F394307

General Info

Members Datasets Scaffolds Average Seq Length
298 185 596 306

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10292858|Ga0207664_102928582
Length 364
Sequence MVTPSPRYDAHPPAFAQPRLGSFIHVDMARRPSQRGHLALAAHRVGLGRSFEAIGSHGWEAAIVAAILTEGLAKYFGATAALRPLNLQVGEGEVLGYLGPNGAGKTTTIRCLLGMIRASSGRAEIFGVDAQQHPAEAHRRLAYVPGEANLWPGLTGGQALHLLGRIQGRVDEAYRDELIGRFQLDPSKRVRAYSKGNRQKVLLIAALSSRADLLILDEPTTGLDPLMEQTFRECVAQARERGQAVFLSSHILSEVEALSDRVAILRAGELVEVGTLAQMRHLSALSVDATFDGTPPDLSRIPGVTAVEVHGNQVRCQIVGSFEPLLSVLATSGVHQLLSREPSLEELFLAHYGRGMSEAVAHAS

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
64 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
65 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
66 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
87 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
88 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
179 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
182 2619618881 Frankia sp. ACN1ag Isolate Unclassified
183 2619619003 Frankia sp. CpI1-P Isolate Nodule
184 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
185 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 0
Isolates 1.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 0.34
Rhizoplane 9.73
Rhizosphere 74.5
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10292858 3300025929 Bacteria 1431
2 JGI24741J21665_1003577 3300001915 Bacteria 3671
3 rootH2_10000244 3300003320 Bacteria 697651
4 Ga0070683_100013587 3300005329 Bacteria 7104
5 Ga0070683_100289184 3300005329 Bacteria 1559
6 Ga0070677_10009897 3300005333 Unclassified 3247
7 Ga0070703_10000416 3300005406 Bacteria 17571
8 Ga0070709_10000388 3300005434 Bacteria 27087
9 Ga0070714_100038811 3300005435 Bacteria 4006
10 Ga0070713_100037932 3300005436 Bacteria 3899
11 Ga0070711_100011484 3300005439 Bacteria 5501
12 Ga0070708_100006729 3300005445 Bacteria 9154
13 Ga0070708_100014544 3300005445 Bacteria 6481
14 Ga0070708_100075974 3300005445 Bacteria 3033
15 Ga0070681_10050683 3300005458 Bacteria 4142
16 Ga0070706_100002888 3300005467 Bacteria 17120
17 Ga0070706_100020424 3300005467 Bacteria 6104
18 Ga0070706_100029871 3300005467 Bacteria 5020
19 Ga0070706_100186915 3300005467 Bacteria 1936
20 Ga0070707_100064634 3300005468 Bacteria 3513
21 Ga0070707_100174833 3300005468 Bacteria 2093
22 Ga0070698_100010754 3300005471 Bacteria 9737
23 Ga0070699_100026910 3300005518 Bacteria 4961
24 Ga0070684_100226026 3300005535 Bacteria 1708
25 Ga0070697_100110039 3300005536 Bacteria 2295
26 Ga0070696_100019498 3300005546 Bacteria 4592
27 Ga0068855_100000001 3300005563 Bacteria 818777
28 Ga0068855_100446965 3300005563 Bacteria 1411
29 Ga0068856_100000215 3300005614 Bacteria 62264
30 Ga0068859_100004792 3300005617 Bacteria 13767
31 Ga0068858_100484433 3300005842 Bacteria 1194
32 Ga0070717_10113275 3300006028 Bacteria 2316
33 Ga0070717_10119344 3300006028 Bacteria 2257
34 Ga0075368_10000005 3300006042 Bacteria 55453
35 Ga0075368_10000726 3300006042 Bacteria 10076
36 Ga0075363_100000641 3300006048 Bacteria 11591
37 Ga0075364_10039652 3300006051 Bacteria 3054
38 Ga0070715_10002335 3300006163 Bacteria 5797
39 Ga0070716_100039786 3300006173 Bacteria 2612
40 Ga0070712_100049274 3300006175 Bacteria 2924
41 Ga0070712_100077058 3300006175 Bacteria 2402
42 Ga0075367_10000356 3300006178 Bacteria 16409
43 Ga0075367_10001617 3300006178 Bacteria 9781
44 Ga0075367_10014067 3300006178 Bacteria 4322
45 Ga0075369_10000009 3300006186 Bacteria 79582
46 Ga0075366_10000590 3300006195 Bacteria 16958
47 Ga0075370_10043096 3300006353 Bacteria 2551
48 Ga0068871_100000011 3300006358 Bacteria 105600
49 Ga0075428_100000002 3300006844 Bacteria 546374
50 Ga0097620_100004792 3300006931 Bacteria 13767
51 Ga0105245_10000007 3300009098 Bacteria 312285
52 Ga0105245_10183114 3300009098 Bacteria 2002
53 Ga0105247_10001870 3300009101 Bacteria 14740
54 Ga0105241_10000003 3300009174 Bacteria 839043
55 Ga0105241_10482563 3300009174 Bacteria 1102
56 Ga0105237_10144302 3300009545 Bacteria 2375
57 Ga0157373_10002698 3300013100 Bacteria 13454
58 Ga0157369_10052842 3300013105 Bacteria 4394
59 Ga0157374_10000014 3300013296 Bacteria 396846
60 Ga0213875_10040007 3300021388 Bacteria 2208
61 Ga0207653_10000426 3300025885 Bacteria 17561
62 Ga0207710_10001195 3300025900 Bacteria 13166
63 Ga0207685_10007894 3300025905 Bacteria 2998
64 Ga0207699_10000155 3300025906 Bacteria 42643
65 Ga0207684_10004854 3300025910 Bacteria 12581
66 Ga0207684_10111277 3300025910 Bacteria 2344
67 Ga0207684_10349776 3300025910 Bacteria 1272
68 Ga0207654_10000002 3300025911 Bacteria 1460142
69 Ga0207707_10011180 3300025912 Bacteria 7808
70 Ga0207693_10004697 3300025915 Bacteria 11493
71 Ga0207693_10252854 3300025915 Bacteria 1382
72 Ga0207663_10037327 3300025916 Bacteria 2928
73 Ga0207646_10025013 3300025922 Bacteria 5465
74 Ga0207646_10340473 3300025922 Bacteria 1355
75 Ga0207687_10000008 3300025927 Bacteria 497738
76 Ga0207700_10096643 3300025928 Bacteria 2346
77 Ga0207700_10190898 3300025928 Bacteria 1721
78 Ga0207665_10023958 3300025939 Bacteria 4022
79 Ga0207661_10014724 3300025944 Bacteria 5738
80 Ga0207667_10000003 3300025949 Bacteria 822935
81 Ga0207702_10000569 3300026078 Bacteria 40973
82 Ga0207683_10252829 3300026121 Bacteria 1608
83 Ga0209813_10000001 3300027866 Bacteria 280406
84 Ga0209813_10012994 3300027866 Bacteria 2213
85 Ga0265337_1000384 3300028556 Bacteria 23747
86 Ga0265337_1000731 3300028556 Bacteria 17268
87 Ga0265326_10002969 3300028558 Bacteria 5654
88 Ga0265326_10011049 3300028558 Bacteria 2671
89 Ga0265319_1002343 3300028563 Bacteria 10425
90 Ga0265334_10005457 3300028573 Bacteria 5556
91 Ga0265334_10006458 3300028573 Bacteria 5046
92 Ga0265334_10020716 3300028573 Bacteria 2691
93 Ga0265318_10025777 3300028577 Bacteria 2318
94 Ga0265323_10019415 3300028653 Bacteria 2621
95 Ga0265322_10011069 3300028654 Bacteria 2617
96 Ga0265322_10011818 3300028654 Bacteria 2526
97 Ga0265336_10000047 3300028666 Bacteria 123576
98 Ga0265336_10000571 3300028666 Bacteria 20772
99 Ga0265336_10009654 3300028666 Bacteria 3329
100 Ga0265338_10000039 3300028800 Bacteria 236135
101 Ga0265338_10000400 3300028800 Bacteria 77806
102 Ga0265338_10000482 3300028800 Bacteria 71209
103 Ga0265338_10000595 3300028800 Bacteria 63820
104 Ga0265338_10000727 3300028800 Bacteria 56128
105 Ga0265338_10000938 3300028800 Bacteria 49159
106 Ga0265338_10002437 3300028800 Bacteria 27961
107 Ga0265338_10002780 3300028800 Bacteria 25593
108 Ga0265338_10003468 3300028800 Bacteria 22188
109 Ga0265338_10024315 3300028800 Bacteria 6191
110 Ga0265338_10025242 3300028800 Bacteria 6039
111 Ga0265338_10083879 3300028800 Bacteria 2663
112 Ga0265324_10002135 3300029957 Bacteria 10397
113 Ga0265324_10004771 3300029957 Bacteria 6003
114 Ga0265320_10044794 3300031240 Bacteria 2177
115 Ga0265325_10001157 3300031241 Bacteria 18910
116 Ga0265325_10002048 3300031241 Bacteria 13849
117 Ga0265325_10008740 3300031241 Bacteria 5957
118 Ga0265325_10018502 3300031241 Bacteria 3864
119 Ga0265325_10041739 3300031241 Bacteria 2403
120 Ga0265340_10008639 3300031247 Bacteria 5490
121 Ga0265340_10018698 3300031247 Bacteria 3572
122 Ga0265340_10055627 3300031247 Bacteria 1905
123 Ga0265340_10066366 3300031247 Bacteria 1717
124 Ga0265340_10118449 3300031247 Bacteria 1219
125 Ga0265339_10016014 3300031249 Bacteria 4479
126 Ga0265339_10030153 3300031249 Bacteria 3073
127 Ga0265339_10048284 3300031249 Bacteria 2334
128 Ga0265327_10000017 3300031251 Bacteria 445264
129 Ga0265327_10000106 3300031251 Bacteria 184297
130 Ga0265327_10002783 3300031251 Bacteria 17675
131 Ga0265327_10052490 3300031251 Bacteria 2123
132 Ga0265327_10057832 3300031251 Bacteria 1993
133 Ga0265316_10030366 3300031344 Bacteria 4431
134 Ga0265316_10185353 3300031344 Bacteria 1548
135 Ga0265316_10185390 3300031344 Bacteria 1548
136 Ga0307509_10331567 3300031507 Bacteria 1253
137 Ga0265313_10001010 3300031595 Bacteria 27503
138 Ga0265313_10016438 3300031595 Bacteria 4254
139 Ga0265313_10078665 3300031595 Bacteria 1503
140 Ga0265314_10002147 3300031711 Bacteria 20651
141 Ga0265314_10085485 3300031711 Bacteria 2068
142 Ga0265342_10046232 3300031712 Bacteria 2616
143 Ga0265342_10183969 3300031712 Bacteria 1143
144 Ga0307409_100469111 3300031995 Bacteria 1219
145 Ga0307415_100046282 3300032126 Bacteria 2922
146 Ga0373926_0033254 3300035083 Bacteria 1822
147 Ga0373944_0004118 3300035089 Bacteria 3774
148 Ga0373936_0005882 3300035113 Bacteria 4616
149 Ga0373945_0001580 3300035116 Bacteria 6977
150 Ga0373953_0004125 3300035117 Bacteria 4608
151 Ga0373943_0008925 3300035170 Bacteria 4491
152 Ga0373946_0000569 3300035171 Bacteria 12183
153 Ga0373935_0078203 3300035692 Bacteria 2145
154 Ga0373927_0043977 3300035695 Bacteria 2890
155 Ga0373927_0065517 3300035695 Bacteria 2350
156 Ga0373927_0077521 3300035695 Bacteria 2153
157 Ga0373933_0054304 3300035724 Bacteria 2401
158 Ga0373947_0014624 3300035725 Bacteria 4499
159 Ga0373937_0028529 3300036401 Bacteria 5051
160 Ga0373937_0075813 3300036401 Bacteria 3105
161 Ga0373937_0119361 3300036401 Bacteria 2457
162 Ga0373925_0044900 3300037068 Bacteria 3281
163 Ga0395900_0060924 3300037418 Bacteria 3882
164 Ga0436364_0524765 3300037853 Bacteria 2430
165 Ga0436364_0915257 3300037853 Bacteria 20960
166 Ga0395901_0063127 3300038443 Unclassified 3855
167 Ga0395901_0166943 3300038443 Bacteria 2310
168 Ga0436365_0747521 3300039437 Bacteria 20665
169 Ga0436363_1226233 3300039450 Bacteria 3349
170 Ga0495603_0043580 3300046455 Bacteria 2679
171 Ga0495629_0012777 3300046459 Bacteria 6076
172 Ga0495629_0091549 3300046459 Bacteria 2122
173 Ga0495629_0207862 3300046459 Bacteria 1352
174 Ga0495641_0018009 3300046461 Unclassified 3659
175 Ga0495641_0058293 3300046461 Bacteria 1747
176 Ga0495651_0008048 3300046462 Bacteria 8083
177 Ga0495651_0016738 3300046462 Bacteria 5678
178 Ga0495651_0209978 3300046462 Bacteria 1356
179 Ga0495653_0038241 3300046463 Bacteria 3767
180 Ga0495653_0078245 3300046463 Bacteria 2453
181 Ga0495582_0018167 3300046473 Bacteria 3848
182 Ga0495639_0035654 3300046475 Bacteria 2226
183 Ga0495662_0007203 3300046476 Bacteria 5509
184 Ga0495664_0036855 3300046477 Bacteria 2884
185 Ga0495594_0020226 3300046499 Bacteria 3545
186 Ga0495608_0028245 3300046511 Bacteria 3813
187 Ga0495608_0140341 3300046511 Bacteria 1543
188 Ga0495628_0130616 3300046516 Bacteria 1921
189 Ga0495628_0312715 3300046516 Bacteria 1161
190 Ga0495630_0004764 3300046517 Bacteria 9518
191 Ga0495666_0055336 3300046526 Bacteria 1901
192 Ga0495652_0083116 3300046529 Bacteria 2637
193 Ga0495665_0002624 3300046531 Bacteria 9696
194 Ga0495640_0043298 3300046533 Bacteria 3136
195 Ga0495586_0062573 3300046535 Bacteria 2026
196 Ga0495587_0044439 3300046536 Bacteria 2642
197 Ga0495645_0042943 3300046543 Bacteria 3297
198 Ga0495667_0080009 3300046559 Bacteria 2124
199 Ga0495634_0006380 3300046642 Bacteria 8968
200 Ga0495634_0047104 3300046642 Bacteria 2906
201 Ga0495599_0053104 3300046678 Bacteria 2539
202 Ga0495623_0029911 3300046679 Bacteria 3505
203 Ga0495623_0063089 3300046679 Bacteria 2321
204 Ga0495647_0000212 3300046681 Bacteria 15653
205 Ga0495658_0000264 3300046683 Bacteria 29775
206 Ga0495658_0215145 3300046683 Bacteria 1202
207 Ga0495658_0285967 3300046683 Bacteria 1041
208 Ga0495613_0000809 3300046689 Bacteria 24258
209 Ga0495613_0182072 3300046689 Bacteria 1487
210 Ga0495613_0213062 3300046689 Bacteria 1358
211 Ga0495624_0000732 3300046690 Bacteria 25830
212 Ga0495600_0291704 3300046809 Bacteria 1031
213 Ga0495581_0011391 3300047315 Bacteria 5145
214 Ga0495581_0044652 3300047315 Bacteria 2563
215 Ga0495674_0157536 3300047319 Bacteria 1901
216 Ga0495674_0173039 3300047319 Bacteria 1801
217 Ga0495676_0091842 3300047321 Bacteria 2267
218 Ga0495676_0284540 3300047321 Bacteria 1119
219 Ga0495680_0060241 3300047322 Bacteria 2927
220 Ga0495680_0081971 3300047322 Bacteria 2434
221 Ga0495680_0253556 3300047322 Bacteria 1246
222 Ga0495675_0021438 3300047444 Bacteria 4114
223 Ga0495675_0068152 3300047444 Bacteria 2248
224 Ga0495684_0056746 3300047471 Bacteria 2985
225 Ga0495684_0120360 3300047471 Bacteria 1978
226 Ga0495593_0020547 3300047673 Bacteria 3697
227 Ga0495602_0043617 3300048088 Bacteria 4076
228 Ga0495602_0276043 3300048088 Bacteria 1240
229 Ga0495614_0015889 3300048089 Bacteria 3278
230 Ga0496100_0072598 3300048903 Bacteria 2301
231 Ga0496101_0016860 3300048904 Bacteria 4945
232 Ga0496101_0491992 3300048904 Bacteria 969
233 Ga0496102_0000090 3300048905 Bacteria 127346
234 Ga0496102_0029645 3300048905 Bacteria 4897
235 Ga0496102_0112951 3300048905 Bacteria 2534
236 Ga0496103_0000034 3300048906 Bacteria 189284
237 Ga0496104_0155486 3300048907 Bacteria 2195
238 Ga0496104_0473809 3300048907 Bacteria 1163
239 Ga0496105_0404225 3300048908 Bacteria 1084
240 Ga0496106_0240550 3300048909 Bacteria 1446
241 Ga0496107_0043917 3300048910 Bacteria 3212
242 Ga0496108_0007402 3300048911 Bacteria 8902
243 Ga0496108_0013103 3300048911 Bacteria 6759
244 Ga0496108_0032458 3300048911 Bacteria 4337
245 Ga0496108_0131848 3300048911 Bacteria 2148
246 Ga0496108_0351021 3300048911 Bacteria 1287
247 Ga0496109_0137706 3300048912 Bacteria 2282
248 Ga0496109_0296966 3300048912 Bacteria 1523
249 Ga0496110_0029233 3300048913 Bacteria 4741
250 Ga0496110_0065501 3300048913 Bacteria 3212
251 Ga0496110_0085548 3300048913 Bacteria 2814
252 Ga0496111_0030719 3300048914 Bacteria 3821
253 Ga0496111_0052243 3300048914 Bacteria 2951
254 Ga0496111_0180674 3300048914 Bacteria 1568
255 Ga0496112_0081353 3300048915 Bacteria 3203
256 Ga0496112_0149863 3300048915 Bacteria 2300
257 Ga0496113_0009794 3300048916 Bacteria 6303
258 Ga0496114_0204891 3300048917 Bacteria 1729
259 Ga0496117_0070021 3300048920 Bacteria 2359
260 Ga0496118_0008416 3300048921 Bacteria 10666
261 Ga0496119_0018384 3300048922 Bacteria 5204
262 Ga0496121_0016369 3300048924 Bacteria 7661
263 Ga0496126_0180596 3300048929 Bacteria 1793
264 Ga0501071_0062851 3300049587 Bacteria 2691
265 nmdc:mga03n38_456_c1 3300050490 Bacteria 10253
266 nmdc:mga00v17_33252_c1 3300050491 Bacteria 3054
267 nmdc:mga0yw44_109051_c1 3300050492 Bacteria 1772
268 nmdc:mga0k408_10_c2 3300050493 Bacteria 32712
269 nmdc:mga0k408_126_c1 3300050493 Bacteria 37833
270 nmdc:mga0k408_589_c1 3300050493 Bacteria 20080
271 nmdc:mga06z11_12_c1 3300050494 Bacteria 100611
272 nmdc:mga06z11_1474_c1 3300050494 Bacteria 8758
273 nmdc:mga06z11_173125_c1 3300050494 Bacteria 1241
274 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
275 nmdc:mga04h51_42322_c1 3300050495 Bacteria 1493
276 nmdc:mga07m45_2211_c1 3300050496 Bacteria 9081
277 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
278 Ga0495601_0013186 3300053077 Bacteria 4970
279 Ga0495601_0055998 3300053077 Bacteria 2497
280 Ga0495612_0006828 3300053078 Bacteria 4674
281 Ga0495612_0014873 3300053078 Bacteria 3122
282 Ga0495619_0004302 3300053085 Bacteria 9083
283 Ga0495619_0042746 3300053085 Bacteria 2969
284 Ga0495619_0080692 3300053085 Bacteria 2189
285 Ga0495619_0085776 3300053085 Bacteria 2127
286 Ga0500643_000133 3300053087 Bacteria 75773
287 Ga0500583_0000082 3300053092 Bacteria 54810
288 Ga0500583_0041105 3300053092 Bacteria 2098
289 Ga0500651_0123907 3300053093 Bacteria 1567
290 Ga0500568_0015964 3300053139 Bacteria 3348
291 Ga0500589_000013 3300053147 Bacteria 109118
292 Ga0500611_001362 3300053727 Bacteria 2665
293 Ga0501084_0041380 3300054114 Bacteria 3855
294 2579854725 2579778521 Bacteria 7624758
295 2619857579 2619618881 Bacteria 7521104
296 2620350771 2619619003 Bacteria 7619552
297 2686536253 2684623035 Bacteria 8032739
298 2954720242 2954711539 Bacteria 10867210
299 Ga0207664_10292858
300 JGI24741J21665_1003577
301 rootH2_10000244
302 Ga0070683_100013587
303 Ga0070683_100289184
304 Ga0070677_10009897
305 Ga0070703_10000416
306 Ga0070709_10000388
307 Ga0070714_100038811
308 Ga0070713_100037932
309 Ga0070711_100011484
310 Ga0070708_100006729
311 Ga0070708_100014544
312 Ga0070708_100075974
313 Ga0070681_10050683
314 Ga0070706_100002888
315 Ga0070706_100020424
316 Ga0070706_100029871
317 Ga0070706_100186915
318 Ga0070707_100064634
319 Ga0070707_100174833
320 Ga0070698_100010754
321 Ga0070699_100026910
322 Ga0070684_100226026
323 Ga0070697_100110039
324 Ga0070696_100019498
325 Ga0068855_100000001
326 Ga0068855_100446965
327 Ga0068856_100000215
328 Ga0068859_100004792
329 Ga0068858_100484433
330 Ga0070717_10113275
331 Ga0070717_10119344
332 Ga0075368_10000005
333 Ga0075368_10000726
334 Ga0075363_100000641
335 Ga0075364_10039652
336 Ga0070715_10002335
337 Ga0070716_100039786
338 Ga0070712_100049274
339 Ga0070712_100077058
340 Ga0075367_10000356
341 Ga0075367_10001617
342 Ga0075367_10014067
343 Ga0075369_10000009
344 Ga0075366_10000590
345 Ga0075370_10043096
346 Ga0068871_100000011
347 Ga0075428_100000002
348 Ga0097620_100004792
349 Ga0105245_10000007
350 Ga0105245_10183114
351 Ga0105247_10001870
352 Ga0105241_10000003
353 Ga0105241_10482563
354 Ga0105237_10144302
355 Ga0157373_10002698
356 Ga0157369_10052842
357 Ga0157374_10000014
358 Ga0213875_10040007
359 Ga0207653_10000426
360 Ga0207710_10001195
361 Ga0207685_10007894
362 Ga0207699_10000155
363 Ga0207684_10004854
364 Ga0207684_10111277
365 Ga0207684_10349776
366 Ga0207654_10000002
367 Ga0207707_10011180
368 Ga0207693_10004697
369 Ga0207693_10252854
370 Ga0207663_10037327
371 Ga0207646_10025013
372 Ga0207646_10340473
373 Ga0207687_10000008
374 Ga0207700_10096643
375 Ga0207700_10190898
376 Ga0207665_10023958
377 Ga0207661_10014724
378 Ga0207667_10000003
379 Ga0207702_10000569
380 Ga0207683_10252829
381 Ga0209813_10000001
382 Ga0209813_10012994
383 Ga0265337_1000384
384 Ga0265337_1000731
385 Ga0265326_10002969
386 Ga0265326_10011049
387 Ga0265319_1002343
388 Ga0265334_10005457
389 Ga0265334_10006458
390 Ga0265334_10020716
391 Ga0265318_10025777
392 Ga0265323_10019415
393 Ga0265322_10011069
394 Ga0265322_10011818
395 Ga0265336_10000047
396 Ga0265336_10000571
397 Ga0265336_10009654
398 Ga0265338_10000039
399 Ga0265338_10000400
400 Ga0265338_10000482
401 Ga0265338_10000595
402 Ga0265338_10000727
403 Ga0265338_10000938
404 Ga0265338_10002437
405 Ga0265338_10002780
406 Ga0265338_10003468
407 Ga0265338_10024315
408 Ga0265338_10025242
409 Ga0265338_10083879
410 Ga0265324_10002135
411 Ga0265324_10004771
412 Ga0265320_10044794
413 Ga0265325_10001157
414 Ga0265325_10002048
415 Ga0265325_10008740
416 Ga0265325_10018502
417 Ga0265325_10041739
418 Ga0265340_10008639
419 Ga0265340_10018698
420 Ga0265340_10055627
421 Ga0265340_10066366
422 Ga0265340_10118449
423 Ga0265339_10016014
424 Ga0265339_10030153
425 Ga0265339_10048284
426 Ga0265327_10000017
427 Ga0265327_10000106
428 Ga0265327_10002783
429 Ga0265327_10052490
430 Ga0265327_10057832
431 Ga0265316_10030366
432 Ga0265316_10185353
433 Ga0265316_10185390
434 Ga0307509_10331567
435 Ga0265313_10001010
436 Ga0265313_10016438
437 Ga0265313_10078665
438 Ga0265314_10002147
439 Ga0265314_10085485
440 Ga0265342_10046232
441 Ga0265342_10183969
442 Ga0307409_100469111
443 Ga0307415_100046282
444 Ga0373926_0033254
445 Ga0373944_0004118
446 Ga0373936_0005882
447 Ga0373945_0001580
448 Ga0373953_0004125
449 Ga0373943_0008925
450 Ga0373946_0000569
451 Ga0373935_0078203
452 Ga0373927_0043977
453 Ga0373927_0065517
454 Ga0373927_0077521
455 Ga0373933_0054304
456 Ga0373947_0014624
457 Ga0373937_0028529
458 Ga0373937_0075813
459 Ga0373937_0119361
460 Ga0373925_0044900
461 Ga0395900_0060924
462 Ga0436364_0524765
463 Ga0436364_0915257
464 Ga0395901_0063127
465 Ga0395901_0166943
466 Ga0436365_0747521
467 Ga0436363_1226233
468 Ga0495603_0043580
469 Ga0495629_0012777
470 Ga0495629_0091549
471 Ga0495629_0207862
472 Ga0495641_0018009
473 Ga0495641_0058293
474 Ga0495651_0008048
475 Ga0495651_0016738
476 Ga0495651_0209978
477 Ga0495653_0038241
478 Ga0495653_0078245
479 Ga0495582_0018167
480 Ga0495639_0035654
481 Ga0495662_0007203
482 Ga0495664_0036855
483 Ga0495594_0020226
484 Ga0495608_0028245
485 Ga0495608_0140341
486 Ga0495628_0130616
487 Ga0495628_0312715
488 Ga0495630_0004764
489 Ga0495666_0055336
490 Ga0495652_0083116
491 Ga0495665_0002624
492 Ga0495640_0043298
493 Ga0495586_0062573
494 Ga0495587_0044439
495 Ga0495645_0042943
496 Ga0495667_0080009
497 Ga0495634_0006380
498 Ga0495634_0047104
499 Ga0495599_0053104
500 Ga0495623_0029911
501 Ga0495623_0063089
502 Ga0495647_0000212
503 Ga0495658_0000264
504 Ga0495658_0215145
505 Ga0495658_0285967
506 Ga0495613_0000809
507 Ga0495613_0182072
508 Ga0495613_0213062
509 Ga0495624_0000732
510 Ga0495600_0291704
511 Ga0495581_0011391
512 Ga0495581_0044652
513 Ga0495674_0157536
514 Ga0495674_0173039
515 Ga0495676_0091842
516 Ga0495676_0284540
517 Ga0495680_0060241
518 Ga0495680_0081971
519 Ga0495680_0253556
520 Ga0495675_0021438
521 Ga0495675_0068152
522 Ga0495684_0056746
523 Ga0495684_0120360
524 Ga0495593_0020547
525 Ga0495602_0043617
526 Ga0495602_0276043
527 Ga0495614_0015889
528 Ga0496100_0072598
529 Ga0496101_0016860
530 Ga0496101_0491992
531 Ga0496102_0000090
532 Ga0496102_0029645
533 Ga0496102_0112951
534 Ga0496103_0000034
535 Ga0496104_0155486
536 Ga0496104_0473809
537 Ga0496105_0404225
538 Ga0496106_0240550
539 Ga0496107_0043917
540 Ga0496108_0007402
541 Ga0496108_0013103
542 Ga0496108_0032458
543 Ga0496108_0131848
544 Ga0496108_0351021
545 Ga0496109_0137706
546 Ga0496109_0296966
547 Ga0496110_0029233
548 Ga0496110_0065501
549 Ga0496110_0085548
550 Ga0496111_0030719
551 Ga0496111_0052243
552 Ga0496111_0180674
553 Ga0496112_0081353
554 Ga0496112_0149863
555 Ga0496113_0009794
556 Ga0496114_0204891
557 Ga0496117_0070021
558 Ga0496118_0008416
559 Ga0496119_0018384
560 Ga0496121_0016369
561 Ga0496126_0180596
562 Ga0501071_0062851
563 nmdc:mga03n38_456_c1
564 nmdc:mga00v17_33252_c1
565 nmdc:mga0yw44_109051_c1
566 nmdc:mga0k408_10_c2
567 nmdc:mga0k408_126_c1
568 nmdc:mga0k408_589_c1
569 nmdc:mga06z11_12_c1
570 nmdc:mga06z11_1474_c1
571 nmdc:mga06z11_173125_c1
572 nmdc:mga04h51_1_c1
573 nmdc:mga04h51_42322_c1
574 nmdc:mga07m45_2211_c1
575 nmdc:mga0sz30_1_c1
576 Ga0495601_0013186
577 Ga0495601_0055998
578 Ga0495612_0006828
579 Ga0495612_0014873
580 Ga0495619_0004302
581 Ga0495619_0042746
582 Ga0495619_0080692
583 Ga0495619_0085776
584 Ga0500643_000133
585 Ga0500583_0000082
586 Ga0500583_0041105
587 Ga0500651_0123907
588 Ga0500568_0015964
589 Ga0500589_000013
590 Ga0500611_001362
591 Ga0501084_0041380
592 2579854725
593 2619857579
594 2620350771
595 2686536253
596 2954720242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

161

256

0.9

PF00005

ABC_tran

ABC transporter

82

221

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.9196 3 220
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9184 2 218
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.916 4 217
6xgz-assembly3.cif.gz_E crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9124 1 219
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.912 1 219
ID Description Score Start End Superfamily
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9815 2 221 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9544 3 220 3.40.50.300
af_Q9TXV8_581_832_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9433 3 220 3.40.50.300
af_Q9XW49_440_685_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9398 3 220 3.40.50.300
af_P9WQL7_7_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9385 2 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N3Q1I1-F1-model_v4 ABC transporter ATP-binding protein 0.9441 2 217 GO:0005524
GO:0016887
AF-A0A7X0FRN7-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9426 2 218 GO:0005524
GO:0016887
GO:0046677
AF-A0A2U3CB58-F1-model_v4 ABC transporter domain-containing protein 0.9414 2 218 GO:0005524
GO:0016887
AF-A0A2M9YKK2-F1-model_v4 ABC transporter ATP-binding protein 0.9366 5 217 GO:0005524
GO:0016887
AF-A0A496MVR8-F1-model_v4 ATP-binding cassette domain-containing protein 0.9314 3 217 GO:0005524
GO:0012505
GO:0016887
GO:0046677

Map