F394262

General Info

Members Datasets Scaffolds Average Seq Length
298 214 596 310

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10072528|Ga0105246_100725282
Length 369
Sequence VTKADGAGSAAPLRSQKRLVPKPAQERDFSEGTDFADFLAAIWTPYRTCAIAGRSKGIAMKLDTTASGVYSIAPTPFNQDGSIDWTSVDRMTDFYFECGCNGFTILGVLGEAPKLDADEALQMAARVIKRANGKPIIVGVSAPGFAAMRSLSLKVMDLGAAAVMIAPGAGLKTDDQIAAYFRNAIEAIGSDIPWVLQDYPHSTGITMSNGLVKRVVTENPSLVVLKHEDWPGLDKITALRGWEKDGSMRKISILIGNNGLFFDFELDRGVDGANTGYAFPDMLVEMVNLNRSGKRDQAHDLFDAHLPLLRYDHQPGVGLAVRKHVLVRRGVLSTPTMRKPAPAFSAETRAEVDYLLERLGKRDPRAKTA

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
154 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
184 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
196 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
197 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
198 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
199 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
200 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
201 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
202 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
203 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
204 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
205 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
206 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
207 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
208 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
209 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
210 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
211 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
212 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
213 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
214 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.95
Metatranscriptomes 0
Isolates 7.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 3.02
Rhizoplane 2.35
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10072528 3300011119 Bacteria 2428
2 JGI25158J39367_1001378 3300002739 Bacteria 4282
3 JGI25159J45721_1000233 3300002987 Bacteria 26229
4 JGI25159J45721_1000255 3300002987 Bacteria 25011
5 JGI25151J46595_10002351 3300003187 Bacteria 11490
6 JGI25151J46595_10032493 3300003187 Bacteria 2021
7 JGI25165J46597_1000008 3300003214 Bacteria 478603
8 JGI25153J46596_10002199 3300003215 Bacteria 11378
9 JGI25160J50197_1000462 3300003354 Bacteria 25221
10 JGI25160J50197_1033485 3300003354 Bacteria 1291
11 JGI25161J50226_1000344 3300003374 Bacteria 24999
12 Ga0055526_1020785 3300003771 Bacteria 2315
13 Ga0055524_1000429 3300003775 Bacteria 35268
14 Ga0055536_1017316 3300003781 Bacteria 2365
15 Ga0055540_1014462 3300003792 Bacteria 2346
16 Ga0055531_10036537 3300003794 Bacteria 1513
17 Ga0055543_1000448 3300004625 Bacteria 25049
18 Ga0065165_1001789 3300005262 Bacteria 21196
19 Ga0065165_1001892 3300005262 Bacteria 20185
20 Ga0070658_10025334 3300005327 Bacteria 4756
21 Ga0070658_10160354 3300005327 Bacteria 1887
22 Ga0070676_10006271 3300005328 Bacteria 6350
23 Ga0070690_100201631 3300005330 Unclassified 1385
24 Ga0070670_100186807 3300005331 Bacteria 1799
25 Ga0068869_100004801 3300005334 Bacteria 8440
26 Ga0070666_10012631 3300005335 Bacteria 5334
27 Ga0070666_10029071 3300005335 Unclassified 3631
28 Ga0070682_100142180 3300005337 Bacteria 1637
29 Ga0068868_100028743 3300005338 Unclassified 4254
30 Ga0068868_100061802 3300005338 Bacteria 2968
31 Ga0070660_100004807 3300005339 Bacteria 9344
32 Ga0070674_100468926 3300005356 Bacteria 1043
33 Ga0070673_100028577 3300005364 Bacteria 4149
34 Ga0070659_100006735 3300005366 Bacteria 8304
35 Ga0070667_100021759 3300005367 Bacteria 5321
36 Ga0070713_100462552 3300005436 Bacteria 1193
37 Ga0070678_100052122 3300005456 Bacteria 2969
38 Ga0070681_10252247 3300005458 Bacteria 1677
39 Ga0068867_100013966 3300005459 Bacteria 5685
40 Ga0070679_100005854 3300005530 Bacteria 11409
41 Ga0070679_100051097 3300005530 Bacteria 4117
42 Ga0070684_100159554 3300005535 Bacteria 2045
43 Ga0068853_100483132 3300005539 Bacteria 1168
44 Ga0070665_100000799 3300005548 Bacteria 41263
45 Ga0070665_100008118 3300005548 Bacteria 10628
46 Ga0070665_100038762 3300005548 Bacteria 4790
47 Ga0070665_100109933 3300005548 Unclassified 2758
48 Ga0070665_100228793 3300005548 Bacteria 1859
49 Ga0070665_100280633 3300005548 Bacteria 1668
50 Ga0070665_100422991 3300005548 Bacteria 1341
51 Ga0068855_100016712 3300005563 Bacteria 8825
52 Ga0068855_100044527 3300005563 Bacteria 5251
53 Ga0068855_100127853 3300005563 Bacteria 2904
54 Ga0068857_100284351 3300005577 Bacteria 1522
55 Ga0068857_100378138 3300005577 Bacteria 1315
56 Ga0068854_100179843 3300005578 Bacteria 1651
57 Ga0068856_100048464 3300005614 Unclassified 4187
58 Ga0068856_100098117 3300005614 Bacteria 2920
59 Ga0068852_100150787 3300005616 Bacteria 2162
60 Ga0068852_100308924 3300005616 Unclassified 1533
61 Ga0068859_100093372 3300005617 Unclassified 3061
62 Ga0068859_100362506 3300005617 Bacteria 1544
63 Ga0068864_100054858 3300005618 Unclassified 3440
64 Ga0068863_100025718 3300005841 Bacteria 5614
65 Ga0068858_100015496 3300005842 Bacteria 7169
66 Ga0068858_100019188 3300005842 Bacteria 6396
67 Ga0068860_100385834 3300005843 Unclassified 1383
68 Ga0068860_100412656 3300005843 Bacteria 1337
69 Ga0081540_1000008 3300005983 Bacteria 203702
70 Ga0081539_10006736 3300005985 Bacteria 10809
71 Ga0075365_10004549 3300006038 Bacteria 7368
72 Ga0097621_100001480 3300006237 Bacteria 16099
73 Ga0097621_100007701 3300006237 Bacteria 7720
74 Ga0097621_100027224 3300006237 Bacteria 4494
75 Ga0097621_100067261 3300006237 Bacteria 2953
76 Ga0068871_100000171 3300006358 Bacteria 43487
77 Ga0068871_100010870 3300006358 Bacteria 6665
78 Ga0068871_100019649 3300006358 Bacteria 5161
79 Ga0068871_100035770 3300006358 Bacteria 3949
80 Ga0068871_100186256 3300006358 Bacteria 1786
81 Ga0075428_100040687 3300006844 Bacteria 5112
82 Ga0068865_100032496 3300006881 Bacteria 3486
83 Ga0097620_100093365 3300006931 Unclassified 3061
84 Ga0097620_100362512 3300006931 Bacteria 1544
85 Ga0079104_1000086 3300006946 Bacteria 136260
86 Ga0075435_100035805 3300007076 Bacteria 3941
87 Ga0105240_10053424 3300009093 Bacteria 5070
88 Ga0105240_10115419 3300009093 Bacteria 3242
89 Ga0105240_10217375 3300009093 Bacteria 2229
90 Ga0111539_10000654 3300009094 Bacteria 44760
91 Ga0105245_10189346 3300009098 Bacteria 1970
92 Ga0105241_10072860 3300009174 Bacteria 2671
93 Ga0105241_10456250 3300009174 Bacteria 1131
94 Ga0105242_10172371 3300009176 Bacteria 1903
95 Ga0105248_10009250 3300009177 Bacteria 10842
96 Ga0105237_10116665 3300009545 Bacteria 2663
97 Ga0105238_10042304 3300009551 Bacteria 4614
98 Ga0105249_10032006 3300009553 Bacteria 4757
99 Ga0105239_10077934 3300010375 Bacteria 3647
100 Ga0157370_10263079 3300013104 Bacteria 1594
101 Ga0157369_10075787 3300013105 Bacteria 3606
102 Ga0157369_10127195 3300013105 Bacteria 2700
103 Ga0157374_10009029 3300013296 Bacteria 8549
104 Ga0157378_10026274 3300013297 Bacteria 5133
105 Ga0163162_10036554 3300013306 Unclassified 4896
106 Ga0157372_10116687 3300013307 Unclassified 3061
107 Ga0157375_10019712 3300013308 Bacteria 6143
108 Ga0163163_10000055 3300014325 Bacteria 125341
109 Ga0163163_10020532 3300014325 Bacteria 6222
110 Ga0157379_10000157 3300014968 Bacteria 50598
111 Ga0157379_10010424 3300014968 Bacteria 8100
112 Ga0157379_10084197 3300014968 Bacteria 2850
113 Ga0163161_10093088 3300017792 Bacteria 2233
114 Ga0209436_100170 3300025208 Bacteria 31154
115 Ga0209563_110177 3300025230 Bacteria 1385
116 Ga0209233_1000006 3300025261 Bacteria 1473685
117 Ga0209130_1000271 3300025284 Bacteria 64956
118 Ga0209025_1000996 3300025294 Bacteria 41994
119 Ga0209758_1000008 3300025297 Bacteria 1215263
120 Ga0209758_1024821 3300025297 Bacteria 2656
121 Ga0209050_1002915 3300025298 Bacteria 13430
122 Ga0207426_1000454 3300025302 Bacteria 64956
123 Ga0207426_1000537 3300025302 Bacteria 54262
124 Ga0209257_1051730 3300025304 Bacteria 1156
125 Ga0207642_10008227 3300025899 Bacteria 3566
126 Ga0207688_10134821 3300025901 Bacteria 1449
127 Ga0207680_10012171 3300025903 Unclassified 4376
128 Ga0207647_10135728 3300025904 Bacteria 1444
129 Ga0207705_10019695 3300025909 Bacteria 4825
130 Ga0207705_10084415 3300025909 Bacteria 2318
131 Ga0207654_10043764 3300025911 Bacteria 2540
132 Ga0207707_10154832 3300025912 Bacteria 2004
133 Ga0207695_10171777 3300025913 Bacteria 2093
134 Ga0207695_10192142 3300025913 Bacteria 1959
135 Ga0207671_10228156 3300025914 Bacteria 1460
136 Ga0207693_10182255 3300025915 Bacteria 1653
137 Ga0207650_10174560 3300025925 Bacteria 1710
138 Ga0207700_10601250 3300025928 Bacteria 979
139 Ga0207706_10204987 3300025933 Bacteria 1729
140 Ga0207686_10065861 3300025934 Bacteria 2312
141 Ga0207686_10193596 3300025934 Bacteria 1451
142 Ga0207709_10019674 3300025935 Bacteria 3800
143 Ga0207669_10470104 3300025937 Bacteria 1000
144 Ga0207704_10022178 3300025938 Bacteria 3397
145 Ga0207691_10152711 3300025940 Bacteria 2029
146 Ga0207711_10002313 3300025941 Bacteria 17072
147 Ga0207689_10016333 3300025942 Bacteria 6288
148 Ga0207667_10072648 3300025949 Bacteria 3575
149 Ga0207651_10002264 3300025960 Bacteria 9139
150 Ga0207651_10543760 3300025960 Bacteria 1009
151 Ga0207712_10003465 3300025961 Bacteria 9957
152 Ga0207658_10042368 3300025986 Bacteria 3302
153 Ga0207677_10022821 3300026023 Bacteria 3853
154 Ga0207639_10158333 3300026041 Bacteria 1905
155 Ga0207678_10152663 3300026067 Bacteria 1972
156 Ga0207702_10042070 3300026078 Bacteria 3832
157 Ga0207641_10020756 3300026088 Bacteria 5399
158 Ga0207648_10019290 3300026089 Bacteria 6155
159 Ga0207648_10097382 3300026089 Bacteria 2575
160 Ga0207648_10265083 3300026089 Bacteria 1533
161 Ga0207676_10041241 3300026095 Unclassified 3542
162 Ga0207674_10164184 3300026116 Bacteria 2175
163 Ga0207674_10165485 3300026116 Bacteria 2166
164 Ga0207683_10150135 3300026121 Bacteria 2103
165 Ga0207683_10163945 3300026121 Bacteria 2011
166 Ga0207698_10094397 3300026142 Unclassified 2459
167 Ga0207698_10255046 3300026142 Bacteria 1608
168 Ga0209281_1000214 3300027111 Bacteria 128147
169 Ga0268266_10000372 3300028379 Bacteria 68830
170 Ga0268266_10038468 3300028379 Bacteria 4073
171 Ga0268266_10091789 3300028379 Bacteria 2663
172 Ga0268266_10118020 3300028379 Unclassified 2358
173 Ga0268266_10479241 3300028379 Bacteria 1186
174 Ga0268265_10472422 3300028380 Bacteria 1176
175 Ga0268264_10022707 3300028381 Bacteria 5119
176 Ga0268264_10111792 3300028381 Bacteria 2394
177 Ga0265330_10034804 3300031235 Bacteria 2249
178 Ga0265332_10065051 3300031238 Bacteria 1557
179 Ga0265325_10006641 3300031241 Bacteria 6997
180 Ga0265325_10055361 3300031241 Bacteria 2028
181 Ga0265339_10113690 3300031249 Bacteria 1398
182 Ga0265331_10007294 3300031250 Bacteria 6407
183 Ga0265331_10011709 3300031250 Bacteria 4794
184 Ga0265316_10037703 3300031344 Bacteria 3899
185 Ga0307408_100065297 3300031548 Bacteria 2669
186 Ga0265313_10008369 3300031595 Bacteria 6882
187 Ga0265342_10016762 3300031712 Bacteria 4779
188 Ga0307516_10040476 3300031730 Bacteria 4639
189 Ga0307516_10129999 3300031730 Bacteria 2299
190 Ga0307510_10216987 3300033180 Bacteria 1429
191 Ga0373927_0199987 3300035695 Bacteria 1312
192 Ga0395901_0015310 3300038443 Bacteria 7805
193 Ga0436365_1244115 3300039437 Bacteria 1315
194 Ga0466961_0213680 3300044693 Bacteria 1190
195 Ga0453684_0107910 3300044712 Bacteria 3389
196 Ga0495592_0190734 3300046454 Bacteria 1389
197 Ga0495651_0035525 3300046462 Bacteria 3879
198 Ga0495606_0036750 3300046507 Bacteria 3332
199 Ga0495606_0098168 3300046507 Bacteria 1788
200 Ga0495610_0082798 3300046512 Bacteria 1470
201 Ga0495643_0123043 3300046522 Bacteria 1309
202 Ga0495648_0088625 3300046524 Bacteria 1739
203 Ga0495652_0238317 3300046529 Bacteria 1356
204 Ga0495654_0000147 3300046530 Bacteria 72993
205 Ga0495609_0013568 3300046538 Bacteria 3846
206 Ga0495656_0000140 3300046615 Bacteria 26809
207 Ga0495649_0150913 3300046694 Bacteria 1221
208 Ga0495589_0082426 3300046794 Bacteria 1564
209 Ga0495604_0273194 3300047317 Bacteria 1144
210 Ga0495636_0080986 3300047318 Bacteria 1398
211 Ga0495681_0067134 3300047470 Bacteria 1635
212 Ga0496106_0000028 3300048909 Bacteria 143296
213 Ga0496109_0315999 3300048912 Bacteria 1474
214 Ga0496111_0000180 3300048914 Bacteria 28698
215 Ga0496116_0266319 3300048919 Bacteria 841
216 Ga0496121_0181171 3300048924 Bacteria 1520
217 Ga0496122_0000072 3300048925 Bacteria 222436
218 Ga0496122_0052730 3300048925 Bacteria 3075
219 Ga0496123_0000035 3300048926 Bacteria 267288
220 Ga0501031_0214708 3300049568 Bacteria 1253
221 Ga0501032_0105467 3300049569 Bacteria 1867
222 Ga0501032_0187737 3300049569 Bacteria 1351
223 Ga0501033_0010411 3300049570 Bacteria 7132
224 Ga0501033_0012274 3300049570 Bacteria 6538
225 Ga0501033_0034379 3300049570 Bacteria 3803
226 Ga0501033_0246585 3300049570 Bacteria 1267
227 Ga0501034_0061002 3300049571 Bacteria 3788
228 Ga0501034_0113950 3300049571 Bacteria 2693
229 Ga0501034_0172871 3300049571 Bacteria 2127
230 Ga0501034_0249896 3300049571 Bacteria 1718
231 Ga0501036_0020732 3300049572 Bacteria 5520
232 Ga0501037_0042229 3300049573 Bacteria 3351
233 Ga0501037_0226761 3300049573 Bacteria 1313
234 Ga0501038_0049960 3300049574 Bacteria 3614
235 Ga0501043_0114453 3300049579 Bacteria 2117
236 Ga0501043_0227940 3300049579 Bacteria 1440
237 Ga0501046_0038026 3300049580 Bacteria 3864
238 Ga0501047_0004530 3300049581 Bacteria 13064
239 Ga0501047_0019157 3300049581 Bacteria 6565
240 Ga0501067_0030773 3300049583 Bacteria 2977
241 Ga0501068_0026454 3300049584 Bacteria 3419
242 Ga0501070_0081675 3300049586 Bacteria 2675
243 Ga0501070_0120742 3300049586 Bacteria 2166
244 Ga0501073_0024640 3300049589 Bacteria 4320
245 Ga0501073_0269245 3300049589 Bacteria 1175
246 Ga0501074_0045959 3300049590 Bacteria 3158
247 Ga0501079_0203023 3300049741 Bacteria 1548
248 Ga0501080_0079070 3300049742 Bacteria 3057
249 Ga0501080_0099586 3300049742 Bacteria 2697
250 Ga0501083_0014970 3300049744 Bacteria 5428
251 Ga0501083_0083696 3300049744 Bacteria 2113
252 Ga0501083_0180640 3300049744 Bacteria 1378
253 Ga0501035_0013540 3300049822 Bacteria 7529
254 Ga0501035_0026593 3300049822 Bacteria 5293
255 Ga0501035_0032160 3300049822 Bacteria 4775
256 Ga0501035_0069600 3300049822 Bacteria 3118
257 Ga0501035_0195456 3300049822 Bacteria 1738
258 Ga0501044_0005873 3300049823 Bacteria 13598
259 Ga0501044_0112495 3300049823 Bacteria 2729
260 Ga0501044_0180944 3300049823 Bacteria 2075
261 nmdc:mga0yw44_518_c1 3300050492 Bacteria 13808
262 Ga0500643_000006 3300053087 Bacteria 479605
263 Ga0500566_0193738 3300053094 Bacteria 1032
264 Ga0500641_0005854 3300053096 Bacteria 4353
265 Ga0500595_002085 3300053119 Bacteria 10225
266 Ga0500618_000134 3300053125 Bacteria 62033
267 Ga0500618_000908 3300053125 Bacteria 15486
268 Ga0500618_005060 3300053125 Bacteria 4067
269 Ga0500559_0018798 3300053136 Bacteria 2919
270 Ga0500568_0032477 3300053139 Bacteria 2147
271 Ga0500573_0000004 3300053140 Bacteria 341236
272 Ga0500616_0001606 3300053153 Bacteria 21050
273 Ga0500645_028024 3300053730 Bacteria 1706
274 Ga0500645_050309 3300053730 Bacteria 1217
275 Ga0501084_0385329 3300054114 Bacteria 1184
276 Ga0501082_0108769 3300060353 Bacteria 2399
277 Ga0501082_0183868 3300060353 Bacteria 1818
278 2511169696 2510917026 Bacteria 7046020
279 2585258901 2582581304 Bacteria 5831370
280 2585994199 2585427633 Bacteria 6413184
281 2599719842 2599185236 Bacteria 6875203
282 2600197773 2599185352 Bacteria 7228948
283 2600373137 2600254933 Bacteria 4750527
284 2600377287 2600254933 Bacteria 4750527
285 2819682986 2818991461 Bacteria 7026071
286 2821126958 2821123053 Bacteria 7836056
287 2838740904 2838736955 Bacteria 5760694
288 2841844744 2841840854 Bacteria 5761912
289 2842144186 2842140634 Bacteria 5759631
290 2854898038 2854896431 Bacteria 5869725
291 2854919734 2854916844 Bacteria 5725939
292 2857536633 2857531043 Bacteria 6754041
293 2885312413 2885305155 Bacteria 7348390
294 2885326493 2885326080 Bacteria 7134805
295 2885339656 2885334103 Bacteria 7216818
296 2920827451 2920822456 Bacteria 6897201
297 8018150564 8018150411 Bacteria 5549903
298 8056878869 8056875544 Bacteria 4355797
299 Ga0105246_10072528
300 JGI25158J39367_1001378
301 JGI25159J45721_1000233
302 JGI25159J45721_1000255
303 JGI25151J46595_10002351
304 JGI25151J46595_10032493
305 JGI25165J46597_1000008
306 JGI25153J46596_10002199
307 JGI25160J50197_1000462
308 JGI25160J50197_1033485
309 JGI25161J50226_1000344
310 Ga0055526_1020785
311 Ga0055524_1000429
312 Ga0055536_1017316
313 Ga0055540_1014462
314 Ga0055531_10036537
315 Ga0055543_1000448
316 Ga0065165_1001789
317 Ga0065165_1001892
318 Ga0070658_10025334
319 Ga0070658_10160354
320 Ga0070676_10006271
321 Ga0070690_100201631
322 Ga0070670_100186807
323 Ga0068869_100004801
324 Ga0070666_10012631
325 Ga0070666_10029071
326 Ga0070682_100142180
327 Ga0068868_100028743
328 Ga0068868_100061802
329 Ga0070660_100004807
330 Ga0070674_100468926
331 Ga0070673_100028577
332 Ga0070659_100006735
333 Ga0070667_100021759
334 Ga0070713_100462552
335 Ga0070678_100052122
336 Ga0070681_10252247
337 Ga0068867_100013966
338 Ga0070679_100005854
339 Ga0070679_100051097
340 Ga0070684_100159554
341 Ga0068853_100483132
342 Ga0070665_100000799
343 Ga0070665_100008118
344 Ga0070665_100038762
345 Ga0070665_100109933
346 Ga0070665_100228793
347 Ga0070665_100280633
348 Ga0070665_100422991
349 Ga0068855_100016712
350 Ga0068855_100044527
351 Ga0068855_100127853
352 Ga0068857_100284351
353 Ga0068857_100378138
354 Ga0068854_100179843
355 Ga0068856_100048464
356 Ga0068856_100098117
357 Ga0068852_100150787
358 Ga0068852_100308924
359 Ga0068859_100093372
360 Ga0068859_100362506
361 Ga0068864_100054858
362 Ga0068863_100025718
363 Ga0068858_100015496
364 Ga0068858_100019188
365 Ga0068860_100385834
366 Ga0068860_100412656
367 Ga0081540_1000008
368 Ga0081539_10006736
369 Ga0075365_10004549
370 Ga0097621_100001480
371 Ga0097621_100007701
372 Ga0097621_100027224
373 Ga0097621_100067261
374 Ga0068871_100000171
375 Ga0068871_100010870
376 Ga0068871_100019649
377 Ga0068871_100035770
378 Ga0068871_100186256
379 Ga0075428_100040687
380 Ga0068865_100032496
381 Ga0097620_100093365
382 Ga0097620_100362512
383 Ga0079104_1000086
384 Ga0075435_100035805
385 Ga0105240_10053424
386 Ga0105240_10115419
387 Ga0105240_10217375
388 Ga0111539_10000654
389 Ga0105245_10189346
390 Ga0105241_10072860
391 Ga0105241_10456250
392 Ga0105242_10172371
393 Ga0105248_10009250
394 Ga0105237_10116665
395 Ga0105238_10042304
396 Ga0105249_10032006
397 Ga0105239_10077934
398 Ga0157370_10263079
399 Ga0157369_10075787
400 Ga0157369_10127195
401 Ga0157374_10009029
402 Ga0157378_10026274
403 Ga0163162_10036554
404 Ga0157372_10116687
405 Ga0157375_10019712
406 Ga0163163_10000055
407 Ga0163163_10020532
408 Ga0157379_10000157
409 Ga0157379_10010424
410 Ga0157379_10084197
411 Ga0163161_10093088
412 Ga0209436_100170
413 Ga0209563_110177
414 Ga0209233_1000006
415 Ga0209130_1000271
416 Ga0209025_1000996
417 Ga0209758_1000008
418 Ga0209758_1024821
419 Ga0209050_1002915
420 Ga0207426_1000454
421 Ga0207426_1000537
422 Ga0209257_1051730
423 Ga0207642_10008227
424 Ga0207688_10134821
425 Ga0207680_10012171
426 Ga0207647_10135728
427 Ga0207705_10019695
428 Ga0207705_10084415
429 Ga0207654_10043764
430 Ga0207707_10154832
431 Ga0207695_10171777
432 Ga0207695_10192142
433 Ga0207671_10228156
434 Ga0207693_10182255
435 Ga0207650_10174560
436 Ga0207700_10601250
437 Ga0207706_10204987
438 Ga0207686_10065861
439 Ga0207686_10193596
440 Ga0207709_10019674
441 Ga0207669_10470104
442 Ga0207704_10022178
443 Ga0207691_10152711
444 Ga0207711_10002313
445 Ga0207689_10016333
446 Ga0207667_10072648
447 Ga0207651_10002264
448 Ga0207651_10543760
449 Ga0207712_10003465
450 Ga0207658_10042368
451 Ga0207677_10022821
452 Ga0207639_10158333
453 Ga0207678_10152663
454 Ga0207702_10042070
455 Ga0207641_10020756
456 Ga0207648_10019290
457 Ga0207648_10097382
458 Ga0207648_10265083
459 Ga0207676_10041241
460 Ga0207674_10164184
461 Ga0207674_10165485
462 Ga0207683_10150135
463 Ga0207683_10163945
464 Ga0207698_10094397
465 Ga0207698_10255046
466 Ga0209281_1000214
467 Ga0268266_10000372
468 Ga0268266_10038468
469 Ga0268266_10091789
470 Ga0268266_10118020
471 Ga0268266_10479241
472 Ga0268265_10472422
473 Ga0268264_10022707
474 Ga0268264_10111792
475 Ga0265330_10034804
476 Ga0265332_10065051
477 Ga0265325_10006641
478 Ga0265325_10055361
479 Ga0265339_10113690
480 Ga0265331_10007294
481 Ga0265331_10011709
482 Ga0265316_10037703
483 Ga0307408_100065297
484 Ga0265313_10008369
485 Ga0265342_10016762
486 Ga0307516_10040476
487 Ga0307516_10129999
488 Ga0307510_10216987
489 Ga0373927_0199987
490 Ga0395901_0015310
491 Ga0436365_1244115
492 Ga0466961_0213680
493 Ga0453684_0107910
494 Ga0495592_0190734
495 Ga0495651_0035525
496 Ga0495606_0036750
497 Ga0495606_0098168
498 Ga0495610_0082798
499 Ga0495643_0123043
500 Ga0495648_0088625
501 Ga0495652_0238317
502 Ga0495654_0000147
503 Ga0495609_0013568
504 Ga0495656_0000140
505 Ga0495649_0150913
506 Ga0495589_0082426
507 Ga0495604_0273194
508 Ga0495636_0080986
509 Ga0495681_0067134
510 Ga0496106_0000028
511 Ga0496109_0315999
512 Ga0496111_0000180
513 Ga0496116_0266319
514 Ga0496121_0181171
515 Ga0496122_0000072
516 Ga0496122_0052730
517 Ga0496123_0000035
518 Ga0501031_0214708
519 Ga0501032_0105467
520 Ga0501032_0187737
521 Ga0501033_0010411
522 Ga0501033_0012274
523 Ga0501033_0034379
524 Ga0501033_0246585
525 Ga0501034_0061002
526 Ga0501034_0113950
527 Ga0501034_0172871
528 Ga0501034_0249896
529 Ga0501036_0020732
530 Ga0501037_0042229
531 Ga0501037_0226761
532 Ga0501038_0049960
533 Ga0501043_0114453
534 Ga0501043_0227940
535 Ga0501046_0038026
536 Ga0501047_0004530
537 Ga0501047_0019157
538 Ga0501067_0030773
539 Ga0501068_0026454
540 Ga0501070_0081675
541 Ga0501070_0120742
542 Ga0501073_0024640
543 Ga0501073_0269245
544 Ga0501074_0045959
545 Ga0501079_0203023
546 Ga0501080_0079070
547 Ga0501080_0099586
548 Ga0501083_0014970
549 Ga0501083_0083696
550 Ga0501083_0180640
551 Ga0501035_0013540
552 Ga0501035_0026593
553 Ga0501035_0032160
554 Ga0501035_0069600
555 Ga0501035_0195456
556 Ga0501044_0005873
557 Ga0501044_0112495
558 Ga0501044_0180944
559 nmdc:mga0yw44_518_c1
560 Ga0500643_000006
561 Ga0500566_0193738
562 Ga0500641_0005854
563 Ga0500595_002085
564 Ga0500618_000134
565 Ga0500618_000908
566 Ga0500618_005060
567 Ga0500559_0018798
568 Ga0500568_0032477
569 Ga0500573_0000004
570 Ga0500616_0001606
571 Ga0500645_028024
572 Ga0500645_050309
573 Ga0501084_0385329
574 Ga0501082_0108769
575 Ga0501082_0183868
576 2511169696
577 2585258901
578 2585994199
579 2599719842
580 2600197773
581 2600373137
582 2600377287
583 2819682986
584 2821126958
585 2838740904
586 2841844744
587 2842144186
588 2854898038
589 2854919734
590 2857536633
591 2885312413
592 2885326493
593 2885339656
594 2920827451
595 8018150564
596 8056878869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

65

359

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dz1-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 1.87a resolution 0.992 1 298
3dz1-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 1.87a resolution 0.979 1 298
3na8-assembly1.cif.gz_D crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa 0.912 7 299
3na8-assembly1.cif.gz_B crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa 0.9114 7 299
3pb2-assembly2.cif.gz_D characterisation of the first monomeric dihydrodipicolinate synthase variant reveals evolutionary insights 0.9107 8 300
ID Description Score Start End Superfamily
3dz1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9895 1 298 3.20.20.70
3dz1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9794 1 298 3.20.20.70
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9107 8 300 3.20.20.70
af_P75682_5_302_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9078 8 299 3.20.20.70
3na8D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9059 7 299 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W5TC66-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9977 2 308 GO:0005829
GO:0008840
AF-A0A257VH04-F1-model_v4 deleted 0.9955 43 220
AF-A0A528V5D2-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9947 28 121 GO:0016829
AF-A0A261RYY6-F1-model_v4 Dihydrodipicolinate synthase family protein 0.994 1 308 GO:0005829
GO:0008840
AF-A0A528B3R0-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9937 1 192 GO:0005829
GO:0008840

Map