F394339

General Info

Members Datasets Scaffolds Average Seq Length
298 218 596 315

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10024066|Ga0316575_100240663
Length 336
Sequence MLRRMEPVPTKGKAMARRPNASDDGLIELFLDMLAAERGAGENTLSAYRNDLTDLASHLRAAKSSIARADTDDLRGFIKSLDERGFKPASLARRLSAVRQLYRFLYAEGKRGDDPAAVLEGPKRGRSLPKVLSIAEVDTLLAKARANADDTTPPPAQRLRAVRLLCLLEVVYATGLRVSELVALPASAARRDQKMLVVRGKGGKERLVPLNKAARQTMTEYLSLRSEAGKANEKSKKAPESKWLFPSFGETGHLTRQHFARDLKALGAACGIGGERLSPHVLRHAFASHLLHNGADLRVVQTLLGHADISTTQIYTHVLEDRLKSLVRDLHPLGEG

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
104 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
105 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
134 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
135 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
213 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.34
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.05
Nodule 0
Rhizoplane 7.05
Rhizosphere 83.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10024066 3300031665 Bacteria 2356
2 JGI25406J46586_10013258 3300003203 Bacteria 3549
3 JGI25153J46596_10020575 3300003215 Bacteria 2492
4 Ga0070658_10014677 3300005327 Bacteria 6284
5 Ga0070658_10106452 3300005327 Bacteria 2320
6 Ga0070676_10030532 3300005328 Bacteria 3074
7 Ga0070690_100003947 3300005330 Bacteria 8190
8 Ga0070670_100137643 3300005331 Bacteria 2110
9 Ga0070680_100008619 3300005336 Bacteria 7816
10 Ga0070689_100006271 3300005340 Bacteria 8210
11 Ga0070689_100051132 3300005340 Bacteria 3193
12 Ga0070689_100386456 3300005340 Bacteria 1180
13 Ga0070687_100034082 3300005343 Bacteria 2518
14 Ga0070687_100078786 3300005343 Bacteria 1791
15 Ga0070675_100281684 3300005354 Bacteria 1461
16 Ga0070675_100292573 3300005354 Bacteria 1433
17 Ga0070674_100002246 3300005356 Bacteria 10641
18 Ga0070674_100045258 3300005356 Bacteria 3007
19 Ga0070688_100007704 3300005365 Bacteria 5815
20 Ga0070659_100052987 3300005366 Bacteria 3192
21 Ga0070667_100034910 3300005367 Bacteria 4211
22 Ga0070714_100085792 3300005435 Bacteria 2751
23 Ga0070678_100008402 3300005456 Bacteria 6183
24 Ga0070678_100028850 3300005456 Bacteria 3791
25 Ga0070681_10039831 3300005458 Bacteria 4710
26 Ga0070681_10162000 3300005458 Bacteria 2161
27 Ga0068867_100008051 3300005459 Bacteria 7448
28 Ga0068867_100023806 3300005459 Bacteria 4387
29 Ga0070685_10072417 3300005466 Bacteria 2045
30 Ga0070679_100063420 3300005530 Bacteria 3683
31 Ga0070679_100084277 3300005530 Bacteria 3167
32 Ga0070679_100092210 3300005530 Bacteria 3017
33 Ga0070679_100440514 3300005530 Bacteria 1248
34 Ga0068853_100384910 3300005539 Bacteria 1310
35 Ga0070672_100032911 3300005543 Bacteria 3920
36 Ga0068855_100011392 3300005563 Bacteria 10739
37 Ga0068855_100449444 3300005563 Bacteria 1406
38 Ga0068854_100019175 3300005578 Bacteria 4605
39 Ga0068852_100155747 3300005616 Bacteria 2128
40 Ga0068852_100215586 3300005616 Bacteria 1823
41 Ga0068864_100099393 3300005618 Bacteria 2577
42 Ga0068860_100126676 3300005843 Bacteria 2448
43 Ga0068862_100188034 3300005844 Bacteria 1857
44 Ga0081540_1000005 3300005983 Bacteria 227052
45 Ga0081539_10001341 3300005985 Bacteria 42889
46 Ga0070717_10228744 3300006028 Bacteria 1637
47 Ga0075365_10024805 3300006038 Bacteria 3789
48 Ga0075368_10004691 3300006042 Bacteria 4650
49 Ga0075363_100000174 3300006048 Bacteria 16828
50 Ga0075364_10000925 3300006051 Bacteria 15511
51 Ga0070712_100057155 3300006175 Bacteria 2739
52 Ga0075362_10006120 3300006177 Bacteria 4460
53 Ga0075367_10063533 3300006178 Bacteria 2207
54 Ga0075369_10036375 3300006186 Bacteria 2095
55 Ga0075366_10027679 3300006195 Bacteria 3327
56 Ga0075431_100571428 3300006847 Bacteria 1117
57 Ga0075433_10105491 3300006852 Bacteria 2497
58 Ga0075433_10260409 3300006852 Bacteria 1538
59 Ga0075434_100066798 3300006871 Bacteria 3583
60 Ga0075434_100124186 3300006871 Bacteria 2598
61 Ga0075435_100077372 3300007076 Bacteria 2728
62 Ga0111539_10019416 3300009094 Bacteria 8389
63 Ga0111539_10026013 3300009094 Bacteria 7162
64 Ga0114129_10316698 3300009147 Bacteria 2075
65 Ga0105248_10015107 3300009177 Bacteria 8503
66 Ga0105248_10391312 3300009177 Bacteria 1565
67 Ga0105238_10030196 3300009551 Bacteria 5515
68 Ga0105238_10133845 3300009551 Bacteria 2457
69 Ga0105249_10367201 3300009553 Bacteria 1462
70 Ga0105246_10244038 3300011119 Bacteria 1422
71 Ga0157373_10073082 3300013100 Bacteria 2420
72 Ga0157370_10148284 3300013104 Bacteria 2184
73 Ga0163162_10168777 3300013306 Bacteria 2312
74 Ga0163162_10304856 3300013306 Bacteria 1725
75 Ga0157372_10076656 3300013307 Bacteria 3775
76 Ga0157372_10237576 3300013307 Bacteria 2114
77 Ga0157375_10638003 3300013308 Bacteria 1222
78 Ga0163163_10192352 3300014325 Bacteria 2089
79 Ga0163163_10693602 3300014325 Bacteria 1082
80 Ga0157380_10394012 3300014326 Bacteria 1311
81 Ga0182008_10083427 3300014497 Bacteria 1573
82 Ga0206356_11841863 3300020070 Bacteria 1124
83 Ga0209233_1009263 3300025261 Bacteria 3004
84 Ga0209758_1000430 3300025297 Bacteria 71132
85 Ga0207697_10017547 3300025315 Bacteria 2941
86 Ga0207682_10003834 3300025893 Bacteria 6455
87 Ga0207688_10026349 3300025901 Bacteria 3197
88 Ga0207688_10139334 3300025901 Bacteria 1427
89 Ga0207645_10037006 3300025907 Bacteria 3133
90 Ga0207705_10062918 3300025909 Bacteria 2680
91 Ga0207707_10132966 3300025912 Bacteria 2176
92 Ga0207707_10181551 3300025912 Bacteria 1837
93 Ga0207707_10362880 3300025912 Bacteria 1247
94 Ga0207693_10048512 3300025915 Bacteria 3335
95 Ga0207660_10047336 3300025917 Bacteria 3040
96 Ga0207662_10005397 3300025918 Bacteria 6809
97 Ga0207652_10049403 3300025921 Bacteria 3601
98 Ga0207652_10075775 3300025921 Bacteria 2932
99 Ga0207650_10089483 3300025925 Bacteria 2350
100 Ga0207650_10451593 3300025925 Bacteria 1070
101 Ga0207664_10149665 3300025929 Bacteria 1982
102 Ga0207644_10239379 3300025931 Bacteria 1444
103 Ga0207670_10004720 3300025936 Bacteria 7390
104 Ga0207670_10093944 3300025936 Bacteria 2126
105 Ga0207669_10001250 3300025937 Bacteria 10802
106 Ga0207669_10048606 3300025937 Bacteria 2521
107 Ga0207704_10250838 3300025938 Bacteria 1328
108 Ga0207665_10059178 3300025939 Bacteria 2592
109 Ga0207691_10004922 3300025940 Bacteria 12889
110 Ga0207691_10156825 3300025940 Bacteria 1999
111 Ga0207711_10005226 3300025941 Bacteria 10999
112 Ga0207661_10240974 3300025944 Bacteria 1605
113 Ga0207667_10024638 3300025949 Bacteria 6602
114 Ga0207658_10133970 3300025986 Bacteria 1995
115 Ga0207648_10002948 3300026089 Bacteria 18006
116 Ga0207648_10033201 3300026089 Bacteria 4552
117 Ga0207676_10011837 3300026095 Bacteria 6242
118 Ga0207674_10364569 3300026116 Bacteria 1397
119 Ga0207675_100292428 3300026118 Bacteria 1585
120 Ga0207698_10137836 3300026142 Bacteria 2096
121 Ga0209970_1002027 3300027614 Bacteria 3481
122 Ga0268265_10226095 3300028380 Bacteria 1641
123 Ga0268264_10084040 3300028381 Bacteria 2728
124 Ga0268264_10356593 3300028381 Bacteria 1394
125 Ga0265330_10019679 3300031235 Bacteria 3090
126 Ga0265332_10025083 3300031238 Bacteria 2621
127 Ga0265328_10000971 3300031239 Bacteria 13164
128 Ga0265325_10031299 3300031241 Bacteria 2848
129 Ga0265325_10044214 3300031241 Bacteria 2321
130 Ga0265340_10017200 3300031247 Bacteria 3740
131 Ga0265340_10036841 3300031247 Bacteria 2423
132 Ga0265339_10005736 3300031249 Bacteria 8245
133 Ga0265339_10005962 3300031249 Bacteria 8056
134 Ga0265331_10014621 3300031250 Bacteria 4170
135 Ga0265331_10045419 3300031250 Bacteria 2121
136 Ga0307513_10102099 3300031456 Bacteria 2888
137 Ga0307513_10138070 3300031456 Bacteria 2369
138 Ga0265314_10042042 3300031711 Bacteria 3264
139 Ga0265314_10061433 3300031711 Bacteria 2558
140 Ga0265314_10165677 3300031711 Bacteria 1339
141 Ga0265342_10000139 3300031712 Bacteria 81785
142 Ga0265342_10004338 3300031712 Bacteria 11220
143 Ga0316583_10052014 3300032133 Bacteria 1441
144 Ga0373938_0009009 3300034957 Bacteria 1796
145 Ga0373928_0041169 3300035084 Bacteria 1061
146 Ga0373951_0004828 3300035091 Bacteria 3173
147 Ga0373923_0005873 3300035111 Bacteria 4194
148 Ga0373936_0002216 3300035113 Bacteria 7252
149 Ga0373936_0039106 3300035113 Bacteria 1898
150 Ga0373939_0020622 3300035114 Bacteria 1793
151 Ga0373939_0092303 3300035114 Bacteria 1025
152 Ga0373945_0011777 3300035116 Bacteria 2896
153 Ga0373953_0001424 3300035117 Bacteria 6914
154 Ga0373954_0002291 3300035118 Bacteria 7971
155 Ga0373954_0085874 3300035118 Bacteria 1507
156 Ga0373956_0032255 3300035119 Bacteria 2298
157 Ga0373943_0001584 3300035170 Bacteria 10306
158 Ga0373943_0167598 3300035170 Bacteria 1200
159 Ga0373946_0002328 3300035171 Bacteria 6719
160 Ga0373955_0000338 3300035172 Bacteria 19607
161 Ga0373924_0005579 3300035410 Bacteria 4463
162 Ga0373931_0007577 3300035691 Bacteria 5113
163 Ga0373931_0015115 3300035691 Bacteria 3782
164 Ga0373935_0040406 3300035692 Bacteria 2928
165 Ga0373935_0185484 3300035692 Bacteria 1430
166 Ga0373927_0022573 3300035695 Bacteria 4122
167 Ga0373927_0277612 3300035695 Bacteria 1102
168 Ga0373933_0012856 3300035724 Bacteria 4629
169 Ga0373947_0003801 3300035725 Bacteria 8902
170 Ga0373947_0035434 3300035725 Bacteria 2955
171 Ga0373937_0000005 3300036401 Bacteria 199965
172 Ga0373937_0555725 3300036401 Bacteria 1090
173 Ga0373925_0000007 3300037068 Bacteria 257023
174 Ga0373925_0007976 3300037068 Bacteria 7710
175 Ga0373925_0128986 3300037068 Bacteria 1970
176 Ga0395899_0015917 3300037312 Bacteria 5735
177 Ga0395900_0004045 3300037418 Bacteria 15646
178 Ga0395900_0015042 3300037418 Bacteria 7887
179 Ga0395898_0012308 3300037466 Bacteria 8847
180 Ga0395898_0057536 3300037466 Bacteria 3788
181 Ga0395898_0084049 3300037466 Bacteria 3068
182 Ga0436364_1367845 3300037853 Bacteria 1379
183 Ga0395901_0047625 3300038443 Bacteria 4451
184 Ga0395901_0252306 3300038443 Bacteria 1838
185 Ga0436365_0301595 3300039437 Bacteria 4258
186 Ga0436361_0613394 3300039447 Bacteria 2769
187 Ga0436363_0311730 3300039450 Bacteria 3816
188 Ga0439450_009727 3300042008 Bacteria 1836
189 Ga0450923_010843 3300042125 Bacteria 1627
190 Ga0439459_0018908 3300042438 Bacteria 1300
191 Ga0466963_0021477 3300044694 Bacteria 4073
192 Ga0466967_0154847 3300045976 Bacteria 2146
193 Ga0495592_0000241 3300046454 Bacteria 46812
194 Ga0495629_0015097 3300046459 Bacteria 5552
195 Ga0495629_0167508 3300046459 Bacteria 1525
196 Ga0495638_0011669 3300046460 Bacteria 6051
197 Ga0495651_0000555 3300046462 Bacteria 28819
198 Ga0495653_0000103 3300046463 Bacteria 69772
199 Ga0495662_0012843 3300046476 Bacteria 4082
200 Ga0495664_0000003 3300046477 Bacteria 551602
201 Ga0495664_0095150 3300046477 Bacteria 1793
202 Ga0495608_0000131 3300046511 Bacteria 53612
203 Ga0495608_0158911 3300046511 Bacteria 1438
204 Ga0495618_0000019 3300046514 Bacteria 136770
205 Ga0495628_0000080 3300046516 Bacteria 75108
206 Ga0495630_0000989 3300046517 Bacteria 19766
207 Ga0495630_0345875 3300046517 Bacteria 1138
208 Ga0495652_0000006 3300046529 Bacteria 459709
209 Ga0495652_0280902 3300046529 Bacteria 1219
210 Ga0495665_0083169 3300046531 Bacteria 1683
211 Ga0495640_0000002 3300046533 Bacteria 646434
212 Ga0495587_0000001 3300046536 Bacteria 724132
213 Ga0495587_0045334 3300046536 Bacteria 2614
214 Ga0495621_0031398 3300046539 Bacteria 1822
215 Ga0495645_0000009 3300046543 Bacteria 239632
216 Ga0495667_0000021 3300046559 Bacteria 180625
217 Ga0495635_0000001 3300046663 Bacteria 704901
218 Ga0495657_0000088 3300046675 Bacteria 81307
219 Ga0495599_0000025 3300046678 Bacteria 120337
220 Ga0495623_0000018 3300046679 Bacteria 107338
221 Ga0495646_0000003 3300046680 Bacteria 287773
222 Ga0495647_0065520 3300046681 Bacteria 1443
223 Ga0495613_0052038 3300046689 Bacteria 3017
224 Ga0495600_0000042 3300046809 Bacteria 74873
225 Ga0495581_0008078 3300047315 Bacteria 6092
226 Ga0495604_0000008 3300047317 Bacteria 341160
227 Ga0495674_0000028 3300047319 Bacteria 124722
228 Ga0495680_0001113 3300047322 Bacteria 29690
229 Ga0495675_0000691 3300047444 Bacteria 21173
230 Ga0495684_0000002 3300047471 Bacteria 341216
231 Ga0495593_0005631 3300047673 Bacteria 7394
232 Ga0495602_0000022 3300048088 Bacteria 163672
233 Ga0496100_0228184 3300048903 Bacteria 1369
234 Ga0496101_0002031 3300048904 Bacteria 12306
235 Ga0496103_0039827 3300048906 Bacteria 2888
236 Ga0496104_0001419 3300048907 Bacteria 20752
237 Ga0496104_0001499 3300048907 Bacteria 20140
238 Ga0496104_0017387 3300048907 Bacteria 6548
239 Ga0496105_0010619 3300048908 Bacteria 7245
240 Ga0496105_0181624 3300048908 Bacteria 1723
241 Ga0496106_0258433 3300048909 Bacteria 1393
242 Ga0496107_0033824 3300048910 Bacteria 3658
243 Ga0496108_0332790 3300048911 Bacteria 1324
244 Ga0496109_0169885 3300048912 Bacteria 2045
245 Ga0496109_0300207 3300048912 Bacteria 1514
246 Ga0496111_0036104 3300048914 Bacteria 3534
247 Ga0496112_0093346 3300048915 Bacteria 2980
248 Ga0496112_0115132 3300048915 Bacteria 2659
249 Ga0496112_0173890 3300048915 Bacteria 2119
250 Ga0496115_0019547 3300048918 Bacteria 5214
251 Ga0496115_0044413 3300048918 Bacteria 3544
252 Ga0496115_0052116 3300048918 Bacteria 3282
253 Ga0496115_0255024 3300048918 Bacteria 1443
254 Ga0501032_0026639 3300049569 Bacteria 3974
255 Ga0501034_0024050 3300049571 Bacteria 6199
256 Ga0501034_0169483 3300049571 Bacteria 2151
257 Ga0501037_0060180 3300049573 Bacteria 2770
258 Ga0501038_0028450 3300049574 Bacteria 4966
259 Ga0501047_0010868 3300049581 Bacteria 8605
260 Ga0501048_0140640 3300049582 Bacteria 1707
261 Ga0501071_0254722 3300049587 Bacteria 1325
262 Ga0501073_0046862 3300049589 Bacteria 3039
263 Ga0501073_0060313 3300049589 Bacteria 2647
264 Ga0501083_0005209 3300049744 Bacteria 9202
265 Ga0501083_0030262 3300049744 Bacteria 3720
266 Ga0501035_0283157 3300049822 Bacteria 1401
267 Ga0501044_0020418 3300049823 Bacteria 7074
268 Ga0501044_0082893 3300049823 Bacteria 3243
269 nmdc:mga03n38_3664_c1 3300050490 Bacteria 4969
270 nmdc:mga00v17_18034_c1 3300050491 Bacteria 4006
271 nmdc:mga00v17_34258_c1 3300050491 Bacteria 3014
272 nmdc:mga0yw44_232278_c1 3300050492 Bacteria 1224
273 nmdc:mga0k408_87405_c1 3300050493 Bacteria 1831
274 nmdc:mga06z11_25963_c1 3300050494 Bacteria 2783
275 nmdc:mga06z11_36026_c1 3300050494 Bacteria 2439
276 nmdc:mga07m45_18447_c1 3300050496 Bacteria 3766
277 nmdc:mga05p37_177567_c1 3300050507 Bacteria 2593
278 nmdc:mga08y16_215545_c1 3300050511 Bacteria 1988
279 nmdc:mga0n895_267351_c1 3300050512 Bacteria 1735
280 nmdc:mga0rr50_312705_c1 3300050513 Bacteria 1316
281 nmdc:mga0a205_52232_c1 3300050515 Bacteria 3945
282 nmdc:mga0sz30_37487_c1 3300050516 Bacteria 2029
283 Ga0495601_0000001 3300053077 Bacteria 549454
284 Ga0495601_0021394 3300053077 Bacteria 3961
285 Ga0495612_0000003 3300053078 Bacteria 303629
286 Ga0495655_0012554 3300053083 Bacteria 1730
287 Ga0495595_0000093 3300053084 Bacteria 42083
288 Ga0495595_0032397 3300053084 Bacteria 2354
289 Ga0495619_0000004 3300053085 Bacteria 500068
290 Ga0500646_0013460 3300053090 Bacteria 2117
291 Ga0500593_002013 3300053117 Bacteria 7373
292 Ga0500577_0106045 3300053142 Bacteria 1154
293 Ga0500616_0087996 3300053153 Bacteria 1545
294 Ga0501084_0124129 3300054114 Bacteria 2172
295 Ga0501084_0275691 3300054114 Bacteria 1420
296 Ga0501082_0012588 3300060353 Bacteria 7270
297 Ga0501082_0238818 3300060353 Bacteria 1581
298 2891089961 2891088606 Bacteria 4762464
299 Ga0316575_10024066
300 JGI25406J46586_10013258
301 JGI25153J46596_10020575
302 Ga0070658_10014677
303 Ga0070658_10106452
304 Ga0070676_10030532
305 Ga0070690_100003947
306 Ga0070670_100137643
307 Ga0070680_100008619
308 Ga0070689_100006271
309 Ga0070689_100051132
310 Ga0070689_100386456
311 Ga0070687_100034082
312 Ga0070687_100078786
313 Ga0070675_100281684
314 Ga0070675_100292573
315 Ga0070674_100002246
316 Ga0070674_100045258
317 Ga0070688_100007704
318 Ga0070659_100052987
319 Ga0070667_100034910
320 Ga0070714_100085792
321 Ga0070678_100008402
322 Ga0070678_100028850
323 Ga0070681_10039831
324 Ga0070681_10162000
325 Ga0068867_100008051
326 Ga0068867_100023806
327 Ga0070685_10072417
328 Ga0070679_100063420
329 Ga0070679_100084277
330 Ga0070679_100092210
331 Ga0070679_100440514
332 Ga0068853_100384910
333 Ga0070672_100032911
334 Ga0068855_100011392
335 Ga0068855_100449444
336 Ga0068854_100019175
337 Ga0068852_100155747
338 Ga0068852_100215586
339 Ga0068864_100099393
340 Ga0068860_100126676
341 Ga0068862_100188034
342 Ga0081540_1000005
343 Ga0081539_10001341
344 Ga0070717_10228744
345 Ga0075365_10024805
346 Ga0075368_10004691
347 Ga0075363_100000174
348 Ga0075364_10000925
349 Ga0070712_100057155
350 Ga0075362_10006120
351 Ga0075367_10063533
352 Ga0075369_10036375
353 Ga0075366_10027679
354 Ga0075431_100571428
355 Ga0075433_10105491
356 Ga0075433_10260409
357 Ga0075434_100066798
358 Ga0075434_100124186
359 Ga0075435_100077372
360 Ga0111539_10019416
361 Ga0111539_10026013
362 Ga0114129_10316698
363 Ga0105248_10015107
364 Ga0105248_10391312
365 Ga0105238_10030196
366 Ga0105238_10133845
367 Ga0105249_10367201
368 Ga0105246_10244038
369 Ga0157373_10073082
370 Ga0157370_10148284
371 Ga0163162_10168777
372 Ga0163162_10304856
373 Ga0157372_10076656
374 Ga0157372_10237576
375 Ga0157375_10638003
376 Ga0163163_10192352
377 Ga0163163_10693602
378 Ga0157380_10394012
379 Ga0182008_10083427
380 Ga0206356_11841863
381 Ga0209233_1009263
382 Ga0209758_1000430
383 Ga0207697_10017547
384 Ga0207682_10003834
385 Ga0207688_10026349
386 Ga0207688_10139334
387 Ga0207645_10037006
388 Ga0207705_10062918
389 Ga0207707_10132966
390 Ga0207707_10181551
391 Ga0207707_10362880
392 Ga0207693_10048512
393 Ga0207660_10047336
394 Ga0207662_10005397
395 Ga0207652_10049403
396 Ga0207652_10075775
397 Ga0207650_10089483
398 Ga0207650_10451593
399 Ga0207664_10149665
400 Ga0207644_10239379
401 Ga0207670_10004720
402 Ga0207670_10093944
403 Ga0207669_10001250
404 Ga0207669_10048606
405 Ga0207704_10250838
406 Ga0207665_10059178
407 Ga0207691_10004922
408 Ga0207691_10156825
409 Ga0207711_10005226
410 Ga0207661_10240974
411 Ga0207667_10024638
412 Ga0207658_10133970
413 Ga0207648_10002948
414 Ga0207648_10033201
415 Ga0207676_10011837
416 Ga0207674_10364569
417 Ga0207675_100292428
418 Ga0207698_10137836
419 Ga0209970_1002027
420 Ga0268265_10226095
421 Ga0268264_10084040
422 Ga0268264_10356593
423 Ga0265330_10019679
424 Ga0265332_10025083
425 Ga0265328_10000971
426 Ga0265325_10031299
427 Ga0265325_10044214
428 Ga0265340_10017200
429 Ga0265340_10036841
430 Ga0265339_10005736
431 Ga0265339_10005962
432 Ga0265331_10014621
433 Ga0265331_10045419
434 Ga0307513_10102099
435 Ga0307513_10138070
436 Ga0265314_10042042
437 Ga0265314_10061433
438 Ga0265314_10165677
439 Ga0265342_10000139
440 Ga0265342_10004338
441 Ga0316583_10052014
442 Ga0373938_0009009
443 Ga0373928_0041169
444 Ga0373951_0004828
445 Ga0373923_0005873
446 Ga0373936_0002216
447 Ga0373936_0039106
448 Ga0373939_0020622
449 Ga0373939_0092303
450 Ga0373945_0011777
451 Ga0373953_0001424
452 Ga0373954_0002291
453 Ga0373954_0085874
454 Ga0373956_0032255
455 Ga0373943_0001584
456 Ga0373943_0167598
457 Ga0373946_0002328
458 Ga0373955_0000338
459 Ga0373924_0005579
460 Ga0373931_0007577
461 Ga0373931_0015115
462 Ga0373935_0040406
463 Ga0373935_0185484
464 Ga0373927_0022573
465 Ga0373927_0277612
466 Ga0373933_0012856
467 Ga0373947_0003801
468 Ga0373947_0035434
469 Ga0373937_0000005
470 Ga0373937_0555725
471 Ga0373925_0000007
472 Ga0373925_0007976
473 Ga0373925_0128986
474 Ga0395899_0015917
475 Ga0395900_0004045
476 Ga0395900_0015042
477 Ga0395898_0012308
478 Ga0395898_0057536
479 Ga0395898_0084049
480 Ga0436364_1367845
481 Ga0395901_0047625
482 Ga0395901_0252306
483 Ga0436365_0301595
484 Ga0436361_0613394
485 Ga0436363_0311730
486 Ga0439450_009727
487 Ga0450923_010843
488 Ga0439459_0018908
489 Ga0466963_0021477
490 Ga0466967_0154847
491 Ga0495592_0000241
492 Ga0495629_0015097
493 Ga0495629_0167508
494 Ga0495638_0011669
495 Ga0495651_0000555
496 Ga0495653_0000103
497 Ga0495662_0012843
498 Ga0495664_0000003
499 Ga0495664_0095150
500 Ga0495608_0000131
501 Ga0495608_0158911
502 Ga0495618_0000019
503 Ga0495628_0000080
504 Ga0495630_0000989
505 Ga0495630_0345875
506 Ga0495652_0000006
507 Ga0495652_0280902
508 Ga0495665_0083169
509 Ga0495640_0000002
510 Ga0495587_0000001
511 Ga0495587_0045334
512 Ga0495621_0031398
513 Ga0495645_0000009
514 Ga0495667_0000021
515 Ga0495635_0000001
516 Ga0495657_0000088
517 Ga0495599_0000025
518 Ga0495623_0000018
519 Ga0495646_0000003
520 Ga0495647_0065520
521 Ga0495613_0052038
522 Ga0495600_0000042
523 Ga0495581_0008078
524 Ga0495604_0000008
525 Ga0495674_0000028
526 Ga0495680_0001113
527 Ga0495675_0000691
528 Ga0495684_0000002
529 Ga0495593_0005631
530 Ga0495602_0000022
531 Ga0496100_0228184
532 Ga0496101_0002031
533 Ga0496103_0039827
534 Ga0496104_0001419
535 Ga0496104_0001499
536 Ga0496104_0017387
537 Ga0496105_0010619
538 Ga0496105_0181624
539 Ga0496106_0258433
540 Ga0496107_0033824
541 Ga0496108_0332790
542 Ga0496109_0169885
543 Ga0496109_0300207
544 Ga0496111_0036104
545 Ga0496112_0093346
546 Ga0496112_0115132
547 Ga0496112_0173890
548 Ga0496115_0019547
549 Ga0496115_0044413
550 Ga0496115_0052116
551 Ga0496115_0255024
552 Ga0501032_0026639
553 Ga0501034_0024050
554 Ga0501034_0169483
555 Ga0501037_0060180
556 Ga0501038_0028450
557 Ga0501047_0010868
558 Ga0501048_0140640
559 Ga0501071_0254722
560 Ga0501073_0046862
561 Ga0501073_0060313
562 Ga0501083_0005209
563 Ga0501083_0030262
564 Ga0501035_0283157
565 Ga0501044_0020418
566 Ga0501044_0082893
567 nmdc:mga03n38_3664_c1
568 nmdc:mga00v17_18034_c1
569 nmdc:mga00v17_34258_c1
570 nmdc:mga0yw44_232278_c1
571 nmdc:mga0k408_87405_c1
572 nmdc:mga06z11_25963_c1
573 nmdc:mga06z11_36026_c1
574 nmdc:mga07m45_18447_c1
575 nmdc:mga05p37_177567_c1
576 nmdc:mga08y16_215545_c1
577 nmdc:mga0n895_267351_c1
578 nmdc:mga0rr50_312705_c1
579 nmdc:mga0a205_52232_c1
580 nmdc:mga0sz30_37487_c1
581 Ga0495601_0000001
582 Ga0495601_0021394
583 Ga0495612_0000003
584 Ga0495655_0012554
585 Ga0495595_0000093
586 Ga0495595_0032397
587 Ga0495619_0000004
588 Ga0500646_0013460
589 Ga0500593_002013
590 Ga0500577_0106045
591 Ga0500616_0087996
592 Ga0501084_0124129
593 Ga0501084_0275691
594 Ga0501082_0012588
595 Ga0501082_0238818
596 2891089961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

27

109

0.99

PF00589

Phage_integrase

Phage integrase family

130

322

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.8913 4 96
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.8285 2 99
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.7891 4 96
3nkh-assembly1.cif.gz_B crystal structure of integrase from mrsa strain staphylococcus aureus 0.7635 112 315
2kj8-assembly1.cif.gz_A nmr structure of fragment 87-196 from the putative phage integrase ints of e. coli: northeast structural genomics consortium target er652a, psi-2 0.7522 1 107
ID Description Score Start End Superfamily
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9636 7 97 1.10.150.130
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9397 7 97 1.10.150.130
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9318 8 99 1.10.150.130
af_Q2FZ30_3_95_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9218 8 94 1.10.150.130
1a0pA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.916 8 99 1.10.150.130
ID Description Score Start End GO Terms
AF-A0A3D5USP4-F1-model_v4 Recombinase XerD 0.9847 5 94 GO:0003677
GO:0015074
AF-A0A3B8PAE6-F1-model_v4 deleted 0.9757 5 97
AF-A0A3C0FMU1-F1-model_v4 Recombinase XerD 0.9341 5 104 GO:0003677
GO:0015074
AF-A0A2H0ENX4-F1-model_v4 Core-binding (CB) domain-containing protein 0.9337 1 99 GO:0003677
GO:0015074
AF-A0A3D5USP4-F1-model_v4 Recombinase XerD 0.9054 5 94 GO:0003677
GO:0015074

Map