_0000673_49944_50693 248
110 3300042876 Ga0451577_0094059 Ga0451577_0094059_1618_2367 248
111 3300044673 Ga0453683_0149618 Ga0453683_0149618_339_1088 248
112 3300044712 Ga0453684_0001648 Ga0453684_0001648_48625_49374 248
113 3300044712 Ga0453684_0017321 Ga0453684_0017321_340_1089 248
114 3300044712 Ga0453684_0124499 Ga0453684_0124499_340_1089 248
115 3300045051 Ga0451576_0001406 Ga0451576_0001406_11253_12002 248
116 3300049593 Ga0501077_0111150 Ga0501077_0111150_782_1531 248
117 3300042435 Ga0439434_0090500 Ga0439434_0090500_26_775 249
118 3300049581 Ga0501047_0264223 Ga0501047_0264223_117_866 249
119 3300003203 JGI25406J46586_10011631 JGI25406J46586_100116313 250
120 3300005985 Ga0081539_10000660 Ga0081539_1000066025 250
121 3300049743 Ga0501081_0181237 Ga0501081_0181237_584_1339 251
122 3300005329 Ga0070683_100038343 Ga0070683_1000383435 252
123 3300013306 Ga0163162_10509163 Ga0163162_105091632 252
124 3300042876 Ga0451577_0319726 Ga0451577_0319726_81_893 252
125 3300045051 Ga0451576_0002648 Ga0451576_0002648_23714_24526 252
126 3300005293 Ga0065715_10109109 Ga0065715_101091092 253
127 3300005343 Ga0070687_100205592 Ga0070687_1002055921 253
128 3300005355 Ga0070671_100096601 Ga0070671_1000966013 253
129 3300005406 Ga0070703_10001166 Ga0070703_100011661 253
130 3300005440 Ga0070705_100000819 Ga0070705_1000008197 253
131 3300005441 Ga0070700_100169569 Ga0070700_1001695692 253
132 3300005444 Ga0070694_100043235 Ga0070694_1000432353 253
133 3300005444 Ga0070694_100167277 Ga0070694_1001672771 253
134 3300005467 Ga0070706_100001316 Ga0070706_10000131627 253
135 3300005518 Ga0070699_100000009 Ga0070699_100000009234 253
136 3300005518 Ga0070699_100182026 Ga0070699_1001820261 253
137 3300005535 Ga0070684_100038575 Ga0070684_1000385756 253
138 3300005545 Ga0070695_100146270 Ga0070695_1001462701 253
139 3300005546 Ga0070696_100008083 Ga0070696_10000808311 253
140 3300005546 Ga0070696_100117307 Ga0070696_1001173073 253
141 3300006852 Ga0075433_10055651 Ga0075433_100556513 253
142 3300006871 Ga0075434_100038752 Ga0075434_1000387523 253
143 3300006880 Ga0075429_100343685 Ga0075429_1003436851 253
144 3300009147 Ga0114129_11300260 Ga0114129_113002601 253
145 3300009148 Ga0105243_10320443 Ga0105243_103204431 253
146 3300013297 Ga0157378_10275113 Ga0157378_102751131 253
147 3300025885 Ga0207653_10000020 Ga0207653_1000002025 253
148 3300025893 Ga0207682_10024177 Ga0207682_100241774 253
149 3300025910 Ga0207684_10002118 Ga0207684_1000211825 253
150 3300025942 Ga0207689_10110941 Ga0207689_101109411 253
151 3300026088 Ga0207641_10410325 Ga0207641_104103252 253
152 3300028380 Ga0268265_10848299 Ga0268265_108482992 253
153 3300031548 Ga0307408_100115742 Ga0307408_1001157421 253
154 3300031731 Ga0307405_10030085 Ga0307405_100300852 253
155 3300031824 Ga0307413_10009014 Ga0307413_100090144 253
156 3300031824 Ga0307413_10028020 Ga0307413_100280204 253
157 3300031901 Ga0307406_10075401 Ga0307406_100754013 253
158 3300031995 Ga0307409_100064238 Ga0307409_1000642382 253
159 3300049571 Ga0501034_0002859 Ga0501034_0002859_15313_16074 253
160 3300049580 Ga0501046_0421655 Ga0501046_0421655_174_935 253
161 3300050512 nmdc:mga0n895_46871_c1 nmdc:mga0n895_46871_c1_239_1003 253
162 3300050515 nmdc:mga0a205_7607_c1 nmdc:mga0a205_7607_c1_990_1754 253
163 3300005289 Ga0065704_10273450 Ga0065704_102734501 255
164 3300005329 Ga0070683_100091259 Ga0070683_1000912593 255
165 3300005330 Ga0070690_100004138 Ga0070690_1000041389 255
166 3300005334 Ga0068869_100009193 Ga0068869_1000091936 255
167 3300005340 Ga0070689_100314015 Ga0070689_1003140152 255
168 3300005345 Ga0070692_10076976 Ga0070692_100769761 255
169 3300005353 Ga0070669_100004976 Ga0070669_1000049766 255
170 3300005444 Ga0070694_100004228 Ga0070694_10000422810 255
171 3300005444 Ga0070694_100211232 Ga0070694_1002112321 255
172 3300005445 Ga0070708_100019994 Ga0070708_1000199943 255
173 3300005468 Ga0070707_100155076 Ga0070707_1001550763 255
174 3300005471 Ga0070698_100211950 Ga0070698_1002119502 255
175 3300005518 Ga0070699_100073212 Ga0070699_1000732122 255
176 3300005545 Ga0070695_100119375 Ga0070695_1001193753 255
177 3300005617 Ga0068859_100032699 Ga0068859_1000326992 255
178 3300005844 Ga0068862_100030367 Ga0068862_1000303673 255
179 3300005844 Ga0068862_100918688 Ga0068862_1009186881 255
180 3300005985 Ga0081539_10004359 Ga0081539_1000435924 255
181 3300006051 Ga0075364_10021843 Ga0075364_100218437 255
182 3300006931 Ga0097620_100032698 Ga0097620_1000326989 255
183 3300009093 Ga0105240_10283216 Ga0105240_102832163 255
184 3300009147 Ga0114129_10621869 Ga0114129_106218691 255
185 3300009553 Ga0105249_10353967 Ga0105249_103539673 255
186 3300014326 Ga0157380_10061623 Ga0157380_100616234 255
187 3300025913 Ga0207695_10340972 Ga0207695_103409722 255
188 3300025922 Ga0207646_10164654 Ga0207646_101646542 255
189 3300025923 Ga0207681_10031775 Ga0207681_100317751 255
190 3300025942 Ga0207689_10040210 Ga0207689_100402102 255
191 3300025944 Ga0207661_10121629 Ga0207661_101216293 255
192 3300025961 Ga0207712_10167815 Ga0207712_101678151 255
193 3300025972 Ga0207668_10366160 Ga0207668_103661602 255
194 3300048912 Ga0496109_0001176 Ga0496109_0001176_8911_9678 255
195 3300049576 Ga0501040_0208887 Ga0501040_0208887_128_895 255
196 3300050491 nmdc:mga00v17_10629_c1 nmdc:mga00v17_10629_c1_2518_3285 255
197 3300050507 nmdc:mga05p37_330570_c1 nmdc:mga05p37_330570_c1_182_949 255
198 3300050510 nmdc:mga06r32_216507_c1 nmdc:mga06r32_216507_c1_265_1032 255
199 3300050510 nmdc:mga06r32_223547_c1 nmdc:mga06r32_223547_c1_32_799 255
200 3300050510 nmdc:mga06r32_26948_c1 nmdc:mga06r32_26948_c1_4444_5211 255
201 3300050510 nmdc:mga06r32_468927_c1 nmdc:mga06r32_468927_c1_380_1147 255
202 3300050512 nmdc:mga0n895_215183_c1 nmdc:mga0n895_215183_c1_628_1395 255
203 3300050512 nmdc:mga0n895_773428_c1 nmdc:mga0n895_773428_c1_28_795 255
204 3300050513 nmdc:mga0rr50_333159_c1 nmdc:mga0rr50_333159_c1_255_1022 255
205 3300050515 nmdc:mga0a205_157377_c1 nmdc:mga0a205_157377_c1_633_1400 255
206 3300054114 Ga0501084_0043129 Ga0501084_0043129_502_1269 255
207 3300013306 Ga0163162_10384769 Ga0163162_103847691 256
208 3300005295 Ga0065707_10217109 Ga0065707_102171091 257
209 3300005336 Ga0070680_100659837 Ga0070680_1006598371 257
210 3300009094 Ga0111539_10006016 Ga0111539_100060167 257
211 3300009147 Ga0114129_10192548 Ga0114129_101925482 257
212 3300025917 Ga0207660_10382827 Ga0207660_103828271 257
213 3300027907 Ga0207428_10136519 Ga0207428_101365192 257
214 3300028380 Ga0268265_10968544 Ga0268265_109685441 257
215 3300032126 Ga0307415_100325822 Ga0307415_1003258221 257
216 3300042876 Ga0451577_0000148 Ga0451577_0000148_36090_36884 257
217 3300042876 Ga0451577_0003353 Ga0451577_0003353_3642_4454 257
218 3300042876 Ga0451577_0250111 Ga0451577_0250111_725_1537 257
219 3300044673 Ga0453683_0038212 Ga0453683_0038212_1512_2324 257
220 3300044712 Ga0453684_0006814 Ga0453684_0006814_4584_5378 257
221 3300044712 Ga0453684_0043193 Ga0453684_0043193_3226_4023 257
222 3300044712 Ga0453684_0723667 Ga0453684_0723667_28_840 257
223 3300045051 Ga0451576_0130704 Ga0451576_0130704_1169_1966 257
224 3300050507 nmdc:mga05p37_186678_c1 nmdc:mga05p37_186678_c1_781_1554 257
225 3300050511 nmdc:mga08y16_199464_c1 nmdc:mga08y16_199464_c1_793_1566 257
226 3300005434 Ga0070709_10000098 Ga0070709_1000009825 258
227 3300005439 Ga0070711_100000059 Ga0070711_10000005925 258
228 3300005546 Ga0070696_100320948 Ga0070696_1003209481 258
229 3300006844 Ga0075428_100208964 Ga0075428_1002089641 258
230 3300006880 Ga0075429_100054487 Ga0075429_1000544873 258
231 3300006914 Ga0075436_100009167 Ga0075436_1000091672 258
232 3300006914 Ga0075436_100018363 Ga0075436_1000183636 258
233 3300007076 Ga0075435_100177550 Ga0075435_1001775502 258
234 3300007076 Ga0075435_100515174 Ga0075435_1005151742 258
235 3300009147 Ga0114129_10039759 Ga0114129_100397598 258
236 3300009147 Ga0114129_10171818 Ga0114129_101718183 258
237 3300025906 Ga0207699_10000005 Ga0207699_1000000525 258
238 3300025916 Ga0207663_10000004 Ga0207663_10000004122 258
239 3300025939 Ga0207665_10288031 Ga0207665_102880312 258
240 3300049568 Ga0501031_0035914 Ga0501031_0035914_1088_1864 258
241 3300049575 Ga0501039_0254318 Ga0501039_0254318_70_846 258
242 3300049576 Ga0501040_0003158 Ga0501040_0003158_2974_3750 258
243 3300049577 Ga0501041_0029976 Ga0501041_0029976_2481_3257 258
244 3300049824 Ga0501045_0168090 Ga0501045_0168090_123_899 258
245 3300050507 nmdc:mga05p37_6327_c1 nmdc:mga05p37_6327_c1_279_1094 258
246 3300050508 nmdc:mga09592_52756_c1 nmdc:mga09592_52756_c1_1366_2142 258
247 3300050514 nmdc:mga08x19_17_c1 nmdc:mga08x19_17_c1_25725_26501 258
248 3300050515 nmdc:mga0a205_360697_c1 nmdc:mga0a205_360697_c1_496_1272 258
249 3300005456 Ga0070678_100072961 Ga0070678_1000729614 264
250 3300000549 LJQas_1000049 LJQas_100004925 265
251 3300005327 Ga0070658_10027002 Ga0070658_100270026 265
252 3300005329 Ga0070683_100276727 Ga0070683_1002767272 265
253 3300005333 Ga0070677_10051105 Ga0070677_100511052 265
254 3300005340 Ga0070689_100006561 Ga0070689_1000065616 265
255 3300005354 Ga0070675_100591551 Ga0070675_1005915511 265
256 3300005367 Ga0070667_100068904 Ga0070667_1000689043 265
257 3300005456 Ga0070678_100032442 Ga0070678_1000324423 265
258 3300005539 Ga0068853_100123131 Ga0068853_1001231312 265
259 3300005616 Ga0068852_100179826 Ga0068852_1001798263 265
260 3300005616 Ga0068852_100677580 Ga0068852_1006775802 265
261 3300005617 Ga0068859_100089173 Ga0068859_1000891733 265
262 3300005840 Ga0068870_10067217 Ga0068870_100672171 265
263 3300005842 Ga0068858_100041490 Ga0068858_1000414904 265
264 3300005842 Ga0068858_100517242 Ga0068858_1005172422 265
265 3300006931 Ga0097620_100089174 Ga0097620_1000891743 265
266 3300009177 Ga0105248_10058064 Ga0105248_100580646 265
267 3300013105 Ga0157369_10876951 Ga0157369_108769511 265
268 3300013297 Ga0157378_10530497 Ga0157378_105304972 265
269 3300013306 Ga0163162_10037304 Ga0163162_100373043 265
270 3300013306 Ga0163162_10048001 Ga0163162_100480014 265
271 3300013306 Ga0163162_10345337 Ga0163162_103453373 265
272 3300013308 Ga0157375_10065790 Ga0157375_100657903 265
273 3300013308 Ga0157375_10360340 Ga0157375_103603402 265
274 3300017792 Ga0163161_10001314 Ga0163161_1000131425 265
275 3300021384 Ga0213876_10129864 Ga0213876_101298641 265
276 3300025893 Ga0207682_10047113 Ga0207682_100471134 265
277 3300025909 Ga0207705_10009427 Ga0207705_100094273 265
278 3300025936 Ga0207670_10004441 Ga0207670_100044416 265
279 3300025937 Ga0207669_10342971 Ga0207669_103429712 265
280 3300025961 Ga0207712_10071624 Ga0207712_100716244 265
281 3300025986 Ga0207658_10106651 Ga0207658_101066513 265
282 3300026041 Ga0207639_10005292 Ga0207639_1000529212 265
283 3300026089 Ga0207648_10063668 Ga0207648_100636686 265
284 3300026142 Ga0207698_10148596 Ga0207698_101485964 265
285 3300026142 Ga0207698_10167371 Ga0207698_101673712 265
286 3300028380 Ga0268265_10048930 Ga0268265_100489303 265
287 3300028381 Ga0268264_10090358 Ga0268264_100903582 265
288 3300031852 Ga0307410_10003296 Ga0307410_1000329611 265
289 3300031903 Ga0307407_10001523 Ga0307407_100015233 265
290 3300031903 Ga0307407_10104299 Ga0307407_101042991 265
291 3300031995 Ga0307409_100003592 Ga0307409_10000359210 265
292 3300031995 Ga0307409_100011828 Ga0307409_1000118282 265
293 3300031995 Ga0307409_100072416 Ga0307409_1000724165 265
294 3300031995 Ga0307409_100457790 Ga0307409_1004577902 265
295 3300032002 Ga0307416_100032900 Ga0307416_1000329006 265
296 3300032005 Ga0307411_10186633 Ga0307411_101866332 265
297 3300039437 Ga0436365_0405598 Ga0436365_0405598_153_950 265
298 3300049588 Ga0501072_0001823 Ga0501072_0001823_13452_14318 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

23

252

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9877 1 246
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9876 1 247
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.986 1 247
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9857 1 250
5yoh-assembly1.cif.gz_A mycobacterium tuberculosis methionine aminopeptidase type 1c (c105m mutant) in complex with methionine 0.9834 4 246
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9893 1 249 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.986 1 249 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.986 1 247 3.90.230.10
af_P9WK19_6_284_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.985 4 246 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9849 1 246 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A381NBN9-F1-model_v4 Peptidase M24 domain-containing protein 0.9988 14 246 GO:0005829
GO:0006508
GO:0070006
AF-A0A7X7PQL7-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9962 1 247 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A7K1IN49-F1-model_v4 deleted 0.9961 31 164
AF-H9GMZ4-F1-model_v4 Methionyl aminopeptidase type 1D, mitochondrial 0.9958 35 137
AF-K3YJQ4-F1-model_v4 Peptidase M24 domain-containing protein 0.9957 3 137

Feature Viewer

pLDDT pTM Quality
95.61 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map