F394408

General Info

Members Datasets Scaffolds Average Seq Length
298 155 298 121

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2321856|Ga0451853_2321856_220_648
Length 142
Sequence MRKQRGVTMIGWIFLLVPVGITVYGGIRVIPEYLNYYKVIQALSESATALKSDDTLTVQSIRGAIVKRFDTGYVDKPSPDDIIIKKSDKGWEMTADYEATTPMFGNLYLLMSFKKTDRMMHPPRHMRAMDGLLSFQLYSFAA

Samples

Sample ID Description Type Environment
1 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
125 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
153 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 4.03
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10043552 3300002244 Bacteria 803
2 Ga0065715_10665003 3300005293 Bacteria 671
3 Ga0070676_10161729 3300005328 Bacteria 1441
4 Ga0070690_100052031 3300005330 Bacteria 2617
5 Ga0070690_100212862 3300005330 Bacteria 1350
6 Ga0070670_100711786 3300005331 Bacteria 903
7 Ga0070677_10008755 3300005333 Bacteria 3415
8 Ga0070677_10026755 3300005333 Bacteria 2166
9 Ga0068869_100054434 3300005334 Bacteria 2913
10 Ga0068869_100212577 3300005334 Bacteria 1530
11 Ga0068869_100592330 3300005334 Bacteria 936
12 Ga0070682_100554493 3300005337 Bacteria 900
13 Ga0068868_100717501 3300005338 Unclassified 896
14 Ga0068868_100875500 3300005338 Unclassified 815
15 Ga0070689_100002301 3300005340 Bacteria 12422
16 Ga0070689_100261729 3300005340 Bacteria 1430
17 Ga0070691_10057605 3300005341 Bacteria 1864
18 Ga0070691_10117201 3300005341 Bacteria 1338
19 Ga0070691_10130509 3300005341 Bacteria 1273
20 Ga0070687_100304765 3300005343 Bacteria 1012
21 Ga0070692_10723894 3300005345 Bacteria 672
22 Ga0070668_100079640 3300005347 Bacteria 2565
23 Ga0070668_100422895 3300005347 Bacteria 1141
24 Ga0070669_100106952 3300005353 Bacteria 2118
25 Ga0070675_100004279 3300005354 Bacteria 10872
26 Ga0070675_100029716 3300005354 Bacteria 4409
27 Ga0070671_100355702 3300005355 Bacteria 1250
28 Ga0070671_100714133 3300005355 Bacteria 870
29 Ga0070674_100024236 3300005356 Bacteria 3936
30 Ga0070674_100065806 3300005356 Bacteria 2545
31 Ga0070674_100452989 3300005356 Bacteria 1059
32 Ga0070674_100977074 3300005356 Bacteria 742
33 Ga0070673_100010143 3300005364 Bacteria 6361
34 Ga0070673_100017625 3300005364 Bacteria 5084
35 Ga0070673_101570484 3300005364 Bacteria 621
36 Ga0070673_101975294 3300005364 Unclassified 553
37 Ga0070688_100029207 3300005365 Bacteria 3300
38 Ga0070688_100035678 3300005365 Bacteria 3021
39 Ga0070688_100358791 3300005365 Bacteria 1069
40 Ga0070667_100322203 3300005367 Bacteria 1395
41 Ga0070709_10287841 3300005434 Bacteria 1196
42 Ga0070701_10004699 3300005438 Bacteria 5567
43 Ga0070701_10391826 3300005438 Bacteria 878
44 Ga0070701_11038342 3300005438 Bacteria 574
45 Ga0070711_100100865 3300005439 Bacteria 2100
46 Ga0070705_100179819 3300005440 Bacteria 1432
47 Ga0070705_100284555 3300005440 Bacteria 1177
48 Ga0070705_100412789 3300005440 Unclassified 1003
49 Ga0070700_100300458 3300005441 Bacteria 1172
50 Ga0070700_100771019 3300005441 Bacteria 772
51 Ga0070700_100901460 3300005441 Bacteria 720
52 Ga0070700_101026092 3300005441 Bacteria 679
53 Ga0070694_100061268 3300005444 Bacteria 2568
54 Ga0070694_101959780 3300005444 Unclassified 500
55 Ga0070663_100703992 3300005455 Bacteria 859
56 Ga0070678_100068023 3300005456 Bacteria 2654
57 Ga0070678_100079035 3300005456 Bacteria 2486
58 Ga0070662_101910855 3300005457 Unclassified 513
59 Ga0068867_100141430 3300005459 Bacteria 1881
60 Ga0068867_100262443 3300005459 Bacteria 1409
61 Ga0068867_101934604 3300005459 Unclassified 556
62 Ga0070685_10053201 3300005466 Bacteria 2345
63 Ga0070672_100005085 3300005543 Bacteria 8679
64 Ga0070672_100068414 3300005543 Bacteria 2816
65 Ga0070672_100089962 3300005543 Bacteria 2474
66 Ga0070686_100027858 3300005544 Bacteria 3422
67 Ga0070686_101340865 3300005544 Bacteria 599
68 Ga0070686_101618510 3300005544 Unclassified 548
69 Ga0070686_101745831 3300005544 Bacteria 529
70 Ga0070665_100271447 3300005548 Bacteria 1698
71 Ga0070665_102505042 3300005548 Bacteria 517
72 Ga0070704_100185578 3300005549 Bacteria 1667
73 Ga0070664_100566802 3300005564 Bacteria 1051
74 Ga0068857_100306011 3300005577 Bacteria 1466
75 Ga0068854_101633675 3300005578 Bacteria 588
76 Ga0070702_100008777 3300005615 Bacteria 4915
77 Ga0070702_100029717 3300005615 Bacteria 2974
78 Ga0070702_100179849 3300005615 Bacteria 1383
79 Ga0068859_100101608 3300005617 Bacteria 2932
80 Ga0068859_101153242 3300005617 Bacteria 853
81 Ga0068864_100047250 3300005618 Bacteria 3696
82 Ga0068864_100715677 3300005618 Bacteria 979
83 Ga0068866_10112835 3300005718 Bacteria 1520
84 Ga0068861_100005744 3300005719 Bacteria 8413
85 Ga0068861_100074152 3300005719 Bacteria 2645
86 Ga0068861_100083273 3300005719 Bacteria 2509
87 Ga0068861_100113059 3300005719 Bacteria 2178
88 Ga0068861_100287238 3300005719 Bacteria 1419
89 Ga0068861_102393683 3300005719 Unclassified 531
90 Ga0068870_10003293 3300005840 Bacteria 6825
91 Ga0068863_100184311 3300005841 Bacteria 2004
92 Ga0068863_100471668 3300005841 Bacteria 1233
93 Ga0068863_100916482 3300005841 Bacteria 877
94 Ga0068858_100596653 3300005842 Bacteria 1071
95 Ga0068860_100110822 3300005843 Bacteria 2623
96 Ga0068860_100398563 3300005843 Bacteria 1361
97 Ga0068860_101771653 3300005843 Bacteria 639
98 Ga0068862_100029180 3300005844 Bacteria 4647
99 Ga0068862_100301383 3300005844 Bacteria 1474
100 Ga0068862_100420169 3300005844 Bacteria 1254
101 Ga0068862_101973545 3300005844 Unclassified 594
102 Ga0097621_100093783 3300006237 Bacteria 2516
103 Ga0097621_100150236 3300006237 Bacteria 1997
104 Ga0097621_100281806 3300006237 Bacteria 1463
105 Ga0097621_100741623 3300006237 Bacteria 907
106 Ga0068871_100097715 3300006358 Bacteria 2455
107 Ga0068871_100111751 3300006358 Bacteria 2298
108 Ga0068871_100121059 3300006358 Bacteria 2210
109 Ga0068871_100411203 3300006358 Bacteria 1206
110 Ga0068871_100749353 3300006358 Bacteria 898
111 Ga0068865_100072146 3300006881 Bacteria 2452
112 Ga0068865_100161982 3300006881 Bacteria 1707
113 Ga0068865_100232472 3300006881 Bacteria 1447
114 Ga0068865_100602912 3300006881 Bacteria 928
115 Ga0068865_100956285 3300006881 Bacteria 748
116 Ga0068865_101665856 3300006881 Bacteria 574
117 Ga0097620_100101609 3300006931 Bacteria 2932
118 Ga0097620_101153220 3300006931 Bacteria 853
119 Ga0111539_10180995 3300009094 Bacteria 2462
120 Ga0111539_10976238 3300009094 Bacteria 985
121 Ga0111539_12180245 3300009094 Unclassified 643
122 Ga0105245_12179307 3300009098 Bacteria 608
123 Ga0105243_10178968 3300009148 Bacteria 1843
124 Ga0105243_10710367 3300009148 Bacteria 981
125 Ga0105242_10011618 3300009176 Bacteria 6771
126 Ga0105248_10158444 3300009177 Bacteria 2554
127 Ga0105248_12595109 3300009177 Bacteria 578
128 Ga0105238_10698105 3300009551 Bacteria 1027
129 Ga0105238_11393031 3300009551 Bacteria 728
130 Ga0105249_11054802 3300009553 Bacteria 882
131 Ga0157374_10856249 3300013296 Bacteria 926
132 Ga0157378_11364648 3300013297 Bacteria 751
133 Ga0163162_10056440 3300013306 Bacteria 3955
134 Ga0163162_10695727 3300013306 Bacteria 1138
135 Ga0163162_10704714 3300013306 Bacteria 1131
136 Ga0157375_10043888 3300013308 Bacteria 4338
137 Ga0157375_10330920 3300013308 Bacteria 1688
138 Ga0157375_11106203 3300013308 Unclassified 928
139 Ga0163163_10310995 3300014325 Bacteria 1628
140 Ga0163163_10818616 3300014325 Bacteria 995
141 Ga0157380_10004215 3300014326 Bacteria 9944
142 Ga0157380_10037459 3300014326 Bacteria 3758
143 Ga0157380_10145508 3300014326 Bacteria 2042
144 Ga0157380_10239375 3300014326 Bacteria 1635
145 Ga0157380_10295877 3300014326 Bacteria 1488
146 Ga0157380_10304931 3300014326 Bacteria 1469
147 Ga0157380_10863274 3300014326 Bacteria 928
148 Ga0157380_11575243 3300014326 Bacteria 712
149 Ga0157380_13385613 3300014326 Unclassified 510
150 Ga0157380_13413150 3300014326 Unclassified 508
151 Ga0157377_11130864 3300014745 Unclassified 602
152 Ga0157379_10345621 3300014968 Bacteria 1361
153 Ga0157376_10164049 3300014969 Bacteria 2017
154 Ga0157376_10301049 3300014969 Bacteria 1518
155 Ga0163161_10112659 3300017792 Bacteria 2035
156 Ga0163161_10204568 3300017792 Bacteria 1523
157 Ga0163161_10219945 3300017792 Bacteria 1470
158 Ga0163161_10462728 3300017792 Bacteria 1027
159 Ga0207682_10000686 3300025893 Bacteria 15721
160 Ga0207682_10006464 3300025893 Bacteria 4718
161 Ga0207642_10548997 3300025899 Bacteria 713
162 Ga0207688_10503690 3300025901 Bacteria 758
163 Ga0207699_10160363 3300025906 Bacteria 1496
164 Ga0207645_10147952 3300025907 Bacteria 1532
165 Ga0207645_10508764 3300025907 Bacteria 816
166 Ga0207643_10017116 3300025908 Bacteria 3958
167 Ga0207662_10322838 3300025918 Bacteria 1031
168 Ga0207681_10027485 3300025923 Bacteria 3679
169 Ga0207681_10206283 3300025923 Bacteria 1512
170 Ga0207694_10624797 3300025924 Bacteria 907
171 Ga0207650_10226949 3300025925 Bacteria 1505
172 Ga0207659_10008076 3300025926 Bacteria 6515
173 Ga0207659_10023389 3300025926 Bacteria 4123
174 Ga0207644_10462646 3300025931 Unclassified 1043
175 Ga0207706_11716126 3300025933 Unclassified 505
176 Ga0207686_10096258 3300025934 Bacteria 1966
177 Ga0207709_10429178 3300025935 Bacteria 1017
178 Ga0207709_10668573 3300025935 Bacteria 828
179 Ga0207670_10085861 3300025936 Bacteria 2213
180 Ga0207670_10126904 3300025936 Bacteria 1863
181 Ga0207669_10009009 3300025937 Bacteria 4723
182 Ga0207669_10037715 3300025937 Bacteria 2775
183 Ga0207669_10048097 3300025937 Bacteria 2531
184 Ga0207704_10025223 3300025938 Bacteria 3241
185 Ga0207704_10031354 3300025938 Bacteria 2993
186 Ga0207704_10142299 3300025938 Bacteria 1680
187 Ga0207704_10838658 3300025938 Bacteria 770
188 Ga0207691_10016948 3300025940 Bacteria 6913
189 Ga0207691_10023826 3300025940 Bacteria 5761
190 Ga0207691_10081193 3300025940 Bacteria 2915
191 Ga0207691_11403218 3300025940 Unclassified 574
192 Ga0207711_10239262 3300025941 Bacteria 1664
193 Ga0207689_10032475 3300025942 Bacteria 4343
194 Ga0207689_10090513 3300025942 Bacteria 2514
195 Ga0207689_10862638 3300025942 Unclassified 764
196 Ga0207679_11057298 3300025945 Bacteria 744
197 Ga0207651_10005709 3300025960 Bacteria 6424
198 Ga0207651_10280140 3300025960 Bacteria 1377
199 Ga0207651_10747088 3300025960 Bacteria 864
200 Ga0207712_10904573 3300025961 Bacteria 780
201 Ga0207668_10073304 3300025972 Bacteria 2453
202 Ga0207668_10273018 3300025972 Bacteria 1383
203 Ga0207640_11541480 3300025981 Bacteria 598
204 Ga0207658_10294333 3300025986 Bacteria 1396
205 Ga0207658_11345484 3300025986 Bacteria 653
206 Ga0207658_11374466 3300025986 Unclassified 646
207 Ga0207677_11261430 3300026023 Unclassified 678
208 Ga0207703_10497506 3300026035 Bacteria 1144
209 Ga0207678_10210019 3300026067 Bacteria 1665
210 Ga0207708_10023462 3300026075 Bacteria 4663
211 Ga0207708_10048690 3300026075 Bacteria 3227
212 Ga0207708_10116942 3300026075 Bacteria 2075
213 Ga0207708_10124399 3300026075 Bacteria 2012
214 Ga0207708_10971040 3300026075 Bacteria 737
215 Ga0207641_10044430 3300026088 Bacteria 3736
216 Ga0207641_10069136 3300026088 Bacteria 3030
217 Ga0207641_10077604 3300026088 Bacteria 2875
218 Ga0207641_10372865 3300026088 Bacteria 1365
219 Ga0207648_10268718 3300026089 Bacteria 1523
220 Ga0207648_11172456 3300026089 Bacteria 721
221 Ga0207676_10692033 3300026095 Bacteria 987
222 Ga0207674_10079109 3300026116 Bacteria 3293
223 Ga0207675_100002404 3300026118 Bacteria 18537
224 Ga0207675_100007679 3300026118 Bacteria 10175
225 Ga0207675_100090455 3300026118 Bacteria 2878
226 Ga0207675_100327998 3300026118 Bacteria 1495
227 Ga0207675_100801824 3300026118 Bacteria 955
228 Ga0207675_101013288 3300026118 Bacteria 849
229 Ga0207683_10039155 3300026121 Bacteria 4135
230 Ga0207683_10127202 3300026121 Bacteria 2290
231 Ga0207428_10168337 3300027907 Bacteria 1660
232 Ga0268266_12129215 3300028379 Bacteria 533
233 Ga0268265_10017872 3300028380 Bacteria 4903
234 Ga0268265_10048924 3300028380 Bacteria 3177
235 Ga0268265_10057433 3300028380 Bacteria 2966
236 Ga0268264_10057210 3300028381 Bacteria 3261
237 Ga0268264_10783062 3300028381 Bacteria 952
238 Ga0307515_10329415 3300028794 Bacteria 1187
239 Ga0307513_10019379 3300031456 Bacteria 8101
240 Ga0307513_10103059 3300031456 Bacteria 2871
241 Ga0307408_101288886 3300031548 Bacteria 684
242 Ga0307413_10003048 3300031824 Bacteria 6960
243 Ga0307413_11122471 3300031824 Bacteria 680
244 Ga0307410_10070764 3300031852 Bacteria 2417
245 Ga0307406_11497598 3300031901 Bacteria 594
246 Ga0307407_10032039 3300031903 Bacteria 2853
247 Ga0307409_100008553 3300031995 Bacteria 6221
248 Ga0307409_100049651 3300031995 Bacteria 3200
249 Ga0307409_100786838 3300031995 Bacteria 958
250 Ga0307411_10000920 3300032005 Bacteria 11189
251 Ga0307411_10706377 3300032005 Bacteria 879
252 Ga0307411_10781317 3300032005 Bacteria 839
253 Ga0307411_10866181 3300032005 Bacteria 800
254 Ga0451789_0036521 3300041443 Unclassified 1040
255 Ga0451791_0008784 3300041451 Bacteria 1784
256 Ga0451791_0188877 3300041451 Bacteria 936
257 Ga0451793_0070191 3300041452 Bacteria 1410
258 Ga0451795_0170538 3300041456 Bacteria 662
259 Ga0451800_0294001 3300041459 Bacteria 1112
260 Ga0451807_0342670 3300041486 Bacteria 1908
261 Ga0451807_0343574 3300041486 Bacteria 1796
262 Ga0451807_1849278 3300041486 Bacteria 981
263 Ga0451807_2111499 3300041486 Bacteria 672
264 Ga0451841_0365855 3300041498 Bacteria 1136
265 Ga0451853_1748554 3300041512 Bacteria 1434
266 Ga0451853_2321856 3300041512 Bacteria 725
267 Ga0439459_0083112 3300042438 Unclassified 759
268 Ga0495632_0107610 3300046519 Bacteria 1311
269 Ga0495621_0088560 3300046539 Bacteria 1164
270 Ga0495668_0525878 3300046616 Bacteria 652
271 Ga0495672_0188474 3300047320 Bacteria 1039
272 Ga0495680_0902133 3300047322 Bacteria 571
273 Ga0496105_1124332 3300048908 Bacteria 582
274 Ga0496114_0793865 3300048917 Bacteria 825
275 Ga0501031_0284404 3300049568 Bacteria 1073
276 Ga0501036_0126442 3300049572 Bacteria 2159
277 Ga0501040_0268581 3300049576 Bacteria 1218
278 Ga0501042_0390815 3300049578 Bacteria 1008
279 Ga0501067_0185513 3300049583 Bacteria 1158
280 Ga0501068_0002173 3300049584 Bacteria 10451
281 Ga0501068_0374847 3300049584 Unclassified 916
282 Ga0501070_0007478 3300049586 Bacteria 9280
283 Ga0501071_0115005 3300049587 Bacteria 1991
284 Ga0501073_0000314 3300049589 Bacteria 32139
285 Ga0501073_0290026 3300049589 Bacteria 1129
286 Ga0501074_0016769 3300049590 Bacteria 5315
287 Ga0501077_0000591 3300049593 Bacteria 21943
288 Ga0501079_0000274 3300049741 Bacteria 31680
289 Ga0501080_0007557 3300049742 Bacteria 9823
290 Ga0501080_0850235 3300049742 Bacteria 798
291 nmdc:mga08y16_118275_c1 3300050511 Bacteria 2758
292 nmdc:mga08y16_632043_c1 3300050511 Bacteria 1076
293 Ga0500583_0107786 3300053092 Bacteria 1369
294 Ga0500627_0246962 3300053158 Bacteria 791
295 Ga0500611_014548 3300053727 Bacteria 1375
296 Ga0501084_0632751 3300054114 Bacteria 903
297 Ga0501084_1314347 3300054114 Unclassified 606
298 Ga0530510_1037512 3300061734 Bacteria 628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_0188877 Ga0451791_0188877_562_915 100
2 3300025986 Ga0207658_11374466 Ga0207658_113744662 112
3 3300042438 Ga0439459_0083112 Ga0439459_0083112_175_516 112
4 3300047320 Ga0495672_0188474 Ga0495672_0188474_367_705 112
5 3300014326 Ga0157380_10004215 Ga0157380_100042153 113
6 3300032005 Ga0307411_10866181 Ga0307411_108661812 118
7 3300005341 Ga0070691_10117201 Ga0070691_101172012 119
8 3300005438 Ga0070701_11038342 Ga0070701_110383422 119
9 3300005440 Ga0070705_100284555 Ga0070705_1002845551 119
10 3300005441 Ga0070700_101026092 Ga0070700_1010260922 119
11 3300005719 Ga0068861_100287238 Ga0068861_1002872383 119
12 3300005844 Ga0068862_100420169 Ga0068862_1004201692 119
13 3300026075 Ga0207708_10023462 Ga0207708_100234623 119
14 3300026118 Ga0207675_100327998 Ga0207675_1003279983 119
15 3300028380 Ga0268265_10048924 Ga0268265_100489242 119
16 3300049583 Ga0501067_0185513 Ga0501067_0185513_655_1017 119
17 3300049584 Ga0501068_0002173 Ga0501068_0002173_7939_8301 119
18 3300049586 Ga0501070_0007478 Ga0501070_0007478_3533_3895 119
19 3300049589 Ga0501073_0000314 Ga0501073_0000314_7084_7446 119
20 3300049590 Ga0501074_0016769 Ga0501074_0016769_3630_3992 119
21 3300049593 Ga0501077_0000591 Ga0501077_0000591_3788_4150 119
22 3300049741 Ga0501079_0000274 Ga0501079_0000274_3263_3625 119
23 3300049742 Ga0501080_0007557 Ga0501080_0007557_2563_2925 119
24 3300054114 Ga0501084_0632751 Ga0501084_0632751_120_482 119
25 3300005293 Ga0065715_10665003 Ga0065715_106650032 120
26 3300005330 Ga0070690_100052031 Ga0070690_1000520312 120
27 3300005331 Ga0070670_100711786 Ga0070670_1007117861 120
28 3300005334 Ga0068869_100054434 Ga0068869_1000544343 120
29 3300005340 Ga0070689_100002301 Ga0070689_10000230111 120
30 3300005341 Ga0070691_10057605 Ga0070691_100576052 120
31 3300005341 Ga0070691_10130509 Ga0070691_101305091 120
32 3300005345 Ga0070692_10723894 Ga0070692_107238942 120
33 3300005355 Ga0070671_100355702 Ga0070671_1003557021 120
34 3300005364 Ga0070673_101570484 Ga0070673_1015704842 120
35 3300005365 Ga0070688_100029207 Ga0070688_1000292072 120
36 3300005365 Ga0070688_100358791 Ga0070688_1003587911 120
37 3300005434 Ga0070709_10287841 Ga0070709_102878412 120
38 3300005438 Ga0070701_10004699 Ga0070701_100046993 120
39 3300005439 Ga0070711_100100865 Ga0070711_1001008653 120
40 3300005440 Ga0070705_100179819 Ga0070705_1001798192 120
41 3300005440 Ga0070705_100412789 Ga0070705_1004127892 120
42 3300005441 Ga0070700_100901460 Ga0070700_1009014602 120
43 3300005444 Ga0070694_100061268 Ga0070694_1000612682 120
44 3300005444 Ga0070694_101959780 Ga0070694_1019597801 120
45 3300005459 Ga0068867_100262443 Ga0068867_1002624433 120
46 3300005543 Ga0070672_100005085 Ga0070672_1000050857 120
47 3300005544 Ga0070686_100027858 Ga0070686_1000278582 120
48 3300005544 Ga0070686_101618510 Ga0070686_1016185101 120
49 3300005544 Ga0070686_101745831 Ga0070686_1017458311 120
50 3300005548 Ga0070665_102505042 Ga0070665_1025050422 120
51 3300005549 Ga0070704_100185578 Ga0070704_1001855782 120
52 3300005564 Ga0070664_100566802 Ga0070664_1005668022 120
53 3300005577 Ga0068857_100306011 Ga0068857_1003060112 120
54 3300005615 Ga0070702_100008777 Ga0070702_1000087771 120
55 3300005615 Ga0070702_100029717 Ga0070702_1000297173 120
56 3300005617 Ga0068859_100101608 Ga0068859_1001016083 120
57 3300005617 Ga0068859_101153242 Ga0068859_1011532422 120
58 3300005618 Ga0068864_100047250 Ga0068864_1000472503 120
59 3300005718 Ga0068866_10112835 Ga0068866_101128353 120
60 3300005719 Ga0068861_100005744 Ga0068861_10000574410 120
61 3300005719 Ga0068861_100083273 Ga0068861_1000832734 120
62 3300005719 Ga0068861_100113059 Ga0068861_1001130592 120
63 3300005841 Ga0068863_100916482 Ga0068863_1009164822 120
64 3300005842 Ga0068858_100596653 Ga0068858_1005966532 120
65 3300005843 Ga0068860_100110822 Ga0068860_1001108223 120
66 3300005843 Ga0068860_100398563 Ga0068860_1003985632 120
67 3300005843 Ga0068860_101771653 Ga0068860_1017716531 120
68 3300005844 Ga0068862_100029180 Ga0068862_1000291803 120
69 3300005844 Ga0068862_101973545 Ga0068862_1019735451 120
70 3300006237 Ga0097621_100281806 Ga0097621_1002818062 120
71 3300006237 Ga0097621_100741623 Ga0097621_1007416232 120
72 3300006358 Ga0068871_100097715 Ga0068871_1000977152 120
73 3300006358 Ga0068871_100749353 Ga0068871_1007493532 120
74 3300006881 Ga0068865_100232472 Ga0068865_1002324721 120
75 3300006881 Ga0068865_100602912 Ga0068865_1006029122 120
76 3300006881 Ga0068865_100956285 Ga0068865_1009562852 120
77 3300006881 Ga0068865_101665856 Ga0068865_1016658562 120
78 3300006931 Ga0097620_100101609 Ga0097620_1001016093 120
79 3300006931 Ga0097620_101153220 Ga0097620_1011532202 120
80 3300009094 Ga0111539_10976238 Ga0111539_109762382 120
81 3300009098 Ga0105245_12179307 Ga0105245_121793072 120
82 3300009148 Ga0105243_10710367 Ga0105243_107103672 120
83 3300009177 Ga0105248_12595109 Ga0105248_125951092 120
84 3300009551 Ga0105238_10698105 Ga0105238_106981052 120
85 3300009551 Ga0105238_11393031 Ga0105238_113930312 120
86 3300013306 Ga0163162_10704714 Ga0163162_107047142 120
87 3300013308 Ga0157375_10043888 Ga0157375_100438883 120
88 3300014325 Ga0163163_10310995 Ga0163163_103109951 120
89 3300014326 Ga0157380_10037459 Ga0157380_100374593 120
90 3300014326 Ga0157380_10239375 Ga0157380_102393753 120
91 3300014326 Ga0157380_10304931 Ga0157380_103049312 120
92 3300014326 Ga0157380_10863274 Ga0157380_108632742 120
93 3300014326 Ga0157380_11575243 Ga0157380_115752432 120
94 3300014326 Ga0157380_13385613 Ga0157380_133856131 120
95 3300014326 Ga0157380_13413150 Ga0157380_134131501 120
96 3300014969 Ga0157376_10301049 Ga0157376_103010491 120
97 3300017792 Ga0163161_10204568 Ga0163161_102045682 120
98 3300017792 Ga0163161_10462728 Ga0163161_104627282 120
99 3300025899 Ga0207642_10548997 Ga0207642_105489972 120
100 3300025906 Ga0207699_10160363 Ga0207699_101603632 120
101 3300025924 Ga0207694_10624797 Ga0207694_106247972 120
102 3300025925 Ga0207650_10226949 Ga0207650_102269492 120
103 3300025935 Ga0207709_10668573 Ga0207709_106685731 120
104 3300025936 Ga0207670_10126904 Ga0207670_101269043 120
105 3300025938 Ga0207704_10142299 Ga0207704_101422993 120
106 3300025938 Ga0207704_10838658 Ga0207704_108386582 120
107 3300025940 Ga0207691_10016948 Ga0207691_100169486 120
108 3300025942 Ga0207689_10032475 Ga0207689_100324756 120
109 3300025945 Ga0207679_11057298 Ga0207679_110572982 120
110 3300025960 Ga0207651_10747088 Ga0207651_107470882 120
111 3300026035 Ga0207703_10497506 Ga0207703_104975062 120
112 3300026075 Ga0207708_10048690 Ga0207708_100486903 120
113 3300026075 Ga0207708_10116942 Ga0207708_101169423 120
114 3300026088 Ga0207641_10077604 Ga0207641_100776042 120
115 3300026116 Ga0207674_10079109 Ga0207674_100791093 120
116 3300026118 Ga0207675_100002404 Ga0207675_10000240417 120
117 3300026118 Ga0207675_100007679 Ga0207675_1000076793 120
118 3300026118 Ga0207675_100801824 Ga0207675_1008018242 120
119 3300027907 Ga0207428_10168337 Ga0207428_101683372 120
120 3300028379 Ga0268266_12129215 Ga0268266_121292151 120
121 3300028380 Ga0268265_10017872 Ga0268265_100178725 120
122 3300028381 Ga0268264_10057210 Ga0268264_100572103 120
123 3300028381 Ga0268264_10783062 Ga0268264_107830622 120
124 3300028794 Ga0307515_10329415 Ga0307515_103294152 120
125 3300031456 Ga0307513_10019379 Ga0307513_100193797 120
126 3300031456 Ga0307513_10103059 Ga0307513_101030593 120
127 3300031548 Ga0307408_101288886 Ga0307408_1012888862 120
128 3300031824 Ga0307413_10003048 Ga0307413_100030489 120
129 3300031824 Ga0307413_11122471 Ga0307413_111224712 120
130 3300031852 Ga0307410_10070764 Ga0307410_100707643 120
131 3300031901 Ga0307406_11497598 Ga0307406_114975982 120
132 3300031903 Ga0307407_10032039 Ga0307407_100320392 120
133 3300031995 Ga0307409_100008553 Ga0307409_1000085538 120
134 3300031995 Ga0307409_100049651 Ga0307409_1000496513 120
135 3300031995 Ga0307409_100786838 Ga0307409_1007868382 120
136 3300032005 Ga0307411_10000920 Ga0307411_100009208 120
137 3300032005 Ga0307411_10706377 Ga0307411_107063771 120
138 3300032005 Ga0307411_10781317 Ga0307411_107813171 120
139 3300041451 Ga0451791_0008784 Ga0451791_0008784_1373_1738 120
140 3300041452 Ga0451793_0070191 Ga0451793_0070191_449_817 120
141 3300041456 Ga0451795_0170538 Ga0451795_0170538_29_394 120
142 3300041459 Ga0451800_0294001 Ga0451800_0294001_477_842 120
143 3300041486 Ga0451807_1849278 Ga0451807_1849278_501_866 120
144 3300041486 Ga0451807_2111499 Ga0451807_2111499_266_628 120
145 3300041498 Ga0451841_0365855 Ga0451841_0365855_670_1032 120
146 3300041512 Ga0451853_2321856 Ga0451853_2321856_220_648 120
147 3300046519 Ga0495632_0107610 Ga0495632_0107610_476_844 120
148 3300046616 Ga0495668_0525878 Ga0495668_0525878_46_408 120
149 3300047322 Ga0495680_0902133 Ga0495680_0902133_171_536 120
150 3300048908 Ga0496105_1124332 Ga0496105_1124332_18_386 120
151 3300048917 Ga0496114_0793865 Ga0496114_0793865_438_806 120
152 3300049568 Ga0501031_0284404 Ga0501031_0284404_422_820 120
153 3300049572 Ga0501036_0126442 Ga0501036_0126442_168_533 120
154 3300049576 Ga0501040_0268581 Ga0501040_0268581_445_810 120
155 3300049578 Ga0501042_0390815 Ga0501042_0390815_113_478 120
156 3300049584 Ga0501068_0374847 Ga0501068_0374847_120_482 120
157 3300049587 Ga0501071_0115005 Ga0501071_0115005_952_1350 120
158 3300049589 Ga0501073_0290026 Ga0501073_0290026_509_871 120
159 3300049742 Ga0501080_0850235 Ga0501080_0850235_384_782 120
160 3300050511 nmdc:mga08y16_118275_c1 nmdc:mga08y16_118275_c1_568_933 120
161 3300053092 Ga0500583_0107786 Ga0500583_0107786_765_1133 120
162 3300053158 Ga0500627_0246962 Ga0500627_0246962_291_653 120
163 3300053727 Ga0500611_014548 Ga0500611_014548_61_429 120
164 3300054114 Ga0501084_1314347 Ga0501084_1314347_143_508 120
165 3300061734 Ga0530510_1037512 Ga0530510_1037512_248_610 120
166 3300002244 JGI24742J22300_10043552 JGI24742J22300_100435522 121
167 3300005328 Ga0070676_10161729 Ga0070676_101617292 121
168 3300005330 Ga0070690_100212862 Ga0070690_1002128621 121
169 3300005333 Ga0070677_10008755 Ga0070677_100087552 121
170 3300005333 Ga0070677_10026755 Ga0070677_100267554 121
171 3300005334 Ga0068869_100212577 Ga0068869_1002125772 121
172 3300005334 Ga0068869_100592330 Ga0068869_1005923301 121
173 3300005337 Ga0070682_100554493 Ga0070682_1005544932 121
174 3300005338 Ga0068868_100717501 Ga0068868_1007175012 121
175 3300005338 Ga0068868_100875500 Ga0068868_1008755002 121
176 3300005340 Ga0070689_100261729 Ga0070689_1002617292 121
177 3300005343 Ga0070687_100304765 Ga0070687_1003047652 121
178 3300005347 Ga0070668_100079640 Ga0070668_1000796402 121
179 3300005347 Ga0070668_100422895 Ga0070668_1004228952 121
180 3300005353 Ga0070669_100106952 Ga0070669_1001069523 121
181 3300005354 Ga0070675_100004279 Ga0070675_10000427911 121
182 3300005354 Ga0070675_100029716 Ga0070675_1000297163 121
183 3300005355 Ga0070671_100714133 Ga0070671_1007141332 121
184 3300005356 Ga0070674_100024236 Ga0070674_1000242362 121
185 3300005356 Ga0070674_100065806 Ga0070674_1000658063 121
186 3300005356 Ga0070674_100452989 Ga0070674_1004529891 121
187 3300005356 Ga0070674_100977074 Ga0070674_1009770741 121
188 3300005364 Ga0070673_100010143 Ga0070673_1000101433 121
189 3300005364 Ga0070673_100017625 Ga0070673_1000176255 121
190 3300005364 Ga0070673_101975294 Ga0070673_1019752942 121
191 3300005365 Ga0070688_100035678 Ga0070688_1000356782 121
192 3300005367 Ga0070667_100322203 Ga0070667_1003222032 121
193 3300005438 Ga0070701_10391826 Ga0070701_103918262 121
194 3300005441 Ga0070700_100300458 Ga0070700_1003004582 121
195 3300005441 Ga0070700_100771019 Ga0070700_1007710192 121
196 3300005455 Ga0070663_100703992 Ga0070663_1007039922 121
197 3300005456 Ga0070678_100068023 Ga0070678_1000680232 121
198 3300005456 Ga0070678_100079035 Ga0070678_1000790353 121
199 3300005457 Ga0070662_101910855 Ga0070662_1019108551 121
200 3300005459 Ga0068867_100141430 Ga0068867_1001414303 121
201 3300005459 Ga0068867_101934604 Ga0068867_1019346041 121
202 3300005466 Ga0070685_10053201 Ga0070685_100532013 121
203 3300005543 Ga0070672_100068414 Ga0070672_1000684143 121
204 3300005543 Ga0070672_100089962 Ga0070672_1000899622 121
205 3300005544 Ga0070686_101340865 Ga0070686_1013408652 121
206 3300005548 Ga0070665_100271447 Ga0070665_1002714472 121
207 3300005578 Ga0068854_101633675 Ga0068854_1016336751 121
208 3300005615 Ga0070702_100179849 Ga0070702_1001798492 121
209 3300005618 Ga0068864_100715677 Ga0068864_1007156772 121
210 3300005719 Ga0068861_100074152 Ga0068861_1000741523 121
211 3300005719 Ga0068861_102393683 Ga0068861_1023936831 121
212 3300005840 Ga0068870_10003293 Ga0068870_100032936 121
213 3300005841 Ga0068863_100184311 Ga0068863_1001843112 121
214 3300005841 Ga0068863_100471668 Ga0068863_1004716682 121
215 3300005844 Ga0068862_100301383 Ga0068862_1003013832 121
216 3300006237 Ga0097621_100093783 Ga0097621_1000937832 121
217 3300006237 Ga0097621_100150236 Ga0097621_1001502362 121
218 3300006358 Ga0068871_100111751 Ga0068871_1001117512 121
219 3300006358 Ga0068871_100121059 Ga0068871_1001210592 121
220 3300006358 Ga0068871_100411203 Ga0068871_1004112032 121
221 3300006881 Ga0068865_100072146 Ga0068865_1000721462 121
222 3300006881 Ga0068865_100161982 Ga0068865_1001619821 121
223 3300009094 Ga0111539_10180995 Ga0111539_101809953 121
224 3300009094 Ga0111539_12180245 Ga0111539_121802452 121
225 3300009148 Ga0105243_10178968 Ga0105243_101789682 121
226 3300009176 Ga0105242_10011618 Ga0105242_100116186 121
227 3300009177 Ga0105248_10158444 Ga0105248_101584442 121
228 3300009553 Ga0105249_11054802 Ga0105249_110548022 121
229 3300013296 Ga0157374_10856249 Ga0157374_108562492 121
230 3300013297 Ga0157378_11364648 Ga0157378_113646482 121
231 3300013306 Ga0163162_10056440 Ga0163162_100564404 121
232 3300013306 Ga0163162_10695727 Ga0163162_106957272 121
233 3300013308 Ga0157375_10330920 Ga0157375_103309202 121
234 3300013308 Ga0157375_11106203 Ga0157375_111062032 121
235 3300014325 Ga0163163_10818616 Ga0163163_108186162 121
236 3300014326 Ga0157380_10145508 Ga0157380_101455083 121
237 3300014326 Ga0157380_10295877 Ga0157380_102958773 121
238 3300014745 Ga0157377_11130864 Ga0157377_111308641 121
239 3300014968 Ga0157379_10345621 Ga0157379_103456212 121
240 3300014969 Ga0157376_10164049 Ga0157376_101640492 121
241 3300017792 Ga0163161_10112659 Ga0163161_101126594 121
242 3300017792 Ga0163161_10219945 Ga0163161_102199452 121
243 3300025893 Ga0207682_10000686 Ga0207682_100006867 121
244 3300025893 Ga0207682_10006464 Ga0207682_100064647 121
245 3300025901 Ga0207688_10503690 Ga0207688_105036901 121
246 3300025907 Ga0207645_10147952 Ga0207645_101479522 121
247 3300025907 Ga0207645_10508764 Ga0207645_105087641 121
248 3300025908 Ga0207643_10017116 Ga0207643_100171163 121
249 3300025918 Ga0207662_10322838 Ga0207662_103228382 121
250 3300025923 Ga0207681_10027485 Ga0207681_100274852 121
251 3300025923 Ga0207681_10206283 Ga0207681_102062832 121
252 3300025926 Ga0207659_10008076 Ga0207659_100080764 121
253 3300025926 Ga0207659_10023389 Ga0207659_100233892 121
254 3300025931 Ga0207644_10462646 Ga0207644_104626462 121
255 3300025933 Ga0207706_11716126 Ga0207706_117161262 121
256 3300025934 Ga0207686_10096258 Ga0207686_100962582 121
257 3300025935 Ga0207709_10429178 Ga0207709_104291782 121
258 3300025936 Ga0207670_10085861 Ga0207670_100858612 121
259 3300025937 Ga0207669_10009009 Ga0207669_100090093 121
260 3300025937 Ga0207669_10037715 Ga0207669_100377153 121
261 3300025937 Ga0207669_10048097 Ga0207669_100480974 121
262 3300025938 Ga0207704_10025223 Ga0207704_100252233 121
263 3300025938 Ga0207704_10031354 Ga0207704_100313542 121
264 3300025940 Ga0207691_10023826 Ga0207691_100238265 121
265 3300025940 Ga0207691_10081193 Ga0207691_100811933 121
266 3300025940 Ga0207691_11403218 Ga0207691_114032182 121
267 3300025941 Ga0207711_10239262 Ga0207711_102392622 121
268 3300025942 Ga0207689_10090513 Ga0207689_100905133 121
269 3300025942 Ga0207689_10862638 Ga0207689_108626382 121
270 3300025960 Ga0207651_10005709 Ga0207651_100057095 121
271 3300025960 Ga0207651_10280140 Ga0207651_102801402 121
272 3300025961 Ga0207712_10904573 Ga0207712_109045732 121
273 3300025972 Ga0207668_10073304 Ga0207668_100733042 121
274 3300025972 Ga0207668_10273018 Ga0207668_102730182 121
275 3300025981 Ga0207640_11541480 Ga0207640_115414801 121
276 3300025986 Ga0207658_10294333 Ga0207658_102943332 121
277 3300025986 Ga0207658_11345484 Ga0207658_113454842 121
278 3300026023 Ga0207677_11261430 Ga0207677_112614302 121
279 3300026067 Ga0207678_10210019 Ga0207678_102100193 121
280 3300026075 Ga0207708_10124399 Ga0207708_101243993 121
281 3300026075 Ga0207708_10971040 Ga0207708_109710402 121
282 3300026088 Ga0207641_10044430 Ga0207641_100444305 121
283 3300026088 Ga0207641_10069136 Ga0207641_100691362 121
284 3300026088 Ga0207641_10372865 Ga0207641_103728652 121
285 3300026089 Ga0207648_10268718 Ga0207648_102687183 121
286 3300026089 Ga0207648_11172456 Ga0207648_111724562 121
287 3300026095 Ga0207676_10692033 Ga0207676_106920332 121
288 3300026118 Ga0207675_100090455 Ga0207675_1000904553 121
289 3300026118 Ga0207675_101013288 Ga0207675_1010132882 121
290 3300026121 Ga0207683_10039155 Ga0207683_100391553 121
291 3300026121 Ga0207683_10127202 Ga0207683_101272023 121
292 3300028380 Ga0268265_10057433 Ga0268265_100574332 121
293 3300041443 Ga0451789_0036521 Ga0451789_0036521_329_706 121
294 3300041486 Ga0451807_0342670 Ga0451807_0342670_276_653 121
295 3300041486 Ga0451807_0343574 Ga0451807_0343574_590_970 121
296 3300041512 Ga0451853_1748554 Ga0451853_1748554_743_1123 121
297 3300046539 Ga0495621_0088560 Ga0495621_0088560_102_467 121
298 3300050511 nmdc:mga08y16_632043_c1 nmdc:mga08y16_632043_c1_598_963 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16137

DUF4845

Domain of unknown function (DUF4845)

28

113

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcn-assembly2.cif.gz_D crystal structure of pita fragment from pilus islet-2 of streptococcus oralis with tb-xo4 0.7444 93 118
5da9-assembly1.cif.gz_A atp-gamma-s bound rad50 from chaetomium thermophilum in complex with the rad50-binding domain of mre11 0.7047 82 121
3udg-assembly1.cif.gz_A-2 structure of deinococcus radiodurans ssb bound to ssdna 0.6821 81 119
7vcn-assembly2.cif.gz_D crystal structure of pita fragment from pilus islet-2 of streptococcus oralis with tb-xo4 0.6687 93 118
3nm7-assembly2.cif.gz_D crystal structure of borrelia burgdorferi pur-alpha 0.6654 82 120
ID Description Score Start End Superfamily
af_I1N3D0_30_174_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.777 91 119 2.60.40.1820
af_Q54WT6_15_161_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7764 75 121 2.60.40.790
af_A0A0P0X7C1_1_100_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7697 35 78 1.10.10.60
af_F4ID96_3_107_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.765 36 80 1.10.10.60
af_Q656D5_25_440_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7436 81 119 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A534ALA7-F1-model_v4 DUF4845 domain-containing protein 0.947 5 121 GO:0016020
AF-A0A258SQL4-F1-model_v4 Uncharacterized protein 0.9289 77 118
AF-A0A7S6N491-F1-model_v4 DUF4845 domain-containing protein 0.9189 1 120 GO:0016020
AF-A0A7Y3N8A5-F1-model_v4 DUF4845 domain-containing protein 0.918 19 117
AF-A0A2W4Q4V2-F1-model_v4 DUF4845 domain-containing protein 0.9164 1 121 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.88 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map