F394378

General Info

Members Datasets Scaffolds Average Seq Length
298 200 596 205

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0285097|Ga0373937_0285097_790_1491
Length 233
Sequence MEVPKSVIVKSWGFAQEMPPDMTSLASAVLSACTGLLLAGSIATAFAEEAKPSVKPDLAKGQATSANVCAACHTNDGSRGSPANPILQGQHPEYLVKQLTEFKANKRVSPIMSGMAAALSVDDMKNVAAFYASKQAKPGFARNKDLVSLGEKIYRGGIIERSVPACAGCHSPDGAGIPAQYPRLAGQHSDYTEAQLVAFRGGVRTNSVVMTGVTAKMNDREIKAVADYMAGLR

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
177 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
178 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
179 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
187 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
189 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
190 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
191 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
192 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
195 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
196 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
197 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
198 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
199 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
200 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 0.34
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 0
Rhizoplane 1.34
Rhizosphere 76.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0285097 3300036401 Bacteria 1560
2 Ga0055530_10008696 3300003791 Bacteria 4020
3 Ga0065165_1000107 3300005262 Bacteria 139612
4 Ga0070676_10005083 3300005328 Bacteria 6976
5 Ga0070676_10271544 3300005328 Bacteria 1139
6 Ga0070676_10583141 3300005328 Bacteria 804
7 Ga0070690_100008546 3300005330 Bacteria 5903
8 Ga0070670_100005993 3300005331 Bacteria 10284
9 Ga0070670_100064273 3300005331 Bacteria 3149
10 Ga0070670_100065295 3300005331 Bacteria 3123
11 Ga0070677_10005615 3300005333 Bacteria 4139
12 Ga0070677_10035043 3300005333 Bacteria 1943
13 Ga0068869_100021984 3300005334 Bacteria 4391
14 Ga0070666_10004086 3300005335 Bacteria 8865
15 Ga0068868_100001343 3300005338 Bacteria 16950
16 Ga0068868_100059409 3300005338 Bacteria 3024
17 Ga0070661_100615258 3300005344 Bacteria 879
18 Ga0070675_100003418 3300005354 Bacteria 12023
19 Ga0070675_100003929 3300005354 Bacteria 11264
20 Ga0070671_100012901 3300005355 Bacteria 6737
21 Ga0070671_100150079 3300005355 Bacteria 1968
22 Ga0070674_100041904 3300005356 Bacteria 3107
23 Ga0070674_100058228 3300005356 Bacteria 2685
24 Ga0070673_100009204 3300005364 Bacteria 6621
25 Ga0070688_100019843 3300005365 Bacteria 3899
26 Ga0070667_100006523 3300005367 Bacteria 9695
27 Ga0070667_100015946 3300005367 Bacteria 6217
28 Ga0070708_100101852 3300005445 Bacteria 2631
29 Ga0070663_100000518 3300005455 Bacteria 20374
30 Ga0070678_100006062 3300005456 Bacteria 7052
31 Ga0070678_100058629 3300005456 Bacteria 2827
32 Ga0068867_100000020 3300005459 Bacteria 93210
33 Ga0068867_100000345 3300005459 Bacteria 30786
34 Ga0068867_100084367 3300005459 Bacteria 2399
35 Ga0070685_10384593 3300005466 Bacteria 968
36 Ga0070706_100001854 3300005467 Bacteria 21867
37 Ga0070699_100425190 3300005518 Bacteria 1203
38 Ga0070672_100004529 3300005543 Bacteria 9099
39 Ga0070672_100014073 3300005543 Bacteria 5661
40 Ga0070672_100264078 3300005543 Bacteria 1452
41 Ga0070672_100551892 3300005543 Bacteria 1000
42 Ga0070693_100192067 3300005547 Bacteria 1321
43 Ga0070665_100007443 3300005548 Bacteria 11136
44 Ga0070664_100082566 3300005564 Bacteria 2772
45 Ga0070664_100170945 3300005564 Bacteria 1928
46 Ga0068852_100049487 3300005616 Bacteria 3596
47 Ga0068859_100001451 3300005617 Bacteria 24059
48 Ga0068864_100002901 3300005618 Bacteria 14175
49 Ga0068864_100105403 3300005618 Bacteria 2506
50 Ga0068864_100160154 3300005618 Bacteria 2045
51 Ga0068866_10010119 3300005718 Bacteria 4033
52 Ga0068861_100019011 3300005719 Bacteria 4902
53 Ga0068861_101263283 3300005719 Bacteria 716
54 Ga0068863_100010181 3300005841 Bacteria 9144
55 Ga0068863_100227290 3300005841 Bacteria 1799
56 Ga0068858_100000749 3300005842 Bacteria 34025
57 Ga0068860_100004012 3300005843 Bacteria 15113
58 Ga0068860_100490276 3300005843 Bacteria 1226
59 Ga0068860_100759993 3300005843 Bacteria 981
60 Ga0068862_100014852 3300005844 Bacteria 6469
61 Ga0075363_100068842 3300006048 Bacteria 1920
62 Ga0075364_10243012 3300006051 Bacteria 1223
63 Ga0075362_10068966 3300006177 Bacteria 1611
64 Ga0075367_10014523 3300006178 Bacteria 4264
65 Ga0075369_10061965 3300006186 Bacteria 1633
66 Ga0075366_10014455 3300006195 Bacteria 4508
67 Ga0075366_10046693 3300006195 Bacteria 2566
68 Ga0075366_10190901 3300006195 Bacteria 1245
69 Ga0097621_100009422 3300006237 Bacteria 7086
70 Ga0097621_100015389 3300006237 Bacteria 5754
71 Ga0075370_10008769 3300006353 Bacteria 5218
72 Ga0075370_10046892 3300006353 Bacteria 2447
73 Ga0075370_10087042 3300006353 Bacteria 1800
74 Ga0068871_100021762 3300006358 Bacteria 4935
75 Ga0068871_100386845 3300006358 Bacteria 1243
76 Ga0068865_100007319 3300006881 Bacteria 6783
77 Ga0097620_100001451 3300006931 Bacteria 24059
78 Ga0075435_100439650 3300007076 Bacteria 1124
79 Ga0105243_10002080 3300009148 Bacteria 16946
80 Ga0105242_10041488 3300009176 Bacteria 3712
81 Ga0105248_10008335 3300009177 Bacteria 11388
82 Ga0105248_10560714 3300009177 Bacteria 1289
83 Ga0105249_10148826 3300009553 Bacteria 2252
84 Ga0157374_10032302 3300013296 Bacteria 4764
85 Ga0157374_10383627 3300013296 Bacteria 1400
86 Ga0157378_10025487 3300013297 Bacteria 5206
87 Ga0157378_10473100 3300013297 Bacteria 1247
88 Ga0163162_10009756 3300013306 Bacteria 9345
89 Ga0163162_10096615 3300013306 Bacteria 3043
90 Ga0163162_10363188 3300013306 Bacteria 1581
91 Ga0163162_10512328 3300013306 Bacteria 1330
92 Ga0163162_11399190 3300013306 Bacteria 796
93 Ga0157375_10005174 3300013308 Bacteria 11316
94 Ga0157375_10012252 3300013308 Bacteria 7602
95 Ga0157375_10026304 3300013308 Bacteria 5420
96 Ga0157375_10180705 3300013308 Bacteria 2261
97 Ga0157375_10504157 3300013308 Bacteria 1374
98 Ga0163163_10003570 3300014325 Bacteria 13205
99 Ga0157377_10000069 3300014745 Bacteria 80723
100 Ga0157379_10015759 3300014968 Bacteria 6643
101 Ga0157379_10020334 3300014968 Bacteria 5869
102 Ga0157379_10117305 3300014968 Bacteria 2394
103 Ga0157379_10150538 3300014968 Bacteria 2099
104 Ga0157376_10007305 3300014969 Bacteria 7869
105 Ga0157376_10011022 3300014969 Bacteria 6643
106 Ga0157376_11675808 3300014969 Bacteria 671
107 Ga0163161_10055117 3300017792 Bacteria 2886
108 Ga0163161_10061738 3300017792 Bacteria 2729
109 Ga0209673_1004516 3300025273 Bacteria 7410
110 Ga0209050_1001378 3300025298 Bacteria 26512
111 Ga0207697_10027011 3300025315 Bacteria 2347
112 Ga0207682_10005911 3300025893 Bacteria 4951
113 Ga0207642_10014527 3300025899 Bacteria 2908
114 Ga0207680_10010662 3300025903 Bacteria 4608
115 Ga0207645_10018935 3300025907 Bacteria 4521
116 Ga0207645_10027684 3300025907 Bacteria 3659
117 Ga0207645_10259511 3300025907 Bacteria 1151
118 Ga0207705_10201147 3300025909 Bacteria 1509
119 Ga0207684_10003995 3300025910 Bacteria 14112
120 Ga0207646_10078725 3300025922 Bacteria 2947
121 Ga0207681_10132235 3300025923 Bacteria 1846
122 Ga0207650_10004871 3300025925 Bacteria 9172
123 Ga0207650_10038597 3300025925 Bacteria 3489
124 Ga0207659_10002886 3300025926 Bacteria 10227
125 Ga0207659_10326834 3300025926 Bacteria 1267
126 Ga0207644_10126916 3300025931 Bacteria 1948
127 Ga0207644_10134169 3300025931 Bacteria 1899
128 Ga0207644_10338597 3300025931 Bacteria 1219
129 Ga0207686_10074545 3300025934 Bacteria 2193
130 Ga0207709_10001384 3300025935 Bacteria 16986
131 Ga0207669_10045476 3300025937 Bacteria 2587
132 Ga0207704_10005072 3300025938 Bacteria 6059
133 Ga0207704_10234287 3300025938 Bacteria 1367
134 Ga0207691_10010897 3300025940 Bacteria 8724
135 Ga0207691_10018932 3300025940 Bacteria 6522
136 Ga0207691_10125224 3300025940 Bacteria 2274
137 Ga0207711_10016586 3300025941 Bacteria 6116
138 Ga0207689_10100267 3300025942 Bacteria 2379
139 Ga0207679_10137399 3300025945 Bacteria 1970
140 Ga0207651_10001062 3300025960 Bacteria 12183
141 Ga0207651_10262171 3300025960 Bacteria 1419
142 Ga0207712_10158793 3300025961 Bacteria 1755
143 Ga0207640_10163073 3300025981 Bacteria 1652
144 Ga0207658_10029167 3300025986 Bacteria 3893
145 Ga0207658_10337732 3300025986 Bacteria 1308
146 Ga0207677_10002493 3300026023 Bacteria 9661
147 Ga0207677_10093998 3300026023 Bacteria 2188
148 Ga0207703_10005450 3300026035 Bacteria 10235
149 Ga0207678_10000837 3300026067 Bacteria 28213
150 Ga0207708_10087528 3300026075 Bacteria 2398
151 Ga0207702_10367247 3300026078 Bacteria 1381
152 Ga0207641_10002150 3300026088 Bacteria 18573
153 Ga0207641_10059586 3300026088 Bacteria 3251
154 Ga0207648_10001888 3300026089 Bacteria 22895
155 Ga0207648_10001958 3300026089 Bacteria 22499
156 Ga0207648_10025730 3300026089 Bacteria 5238
157 Ga0207648_10241982 3300026089 Bacteria 1607
158 Ga0207676_10004991 3300026095 Bacteria 9400
159 Ga0207676_10020275 3300026095 Bacteria 4862
160 Ga0207676_10162118 3300026095 Bacteria 1938
161 Ga0207674_10019009 3300026116 Bacteria 7446
162 Ga0207675_100005183 3300026118 Bacteria 12547
163 Ga0207683_10007640 3300026121 Bacteria 9258
164 Ga0207698_10034081 3300026142 Bacteria 3708
165 Ga0209996_1001379 3300027395 Bacteria 2907
166 Ga0209968_1001469 3300027526 Bacteria 3580
167 Ga0209966_1000162 3300027695 Bacteria 28187
168 Ga0209974_10082867 3300027876 Bacteria 1106
169 Ga0268266_10060195 3300028379 Bacteria 3273
170 Ga0268266_10359792 3300028379 Bacteria 1369
171 Ga0268265_10044810 3300028380 Bacteria 3296
172 Ga0268265_11185994 3300028380 Bacteria 761
173 Ga0268265_11442690 3300028380 Bacteria 691
174 Ga0268264_10003124 3300028381 Bacteria 14351
175 Ga0268264_10462717 3300028381 Bacteria 1231
176 Ga0268264_11081039 3300028381 Bacteria 810
177 Ga0307517_10103953 3300028786 Bacteria 2216
178 Ga0307517_10118786 3300028786 Bacteria 1966
179 Ga0307515_10002885 3300028794 Bacteria 36551
180 Ga0307515_10012875 3300028794 Bacteria 15692
181 Ga0307515_10135126 3300028794 Bacteria 2687
182 Ga0307513_10002583 3300031456 Bacteria 25034
183 Ga0307513_10025230 3300031456 Bacteria 6893
184 Ga0307513_10097700 3300031456 Bacteria 2971
185 Ga0307509_10000249 3300031507 Bacteria 87094
186 Ga0307509_10113296 3300031507 Bacteria 2710
187 Ga0307509_10125952 3300031507 Bacteria 2528
188 Ga0307509_10539031 3300031507 Bacteria 846
189 Ga0307514_10216950 3300031649 Bacteria 1179
190 Ga0307516_10000237 3300031730 Bacteria 70929
191 Ga0307516_10001705 3300031730 Bacteria 30186
192 Ga0307405_10241157 3300031731 Bacteria 1339
193 Ga0307410_10258603 3300031852 Bacteria 1357
194 Ga0307406_10460313 3300031901 Bacteria 1023
195 Ga0307510_10029610 3300033180 Bacteria 6227
196 Ga0373943_0169022 3300035170 Bacteria 1195
197 Ga0373935_0291414 3300035692 Bacteria 1151
198 Ga0373927_0055923 3300035695 Bacteria 2550
199 Ga0373933_0097619 3300035724 Bacteria 1820
200 Ga0373925_0005006 3300037068 Bacteria 9946
201 Ga0373925_0025195 3300037068 Bacteria 4344
202 Ga0395900_0000125 3300037418 Bacteria 130214
203 Ga0395898_0000802 3300037466 Bacteria 53155
204 Ga0395905_0026109 3300037471 Bacteria 5508
205 Ga0395905_0049442 3300037471 Bacteria 3940
206 Ga0395905_0639819 3300037471 Bacteria 965
207 Ga0439432_093992 3300042006 Bacteria 901
208 Ga0466969_0010182 3300044656 Bacteria 4986
209 Ga0466969_0066221 3300044656 Bacteria 1744
210 Ga0466965_0006674 3300044683 Bacteria 5260
211 Ga0466965_0113780 3300044683 Bacteria 1392
212 Ga0466966_0012387 3300044684 Bacteria 5650
213 Ga0466966_0022716 3300044684 Bacteria 4113
214 Ga0466961_0014418 3300044693 Bacteria 5073
215 Ga0466961_0028606 3300044693 Bacteria 3583
216 Ga0466963_0001034 3300044694 Bacteria 14451
217 Ga0466964_0012633 3300044706 Bacteria 3197
218 Ga0466971_0009556 3300044719 Bacteria 4234
219 Ga0466970_0032401 3300044765 Bacteria 2761
220 Ga0466970_0126769 3300044765 Bacteria 1400
221 Ga0466957_0019552 3300044842 Bacteria 3983
222 Ga0466959_0001210 3300045049 Bacteria 15585
223 Ga0466959_0017288 3300045049 Bacteria 5284
224 Ga0451576_0350522 3300045051 Bacteria 1546
225 Ga0466958_0074200 3300045836 Bacteria 2084
226 Ga0466967_0044253 3300045976 Bacteria 3860
227 Ga0495592_0001883 3300046454 Bacteria 14765
228 Ga0495603_0185548 3300046455 Bacteria 1203
229 Ga0495629_0640193 3300046459 Bacteria 709
230 Ga0495582_0209208 3300046473 Bacteria 1115
231 Ga0495639_0336401 3300046475 Bacteria 757
232 Ga0495610_0013868 3300046512 Bacteria 4764
233 Ga0495620_0023214 3300046515 Bacteria 2971
234 Ga0495630_0072517 3300046517 Bacteria 2592
235 Ga0495632_0005268 3300046519 Bacteria 8591
236 Ga0495586_0008180 3300046535 Bacteria 5574
237 Ga0495598_0016283 3300046537 Bacteria 1894
238 Ga0495621_0066237 3300046539 Bacteria 1321
239 Ga0495645_0302362 3300046543 Bacteria 1045
240 Ga0495625_0349562 3300046660 Bacteria 935
241 Ga0495658_0006963 3300046683 Bacteria 5578
242 Ga0495658_0108362 3300046683 Bacteria 1667
243 Ga0495658_0539832 3300046683 Bacteria 746
244 Ga0495613_0061909 3300046689 Bacteria 2740
245 Ga0495613_0166508 3300046689 Bacteria 1566
246 Ga0495624_0095591 3300046690 Bacteria 1831
247 Ga0495670_0129346 3300046691 Bacteria 1316
248 Ga0495670_0315542 3300046691 Bacteria 839
249 Ga0495671_0059545 3300046692 Bacteria 1887
250 Ga0495671_0124297 3300046692 Bacteria 1258
251 Ga0495676_0052751 3300047321 Bacteria 3244
252 Ga0495681_0075369 3300047470 Bacteria 1519
253 Ga0495684_0190539 3300047471 Bacteria 1516
254 Ga0495593_0115192 3300047673 Bacteria 1370
255 Ga0496102_0011669 3300048905 Bacteria 7585
256 Ga0496108_0014761 3300048911 Bacteria 6376
257 Ga0496109_0082970 3300048912 Bacteria 2955
258 Ga0496115_0465323 3300048918 Bacteria 1020
259 Ga0501307_024741 3300049162 Bacteria 802
260 nmdc:mga03683_61787_c1 3300050489 Bacteria 1585
261 nmdc:mga0k408_12930_c1 3300050493 Bacteria 4571
262 nmdc:mga0k408_19673_c1 3300050493 Bacteria 3776
263 nmdc:mga0k408_85310_c1 3300050493 Bacteria 1853
264 nmdc:mga06z11_12027_c1 3300050494 Bacteria 3752
265 nmdc:mga07m45_15703_c1 3300050496 Bacteria 4045
266 nmdc:mga07m45_465048_c1 3300050496 Bacteria 733
267 nmdc:mga0sz30_80306_c1 3300050516 Bacteria 1411
268 Ga0495612_0031803 3300053078 Bacteria 2130
269 Ga0500578_0044635 3300053086 Bacteria 2845
270 Ga0500644_0003804 3300053088 Bacteria 3748
271 Ga0500646_0062365 3300053090 Bacteria 1100
272 Ga0500583_0141872 3300053092 Bacteria 1194
273 Ga0500651_0056929 3300053093 Bacteria 2447
274 Ga0500557_083977 3300053105 Bacteria 1053
275 Ga0500594_0000665 3300053118 Bacteria 7310
276 Ga0500652_075115 3300053131 Bacteria 1404
277 Ga0500655_004216 3300053133 Bacteria 2591
278 Ga0500559_0000032 3300053136 Bacteria 113579
279 Ga0500561_0007377 3300053137 Bacteria 2140
280 Ga0500568_0006512 3300053139 Bacteria 5852
281 Ga0500568_0133284 3300053139 Bacteria 923
282 Ga0500590_016412 3300053148 Bacteria 3828
283 Ga0500619_067194 3300053154 Bacteria 1188
284 Ga0500622_0001884 3300053156 Bacteria 15840
285 Ga0500622_0039773 3300053156 Bacteria 2451
286 Ga0500627_0068015 3300053158 Bacteria 1574
287 Ga0500645_006713 3300053730 Bacteria 4080
288 Ga0500599_011292 3300053736 Bacteria 1189
289 Ga0500587_012188 3300053739 Bacteria 1084
290 Ga0466962_0001530 3300061719 Bacteria 10806
291 Ga0466962_0025851 3300061719 Bacteria 2817
292 2587725365 2585428057 Bacteria 6737412
293 2587731281 2585428058 Bacteria 6853932
294 2643972756 2643221592 Bacteria 6608788
295 2644143397 2643221625 Bacteria 6512927
296 2644276166 2643221648 Bacteria 6521465
297 2644301245 2643221654 Bacteria 5273570
298 2644340790 2643221660 Bacteria 4208257
299 Ga0373937_0285097
300 Ga0055530_10008696
301 Ga0065165_1000107
302 Ga0070676_10005083
303 Ga0070676_10271544
304 Ga0070676_10583141
305 Ga0070690_100008546
306 Ga0070670_100005993
307 Ga0070670_100064273
308 Ga0070670_100065295
309 Ga0070677_10005615
310 Ga0070677_10035043
311 Ga0068869_100021984
312 Ga0070666_10004086
313 Ga0068868_100001343
314 Ga0068868_100059409
315 Ga0070661_100615258
316 Ga0070675_100003418
317 Ga0070675_100003929
318 Ga0070671_100012901
319 Ga0070671_100150079
320 Ga0070674_100041904
321 Ga0070674_100058228
322 Ga0070673_100009204
323 Ga0070688_100019843
324 Ga0070667_100006523
325 Ga0070667_100015946
326 Ga0070708_100101852
327 Ga0070663_100000518
328 Ga0070678_100006062
329 Ga0070678_100058629
330 Ga0068867_100000020
331 Ga0068867_100000345
332 Ga0068867_100084367
333 Ga0070685_10384593
334 Ga0070706_100001854
335 Ga0070699_100425190
336 Ga0070672_100004529
337 Ga0070672_100014073
338 Ga0070672_100264078
339 Ga0070672_100551892
340 Ga0070693_100192067
341 Ga0070665_100007443
342 Ga0070664_100082566
343 Ga0070664_100170945
344 Ga0068852_100049487
345 Ga0068859_100001451
346 Ga0068864_100002901
347 Ga0068864_100105403
348 Ga0068864_100160154
349 Ga0068866_10010119
350 Ga0068861_100019011
351 Ga0068861_101263283
352 Ga0068863_100010181
353 Ga0068863_100227290
354 Ga0068858_100000749
355 Ga0068860_100004012
356 Ga0068860_100490276
357 Ga0068860_100759993
358 Ga0068862_100014852
359 Ga0075363_100068842
360 Ga0075364_10243012
361 Ga0075362_10068966
362 Ga0075367_10014523
363 Ga0075369_10061965
364 Ga0075366_10014455
365 Ga0075366_10046693
366 Ga0075366_10190901
367 Ga0097621_100009422
368 Ga0097621_100015389
369 Ga0075370_10008769
370 Ga0075370_10046892
371 Ga0075370_10087042
372 Ga0068871_100021762
373 Ga0068871_100386845
374 Ga0068865_100007319
375 Ga0097620_100001451
376 Ga0075435_100439650
377 Ga0105243_10002080
378 Ga0105242_10041488
379 Ga0105248_10008335
380 Ga0105248_10560714
381 Ga0105249_10148826
382 Ga0157374_10032302
383 Ga0157374_10383627
384 Ga0157378_10025487
385 Ga0157378_10473100
386 Ga0163162_10009756
387 Ga0163162_10096615
388 Ga0163162_10363188
389 Ga0163162_10512328
390 Ga0163162_11399190
391 Ga0157375_10005174
392 Ga0157375_10012252
393 Ga0157375_10026304
394 Ga0157375_10180705
395 Ga0157375_10504157
396 Ga0163163_10003570
397 Ga0157377_10000069
398 Ga0157379_10015759
399 Ga0157379_10020334
400 Ga0157379_10117305
401 Ga0157379_10150538
402 Ga0157376_10007305
403 Ga0157376_10011022
404 Ga0157376_11675808
405 Ga0163161_10055117
406 Ga0163161_10061738
407 Ga0209673_1004516
408 Ga0209050_1001378
409 Ga0207697_10027011
410 Ga0207682_10005911
411 Ga0207642_10014527
412 Ga0207680_10010662
413 Ga0207645_10018935
414 Ga0207645_10027684
415 Ga0207645_10259511
416 Ga0207705_10201147
417 Ga0207684_10003995
418 Ga0207646_10078725
419 Ga0207681_10132235
420 Ga0207650_10004871
421 Ga0207650_10038597
422 Ga0207659_10002886
423 Ga0207659_10326834
424 Ga0207644_10126916
425 Ga0207644_10134169
426 Ga0207644_10338597
427 Ga0207686_10074545
428 Ga0207709_10001384
429 Ga0207669_10045476
430 Ga0207704_10005072
431 Ga0207704_10234287
432 Ga0207691_10010897
433 Ga0207691_10018932
434 Ga0207691_10125224
435 Ga0207711_10016586
436 Ga0207689_10100267
437 Ga0207679_10137399
438 Ga0207651_10001062
439 Ga0207651_10262171
440 Ga0207712_10158793
441 Ga0207640_10163073
442 Ga0207658_10029167
443 Ga0207658_10337732
444 Ga0207677_10002493
445 Ga0207677_10093998
446 Ga0207703_10005450
447 Ga0207678_10000837
448 Ga0207708_10087528
449 Ga0207702_10367247
450 Ga0207641_10002150
451 Ga0207641_10059586
452 Ga0207648_10001888
453 Ga0207648_10001958
454 Ga0207648_10025730
455 Ga0207648_10241982
456 Ga0207676_10004991
457 Ga0207676_10020275
458 Ga0207676_10162118
459 Ga0207674_10019009
460 Ga0207675_100005183
461 Ga0207683_10007640
462 Ga0207698_10034081
463 Ga0209996_1001379
464 Ga0209968_1001469
465 Ga0209966_1000162
466 Ga0209974_10082867
467 Ga0268266_10060195
468 Ga0268266_10359792
469 Ga0268265_10044810
470 Ga0268265_11185994
471 Ga0268265_11442690
472 Ga0268264_10003124
473 Ga0268264_10462717
474 Ga0268264_11081039
475 Ga0307517_10103953
476 Ga0307517_10118786
477 Ga0307515_10002885
478 Ga0307515_10012875
479 Ga0307515_10135126
480 Ga0307513_10002583
481 Ga0307513_10025230
482 Ga0307513_10097700
483 Ga0307509_10000249
484 Ga0307509_10113296
485 Ga0307509_10125952
486 Ga0307509_10539031
487 Ga0307514_10216950
488 Ga0307516_10000237
489 Ga0307516_10001705
490 Ga0307405_10241157
491 Ga0307410_10258603
492 Ga0307406_10460313
493 Ga0307510_10029610
494 Ga0373943_0169022
495 Ga0373935_0291414
496 Ga0373927_0055923
497 Ga0373933_0097619
498 Ga0373925_0005006
499 Ga0373925_0025195
500 Ga0395900_0000125
501 Ga0395898_0000802
502 Ga0395905_0026109
503 Ga0395905_0049442
504 Ga0395905_0639819
505 Ga0439432_093992
506 Ga0466969_0010182
507 Ga0466969_0066221
508 Ga0466965_0006674
509 Ga0466965_0113780
510 Ga0466966_0012387
511 Ga0466966_0022716
512 Ga0466961_0014418
513 Ga0466961_0028606
514 Ga0466963_0001034
515 Ga0466964_0012633
516 Ga0466971_0009556
517 Ga0466970_0032401
518 Ga0466970_0126769
519 Ga0466957_0019552
520 Ga0466959_0001210
521 Ga0466959_0017288
522 Ga0451576_0350522
523 Ga0466958_0074200
524 Ga0466967_0044253
525 Ga0495592_0001883
526 Ga0495603_0185548
527 Ga0495629_0640193
528 Ga0495582_0209208
529 Ga0495639_0336401
530 Ga0495610_0013868
531 Ga0495620_0023214
532 Ga0495630_0072517
533 Ga0495632_0005268
534 Ga0495586_0008180
535 Ga0495598_0016283
536 Ga0495621_0066237
537 Ga0495645_0302362
538 Ga0495625_0349562
539 Ga0495658_0006963
540 Ga0495658_0108362
541 Ga0495658_0539832
542 Ga0495613_0061909
543 Ga0495613_0166508
544 Ga0495624_0095591
545 Ga0495670_0129346
546 Ga0495670_0315542
547 Ga0495671_0059545
548 Ga0495671_0124297
549 Ga0495676_0052751
550 Ga0495681_0075369
551 Ga0495684_0190539
552 Ga0495593_0115192
553 Ga0496102_0011669
554 Ga0496108_0014761
555 Ga0496109_0082970
556 Ga0496115_0465323
557 Ga0501307_024741
558 nmdc:mga03683_61787_c1
559 nmdc:mga0k408_12930_c1
560 nmdc:mga0k408_19673_c1
561 nmdc:mga0k408_85310_c1
562 nmdc:mga06z11_12027_c1
563 nmdc:mga07m45_15703_c1
564 nmdc:mga07m45_465048_c1
565 nmdc:mga0sz30_80306_c1
566 Ga0495612_0031803
567 Ga0500578_0044635
568 Ga0500644_0003804
569 Ga0500646_0062365
570 Ga0500583_0141872
571 Ga0500651_0056929
572 Ga0500557_083977
573 Ga0500594_0000665
574 Ga0500652_075115
575 Ga0500655_004216
576 Ga0500559_0000032
577 Ga0500561_0007377
578 Ga0500568_0006512
579 Ga0500568_0133284
580 Ga0500590_016412
581 Ga0500619_067194
582 Ga0500622_0001884
583 Ga0500622_0039773
584 Ga0500627_0068015
585 Ga0500645_006713
586 Ga0500599_011292
587 Ga0500587_012188
588 Ga0466962_0001530
589 Ga0466962_0025851
590 2587725365
591 2587731281
592 2643972756
593 2644143397
594 2644276166
595 2644301245
596 2644340790

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

147

233

0.87

PF00034

Cytochrom_C

Cytochrome c

58

135

0.85

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

148

229

0.82

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

56

130

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o1w-assembly2.cif.gz_B crystal structure of colwellia psychrerythraea cytochrome c 0.908 27 102
2zzs-assembly1.cif.gz_A crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 0.893 27 103
1cno-assembly1.cif.gz_A structure of pseudomonas nautica cytochrome c552, by mad method 0.8878 25 104
2zzs-assembly29.cif.gz_3 crystal structure of cytochrome c554 from vibrio parahaemolyticus strain rimd2210633 0.8755 27 103
4o1w-assembly2.cif.gz_B crystal structure of colwellia psychrerythraea cytochrome c 0.8652 27 102
ID Description Score Start End Superfamily
4o1wD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.905 27 102 1.10.760.10
1cnoH00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8879 25 104 1.10.760.10
1h1oB02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8846 120 202 1.10.760.10
2zzsS00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8837 27 103 1.10.760.10
2zzsM00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8824 27 103 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A5Q0BS65-F1-model_v4 Cytochrome c 0.9302 26 107 GO:0009055
GO:0020037
GO:0046872
AF-A0A7V2UH10-F1-model_v4 C-type cytochrome 0.93 119 203 GO:0009055
GO:0020037
GO:0046872
AF-A0A557RKL9-F1-model_v4 Cytochrome c 0.924 26 106 GO:0009055
GO:0020037
GO:0046872
AF-A0A5P8N3R2-F1-model_v4 C-type cytochrome 0.9225 25 107 GO:0009055
GO:0020037
GO:0046872
AF-A0A257EDD6-F1-model_v4 Cytochrome C554 0.9213 27 107 GO:0009055
GO:0020037
GO:0046872

Map