F394435
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 298 | 216 | 596 | 104 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0192906|Ga0495638_0192906_554_904 |
| Length | 116 |
| Sequence | MSTQMGSTPTESRPLAFRMQLKPGVAAEYERRHDELWPDLAEALRNAGIHDYSIFLDEETMSLFAVLRLRPDHNKDALPLQPVMKRWWDYMADLMEVHPDNKPVEWPLKPVFYFEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 5 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 30 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 31 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 37 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 52 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 78 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 80 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 81 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 82 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 83 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 84 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 85 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 86 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 87 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 88 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 89 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 90 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 91 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 92 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 93 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 94 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 95 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 96 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 97 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 98 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 99 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 100 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 101 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 102 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 103 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 104 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 105 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 106 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 107 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 108 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 109 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 110 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 111 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 154 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 155 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 156 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 157 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 158 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 164 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 165 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 167 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 168 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 169 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 170 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 171 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 172 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 173 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 174 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 175 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 176 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 177 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 178 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 179 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 180 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 181 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 182 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 183 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 185 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 186 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 187 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 188 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 190 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 191 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 192 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 193 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 194 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 195 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 196 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 197 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 198 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 199 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 200 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 201 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 202 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 203 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 204 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 205 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 206 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 207 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 208 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 209 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 210 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 211 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 212 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 213 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 214 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 215 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 216 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.95 |
| Metatranscriptomes | 0 |
| Isolates | 7.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.52 |
| Nodule | 0 |
| Rhizoplane | 1.01 |
| Rhizosphere | 62.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495638_0192906 | 3300046460 | Bacteria | 1155 |
| 2 | JGI25159J45721_1008424 | 3300002987 | Bacteria | 2831 |
| 3 | rootL2_10059714 | 3300003322 | Bacteria | 3325 |
| 4 | JGI25161J50226_1018642 | 3300003374 | Bacteria | 718 |
| 5 | Ga0055537_1000076 | 3300003773 | Bacteria | 70798 |
| 6 | Ga0055537_1000260 | 3300003773 | Bacteria | 38657 |
| 7 | Ga0055524_1019935 | 3300003775 | Bacteria | 2276 |
| 8 | Ga0055536_1003677 | 3300003781 | Bacteria | 8154 |
| 9 | Ga0055536_1004268 | 3300003781 | Bacteria | 7374 |
| 10 | Ga0055534_1000124 | 3300003784 | Bacteria | 57565 |
| 11 | Ga0055528_1000184 | 3300003790 | Bacteria | 52910 |
| 12 | Ga0055530_10002644 | 3300003791 | Bacteria | 11209 |
| 13 | Ga0055530_10005916 | 3300003791 | Bacteria | 5641 |
| 14 | Ga0055530_10071745 | 3300003791 | Bacteria | 745 |
| 15 | Ga0055531_10000743 | 3300003794 | Bacteria | 27461 |
| 16 | Ga0055531_10001300 | 3300003794 | Bacteria | 18805 |
| 17 | Ga0055531_10046624 | 3300003794 | Bacteria | 1189 |
| 18 | Ga0055543_1004162 | 3300004625 | Bacteria | 4017 |
| 19 | Ga0065165_1000003 | 3300005262 | Bacteria | 390701 |
| 20 | Ga0065165_1000906 | 3300005262 | Bacteria | 38225 |
| 21 | Ga0070677_10332421 | 3300005333 | Bacteria | 782 |
| 22 | Ga0070675_101056790 | 3300005354 | Bacteria | 746 |
| 23 | Ga0070659_100956480 | 3300005366 | Bacteria | 750 |
| 24 | Ga0070667_100407442 | 3300005367 | Bacteria | 1238 |
| 25 | Ga0070713_101787274 | 3300005436 | Bacteria | 597 |
| 26 | Ga0070662_100541745 | 3300005457 | Bacteria | 974 |
| 27 | Ga0070685_10034006 | 3300005466 | Bacteria | 2869 |
| 28 | Ga0070679_100418840 | 3300005530 | Bacteria | 1285 |
| 29 | Ga0070684_101419330 | 3300005535 | Bacteria | 654 |
| 30 | Ga0068853_100523465 | 3300005539 | Bacteria | 1121 |
| 31 | Ga0070665_100513504 | 3300005548 | Bacteria | 1210 |
| 32 | Ga0070664_100568771 | 3300005564 | Bacteria | 1049 |
| 33 | Ga0068857_101272580 | 3300005577 | Bacteria | 713 |
| 34 | Ga0068852_101623694 | 3300005616 | Bacteria | 669 |
| 35 | Ga0068864_101199651 | 3300005618 | Bacteria | 757 |
| 36 | Ga0075362_10124353 | 3300006177 | Bacteria | 1223 |
| 37 | Ga0075366_10053242 | 3300006195 | Bacteria | 2404 |
| 38 | Ga0075366_10584817 | 3300006195 | Bacteria | 692 |
| 39 | Ga0105240_12792996 | 3300009093 | Bacteria | 502 |
| 40 | Ga0105241_10089606 | 3300009174 | Bacteria | 2424 |
| 41 | Ga0105237_10703569 | 3300009545 | Bacteria | 1017 |
| 42 | Ga0105237_11264410 | 3300009545 | Unclassified | 744 |
| 43 | Ga0105238_10010174 | 3300009551 | Bacteria | 9434 |
| 44 | Ga0105239_11180562 | 3300010375 | Bacteria | 882 |
| 45 | Ga0157347_1006291 | 3300012502 | Bacteria | 1158 |
| 46 | Ga0157373_11537023 | 3300013100 | Unclassified | 509 |
| 47 | Ga0157371_10085562 | 3300013102 | Bacteria | 2233 |
| 48 | Ga0157371_10557496 | 3300013102 | Unclassified | 850 |
| 49 | Ga0157370_10035177 | 3300013104 | Bacteria | 4871 |
| 50 | Ga0157369_10186838 | 3300013105 | Bacteria | 2179 |
| 51 | Ga0157369_12399258 | 3300013105 | Bacteria | 534 |
| 52 | Ga0157378_10489283 | 3300013297 | Bacteria | 1227 |
| 53 | Ga0157372_10505562 | 3300013307 | Bacteria | 1409 |
| 54 | Ga0157372_11275366 | 3300013307 | Bacteria | 848 |
| 55 | Ga0157375_10225527 | 3300013308 | Bacteria | 2033 |
| 56 | Ga0157380_10538129 | 3300014326 | Bacteria | 1143 |
| 57 | Ga0182008_10371916 | 3300014497 | Bacteria | 762 |
| 58 | Ga0157379_10540196 | 3300014968 | Bacteria | 1084 |
| 59 | Ga0157376_11524088 | 3300014969 | Bacteria | 702 |
| 60 | Ga0163161_11202656 | 3300017792 | Bacteria | 655 |
| 61 | Ga0209436_111549 | 3300025208 | Bacteria | 1545 |
| 62 | Ga0209436_111557 | 3300025208 | Bacteria | 1544 |
| 63 | Ga0209565_1000018 | 3300025263 | Bacteria | 460940 |
| 64 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 65 | Ga0209130_1000036 | 3300025284 | Bacteria | 284111 |
| 66 | Ga0209130_1013336 | 3300025284 | Bacteria | 2108 |
| 67 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 68 | Ga0209675_1002720 | 3300025291 | Bacteria | 8856 |
| 69 | Ga0209676_1001012 | 3300025292 | Bacteria | 32874 |
| 70 | Ga0209564_1000144 | 3300025295 | Bacteria | 175328 |
| 71 | Ga0209564_1002536 | 3300025295 | Bacteria | 14094 |
| 72 | Ga0209564_1019060 | 3300025295 | Bacteria | 2582 |
| 73 | Ga0209758_1000835 | 3300025297 | Bacteria | 42973 |
| 74 | Ga0209050_1000633 | 3300025298 | Bacteria | 54643 |
| 75 | Ga0209050_1021138 | 3300025298 | Bacteria | 2386 |
| 76 | Ga0209256_1001475 | 3300025299 | Bacteria | 24067 |
| 77 | Ga0209256_1003732 | 3300025299 | Bacteria | 10307 |
| 78 | Ga0209256_1003816 | 3300025299 | Bacteria | 10095 |
| 79 | Ga0209256_1045830 | 3300025299 | Bacteria | 1085 |
| 80 | Ga0207426_1003756 | 3300025302 | Bacteria | 7920 |
| 81 | Ga0209257_1000223 | 3300025304 | Bacteria | 134337 |
| 82 | Ga0209257_1000506 | 3300025304 | Bacteria | 68402 |
| 83 | Ga0207705_10765892 | 3300025909 | Bacteria | 750 |
| 84 | Ga0207654_10046613 | 3300025911 | Bacteria | 2472 |
| 85 | Ga0207707_10133163 | 3300025912 | Bacteria | 2174 |
| 86 | Ga0207695_10430623 | 3300025913 | Unclassified | 1203 |
| 87 | Ga0207671_10155875 | 3300025914 | Bacteria | 1766 |
| 88 | Ga0207662_10185492 | 3300025918 | Bacteria | 1340 |
| 89 | Ga0207657_10537164 | 3300025919 | Bacteria | 915 |
| 90 | Ga0207694_10717942 | 3300025924 | Bacteria | 843 |
| 91 | Ga0207659_10736873 | 3300025926 | Bacteria | 845 |
| 92 | Ga0207669_11244769 | 3300025937 | Bacteria | 631 |
| 93 | Ga0207661_10435721 | 3300025944 | Bacteria | 1192 |
| 94 | Ga0207679_11206802 | 3300025945 | Bacteria | 694 |
| 95 | Ga0207678_10700615 | 3300026067 | Bacteria | 891 |
| 96 | Ga0207641_10542132 | 3300026088 | Bacteria | 1134 |
| 97 | Ga0207674_11764468 | 3300026116 | Bacteria | 586 |
| 98 | Ga0268266_10887590 | 3300028379 | Bacteria | 862 |
| 99 | Ga0307515_10016038 | 3300028794 | Bacteria | 13751 |
| 100 | Ga0307515_10022050 | 3300028794 | Bacteria | 11249 |
| 101 | Ga0307515_10059507 | 3300028794 | Bacteria | 5472 |
| 102 | Ga0265332_10095990 | 3300031238 | Bacteria | 1252 |
| 103 | Ga0265316_10160023 | 3300031344 | Bacteria | 1684 |
| 104 | Ga0265316_10507320 | 3300031344 | Bacteria | 861 |
| 105 | Ga0307509_10458974 | 3300031507 | Unclassified | 966 |
| 106 | Ga0307408_100004065 | 3300031548 | Bacteria | 9975 |
| 107 | Ga0307413_10216910 | 3300031824 | Bacteria | 1394 |
| 108 | Ga0307407_10096441 | 3300031903 | Bacteria | 1825 |
| 109 | Ga0307412_11311793 | 3300031911 | Bacteria | 652 |
| 110 | Ga0307409_100432674 | 3300031995 | Bacteria | 1265 |
| 111 | Ga0307409_101831464 | 3300031995 | Bacteria | 636 |
| 112 | Ga0307409_102081888 | 3300031995 | Unclassified | 597 |
| 113 | Ga0307416_100129112 | 3300032002 | Bacteria | 2271 |
| 114 | Ga0307414_10007852 | 3300032004 | Bacteria | 6017 |
| 115 | Ga0307411_10000141 | 3300032005 | Bacteria | 22602 |
| 116 | Ga0307411_10059091 | 3300032005 | Bacteria | 2540 |
| 117 | Ga0307411_10170656 | 3300032005 | Bacteria | 1640 |
| 118 | Ga0395899_0000012 | 3300037312 | Bacteria | 517561 |
| 119 | Ga0395905_0000071 | 3300037471 | Bacteria | 174580 |
| 120 | Ga0451804_0630534 | 3300041463 | Bacteria | 526 |
| 121 | Ga0451835_0719800 | 3300041492 | Bacteria | 572 |
| 122 | Ga0439432_128931 | 3300042006 | Bacteria | 747 |
| 123 | Ga0450897_039684 | 3300042128 | Bacteria | 552 |
| 124 | Ga0450898_067136 | 3300042134 | Bacteria | 713 |
| 125 | Ga0439446_0025215 | 3300042156 | Bacteria | 1699 |
| 126 | Ga0439434_0319194 | 3300042435 | Bacteria | 539 |
| 127 | Ga0439459_0021138 | 3300042438 | Bacteria | 1247 |
| 128 | Ga0466969_0003753 | 3300044656 | Bacteria | 8071 |
| 129 | Ga0466969_0004754 | 3300044656 | Bacteria | 7226 |
| 130 | Ga0466969_0490992 | 3300044656 | Bacteria | 560 |
| 131 | Ga0466972_0278302 | 3300044658 | Bacteria | 782 |
| 132 | Ga0466965_0215110 | 3300044683 | Bacteria | 1023 |
| 133 | Ga0466966_0000303 | 3300044684 | Bacteria | 32389 |
| 134 | Ga0466966_0052061 | 3300044684 | Unclassified | 2602 |
| 135 | Ga0466961_0000482 | 3300044693 | Bacteria | 25345 |
| 136 | Ga0466964_0018915 | 3300044706 | Bacteria | 2645 |
| 137 | Ga0466971_0001240 | 3300044719 | Bacteria | 10615 |
| 138 | Ga0466968_0035120 | 3300044735 | Bacteria | 2096 |
| 139 | Ga0466970_0000842 | 3300044765 | Bacteria | 14765 |
| 140 | Ga0466970_0378724 | 3300044765 | Unclassified | 805 |
| 141 | Ga0466957_0035011 | 3300044842 | Bacteria | 3013 |
| 142 | Ga0466957_0102538 | 3300044842 | Bacteria | 1805 |
| 143 | Ga0466959_0005862 | 3300045049 | Bacteria | 8458 |
| 144 | Ga0466959_0015139 | 3300045049 | Bacteria | 5617 |
| 145 | Ga0466959_0414058 | 3300045049 | Unclassified | 915 |
| 146 | Ga0466958_0105649 | 3300045836 | Bacteria | 1755 |
| 147 | Ga0495590_0001877 | 3300046457 | Bacteria | 8887 |
| 148 | Ga0495638_0000903 | 3300046460 | Bacteria | 30346 |
| 149 | Ga0495638_0010069 | 3300046460 | Bacteria | 6590 |
| 150 | Ga0495638_0012696 | 3300046460 | Bacteria | 5761 |
| 151 | Ga0495638_0065535 | 3300046460 | Bacteria | 2235 |
| 152 | Ga0495638_0066528 | 3300046460 | Bacteria | 2215 |
| 153 | Ga0495605_0216763 | 3300046474 | Bacteria | 828 |
| 154 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 155 | Ga0495585_0036368 | 3300046492 | Bacteria | 2778 |
| 156 | Ga0495596_0089209 | 3300046500 | Bacteria | 1196 |
| 157 | Ga0495607_0046161 | 3300046501 | Bacteria | 2560 |
| 158 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 159 | Ga0495606_0017850 | 3300046507 | Bacteria | 5344 |
| 160 | Ga0495606_0048640 | 3300046507 | Bacteria | 2787 |
| 161 | Ga0495606_0060830 | 3300046507 | Bacteria | 2417 |
| 162 | Ga0495606_0095735 | 3300046507 | Bacteria | 1817 |
| 163 | Ga0495610_0017631 | 3300046512 | Bacteria | 4064 |
| 164 | Ga0495610_0093120 | 3300046512 | Bacteria | 1362 |
| 165 | Ga0495610_0152715 | 3300046512 | Bacteria | 983 |
| 166 | Ga0495616_0001054 | 3300046513 | Bacteria | 19705 |
| 167 | Ga0495616_0001840 | 3300046513 | Bacteria | 14361 |
| 168 | Ga0495631_0016244 | 3300046518 | Bacteria | 3554 |
| 169 | Ga0495632_0014086 | 3300046519 | Bacteria | 4537 |
| 170 | Ga0495632_0026064 | 3300046519 | Bacteria | 3082 |
| 171 | Ga0495632_0034959 | 3300046519 | Bacteria | 2568 |
| 172 | Ga0495637_0002140 | 3300046520 | Bacteria | 11072 |
| 173 | Ga0495637_0025735 | 3300046520 | Bacteria | 2649 |
| 174 | Ga0495643_0052865 | 3300046522 | Bacteria | 2180 |
| 175 | Ga0495643_0055723 | 3300046522 | Bacteria | 2112 |
| 176 | Ga0495644_0025011 | 3300046523 | Bacteria | 2269 |
| 177 | Ga0495648_0000176 | 3300046524 | Bacteria | 73832 |
| 178 | Ga0495648_0306600 | 3300046524 | Bacteria | 741 |
| 179 | Ga0495666_0280042 | 3300046526 | Bacteria | 756 |
| 180 | Ga0495642_0172619 | 3300046528 | Bacteria | 939 |
| 181 | Ga0495654_0114649 | 3300046530 | Bacteria | 1226 |
| 182 | Ga0495587_0067524 | 3300046536 | Bacteria | 2084 |
| 183 | Ga0495609_0022398 | 3300046538 | Bacteria | 2910 |
| 184 | Ga0495597_0025563 | 3300046542 | Bacteria | 2717 |
| 185 | Ga0495597_0061600 | 3300046542 | Bacteria | 1634 |
| 186 | Ga0495597_0175499 | 3300046542 | Bacteria | 868 |
| 187 | Ga0495597_0248909 | 3300046542 | Bacteria | 699 |
| 188 | Ga0495645_0693160 | 3300046543 | Bacteria | 619 |
| 189 | Ga0495633_0495819 | 3300046558 | Bacteria | 551 |
| 190 | Ga0495633_0496256 | 3300046558 | Bacteria | 550 |
| 191 | Ga0495668_0001203 | 3300046616 | Bacteria | 26299 |
| 192 | Ga0495668_0007240 | 3300046616 | Bacteria | 7119 |
| 193 | Ga0495668_0091304 | 3300046616 | Bacteria | 1668 |
| 194 | Ga0495625_0000143 | 3300046660 | Bacteria | 110121 |
| 195 | Ga0495625_0001739 | 3300046660 | Bacteria | 25182 |
| 196 | Ga0495625_0007256 | 3300046660 | Bacteria | 9694 |
| 197 | Ga0495625_0156657 | 3300046660 | Bacteria | 1528 |
| 198 | Ga0495625_0159778 | 3300046660 | Bacteria | 1510 |
| 199 | Ga0495625_0274319 | 3300046660 | Bacteria | 1087 |
| 200 | Ga0495625_0302561 | 3300046660 | Bacteria | 1023 |
| 201 | Ga0495659_0306091 | 3300046664 | Bacteria | 672 |
| 202 | Ga0495659_0367339 | 3300046664 | Bacteria | 617 |
| 203 | Ga0495659_0530518 | 3300046664 | Bacteria | 518 |
| 204 | Ga0495661_0022755 | 3300046665 | Bacteria | 4074 |
| 205 | Ga0495670_0212811 | 3300046691 | Bacteria | 1025 |
| 206 | Ga0495671_0252121 | 3300046692 | Bacteria | 852 |
| 207 | Ga0495671_0361071 | 3300046692 | Bacteria | 696 |
| 208 | Ga0495589_0141187 | 3300046794 | Bacteria | 1153 |
| 209 | Ga0495660_0013064 | 3300046810 | Bacteria | 4813 |
| 210 | Ga0495683_0108721 | 3300047323 | Bacteria | 1325 |
| 211 | Ga0495675_0536188 | 3300047444 | Bacteria | 669 |
| 212 | Ga0495677_0006907 | 3300047445 | Bacteria | 4266 |
| 213 | Ga0495685_118811 | 3300047447 | Bacteria | 868 |
| 214 | Ga0495673_0000416 | 3300047469 | Bacteria | 49348 |
| 215 | Ga0495673_0030394 | 3300047469 | Bacteria | 2536 |
| 216 | Ga0495681_0015104 | 3300047470 | Bacteria | 4383 |
| 217 | Ga0495686_0001382 | 3300047472 | Bacteria | 26955 |
| 218 | Ga0495686_0320763 | 3300047472 | Bacteria | 849 |
| 219 | Ga0495626_0053287 | 3300048091 | Bacteria | 1862 |
| 220 | Ga0496102_0826390 | 3300048905 | Bacteria | 849 |
| 221 | Ga0496115_0858889 | 3300048918 | Bacteria | 702 |
| 222 | Ga0496117_0001963 | 3300048920 | Bacteria | 27350 |
| 223 | Ga0496118_0002437 | 3300048921 | Bacteria | 25046 |
| 224 | Ga0496118_0636958 | 3300048921 | Bacteria | 504 |
| 225 | Ga0496124_0012047 | 3300048927 | Bacteria | 8591 |
| 226 | Ga0496125_0102968 | 3300048928 | Bacteria | 2096 |
| 227 | Ga0496126_0118279 | 3300048929 | Bacteria | 2301 |
| 228 | Ga0496126_0126632 | 3300048929 | Bacteria | 2210 |
| 229 | Ga0496126_0281926 | 3300048929 | Bacteria | 1376 |
| 230 | Ga0495678_003164 | 3300049459 | Bacteria | 10386 |
| 231 | Ga0501033_0008295 | 3300049570 | Bacteria | 8047 |
| 232 | Ga0501034_0003706 | 3300049571 | Bacteria | 17261 |
| 233 | Ga0501037_0048607 | 3300049573 | Bacteria | 3107 |
| 234 | Ga0501038_0923760 | 3300049574 | Bacteria | 643 |
| 235 | Ga0501238_013337 | 3300049671 | Bacteria | 1118 |
| 236 | Ga0501262_035541 | 3300049759 | Bacteria | 730 |
| 237 | Ga0501044_0000796 | 3300049823 | Bacteria | 38157 |
| 238 | nmdc:mga03683_398908_c1 | 3300050489 | Bacteria | 656 |
| 239 | nmdc:mga0k408_468378_c1 | 3300050493 | Bacteria | 748 |
| 240 | nmdc:mga07m45_878183_c1 | 3300050496 | Bacteria | 513 |
| 241 | Ga0500578_0000389 | 3300053086 | Bacteria | 53879 |
| 242 | Ga0500578_0281793 | 3300053086 | Bacteria | 991 |
| 243 | Ga0500643_095326 | 3300053087 | Bacteria | 809 |
| 244 | Ga0500644_0000010 | 3300053088 | Bacteria | 127225 |
| 245 | Ga0500646_0349082 | 3300053090 | Bacteria | 539 |
| 246 | Ga0500583_0352434 | 3300053092 | Unclassified | 713 |
| 247 | Ga0500651_0354571 | 3300053093 | Bacteria | 832 |
| 248 | Ga0500641_0037405 | 3300053096 | Bacteria | 1946 |
| 249 | Ga0500650_0299482 | 3300053098 | Bacteria | 712 |
| 250 | Ga0500556_0001405 | 3300053104 | Bacteria | 10468 |
| 251 | Ga0500556_0085096 | 3300053104 | Bacteria | 1201 |
| 252 | Ga0500562_006506 | 3300053108 | Bacteria | 2943 |
| 253 | Ga0500572_266937 | 3300053111 | Bacteria | 555 |
| 254 | Ga0500594_0000288 | 3300053118 | Bacteria | 11527 |
| 255 | Ga0500597_084092 | 3300053120 | Bacteria | 1381 |
| 256 | Ga0500608_000006 | 3300053122 | Bacteria | 102722 |
| 257 | Ga0500608_203736 | 3300053122 | Bacteria | 815 |
| 258 | Ga0500618_000071 | 3300053125 | Bacteria | 85596 |
| 259 | Ga0500618_039362 | 3300053125 | Bacteria | 1089 |
| 260 | Ga0500642_0229961 | 3300053130 | Bacteria | 857 |
| 261 | Ga0500655_002640 | 3300053133 | Bacteria | 3247 |
| 262 | Ga0500658_0045005 | 3300053134 | Bacteria | 1783 |
| 263 | Ga0500559_0000031 | 3300053136 | Bacteria | 114782 |
| 264 | Ga0500559_0002516 | 3300053136 | Bacteria | 9415 |
| 265 | Ga0500564_000049 | 3300053138 | Bacteria | 30793 |
| 266 | Ga0500564_322173 | 3300053138 | Bacteria | 585 |
| 267 | Ga0500588_0027339 | 3300053146 | Bacteria | 1606 |
| 268 | Ga0500588_0048160 | 3300053146 | Bacteria | 1317 |
| 269 | Ga0500622_0003337 | 3300053156 | Bacteria | 10824 |
| 270 | Ga0500622_0006512 | 3300053156 | Bacteria | 6753 |
| 271 | Ga0500622_0011027 | 3300053156 | Bacteria | 4932 |
| 272 | Ga0500622_0035340 | 3300053156 | Bacteria | 2615 |
| 273 | Ga0500645_001497 | 3300053730 | Bacteria | 11708 |
| 274 | Ga0500609_000799 | 3300053731 | Bacteria | 4723 |
| 275 | Ga0500656_064297 | 3300053732 | Bacteria | 555 |
| 276 | Ga0500599_059278 | 3300053736 | Bacteria | 620 |
| 277 | Ga0466962_0031079 | 3300061719 | Bacteria | 2556 |
| 278 | 2585146253 | 2582581279 | Bacteria | 4980720 |
| 279 | 2585155375 | 2582581280 | Bacteria | 5994497 |
| 280 | 2585198939 | 2582581293 | Bacteria | 5907401 |
| 281 | 2587919581 | 2585428106 | Bacteria | 5179711 |
| 282 | 2643748246 | 2643221545 | Bacteria | 5083237 |
| 283 | 2643779061 | 2643221552 | Bacteria | 5708754 |
| 284 | 2643926213 | 2643221583 | Bacteria | 5218014 |
| 285 | 2643927628 | 2643221584 | Bacteria | 5511711 |
| 286 | 2644226486 | 2643221640 | Bacteria | 5258820 |
| 287 | 2644235974 | 2643221642 | Bacteria | 5357871 |
| 288 | 2644508303 | 2643221691 | Bacteria | 5093099 |
| 289 | 2792459469 | 2791355048 | Bacteria | 5832535 |
| 290 | 2819539568 | 2818991435 | Bacteria | 5433759 |
| 291 | 2819648776 | 2818991454 | Bacteria | 5563326 |
| 292 | 2843747193 | 2843744320 | Bacteria | 5659202 |
| 293 | 2849560731 | 2849560528 | Bacteria | 5393480 |
| 294 | 2849574252 | 2849573788 | Bacteria | 5421256 |
| 295 | 2851158122 | 2851153111 | Bacteria | 5542585 |
| 296 | 2857506801 | 2857504554 | Bacteria | 5369913 |
| 297 | 2898330969 | 2898329390 | Bacteria | 5168154 |
| 298 | 2928534004 | 2928531327 | Bacteria | 5101314 |
| 299 | Ga0495638_0192906 | |||
| 300 | JGI25159J45721_1008424 | |||
| 301 | rootL2_10059714 | |||
| 302 | JGI25161J50226_1018642 | |||
| 303 | Ga0055537_1000076 | |||
| 304 | Ga0055537_1000260 | |||
| 305 | Ga0055524_1019935 | |||
| 306 | Ga0055536_1003677 | |||
| 307 | Ga0055536_1004268 | |||
| 308 | Ga0055534_1000124 | |||
| 309 | Ga0055528_1000184 | |||
| 310 | Ga0055530_10002644 | |||
| 311 | Ga0055530_10005916 | |||
| 312 | Ga0055530_10071745 | |||
| 313 | Ga0055531_10000743 | |||
| 314 | Ga0055531_10001300 | |||
| 315 | Ga0055531_10046624 | |||
| 316 | Ga0055543_1004162 | |||
| 317 | Ga0065165_1000003 | |||
| 318 | Ga0065165_1000906 | |||
| 319 | Ga0070677_10332421 | |||
| 320 | Ga0070675_101056790 | |||
| 321 | Ga0070659_100956480 | |||
| 322 | Ga0070667_100407442 | |||
| 323 | Ga0070713_101787274 | |||
| 324 | Ga0070662_100541745 | |||
| 325 | Ga0070685_10034006 | |||
| 326 | Ga0070679_100418840 | |||
| 327 | Ga0070684_101419330 | |||
| 328 | Ga0068853_100523465 | |||
| 329 | Ga0070665_100513504 | |||
| 330 | Ga0070664_100568771 | |||
| 331 | Ga0068857_101272580 | |||
| 332 | Ga0068852_101623694 | |||
| 333 | Ga0068864_101199651 | |||
| 334 | Ga0075362_10124353 | |||
| 335 | Ga0075366_10053242 | |||
| 336 | Ga0075366_10584817 | |||
| 337 | Ga0105240_12792996 | |||
| 338 | Ga0105241_10089606 | |||
| 339 | Ga0105237_10703569 | |||
| 340 | Ga0105237_11264410 | |||
| 341 | Ga0105238_10010174 | |||
| 342 | Ga0105239_11180562 | |||
| 343 | Ga0157347_1006291 | |||
| 344 | Ga0157373_11537023 | |||
| 345 | Ga0157371_10085562 | |||
| 346 | Ga0157371_10557496 | |||
| 347 | Ga0157370_10035177 | |||
| 348 | Ga0157369_10186838 | |||
| 349 | Ga0157369_12399258 | |||
| 350 | Ga0157378_10489283 | |||
| 351 | Ga0157372_10505562 | |||
| 352 | Ga0157372_11275366 | |||
| 353 | Ga0157375_10225527 | |||
| 354 | Ga0157380_10538129 | |||
| 355 | Ga0182008_10371916 | |||
| 356 | Ga0157379_10540196 | |||
| 357 | Ga0157376_11524088 | |||
| 358 | Ga0163161_11202656 | |||
| 359 | Ga0209436_111549 | |||
| 360 | Ga0209436_111557 | |||
| 361 | Ga0209565_1000018 | |||
| 362 | Ga0209673_1000006 | |||
| 363 | Ga0209130_1000036 | |||
| 364 | Ga0209130_1013336 | |||
| 365 | Ga0209675_1000005 | |||
| 366 | Ga0209675_1002720 | |||
| 367 | Ga0209676_1001012 | |||
| 368 | Ga0209564_1000144 | |||
| 369 | Ga0209564_1002536 | |||
| 370 | Ga0209564_1019060 | |||
| 371 | Ga0209758_1000835 | |||
| 372 | Ga0209050_1000633 | |||
| 373 | Ga0209050_1021138 | |||
| 374 | Ga0209256_1001475 | |||
| 375 | Ga0209256_1003732 | |||
| 376 | Ga0209256_1003816 | |||
| 377 | Ga0209256_1045830 | |||
| 378 | Ga0207426_1003756 | |||
| 379 | Ga0209257_1000223 | |||
| 380 | Ga0209257_1000506 | |||
| 381 | Ga0207705_10765892 | |||
| 382 | Ga0207654_10046613 | |||
| 383 | Ga0207707_10133163 | |||
| 384 | Ga0207695_10430623 | |||
| 385 | Ga0207671_10155875 | |||
| 386 | Ga0207662_10185492 | |||
| 387 | Ga0207657_10537164 | |||
| 388 | Ga0207694_10717942 | |||
| 389 | Ga0207659_10736873 | |||
| 390 | Ga0207669_11244769 | |||
| 391 | Ga0207661_10435721 | |||
| 392 | Ga0207679_11206802 | |||
| 393 | Ga0207678_10700615 | |||
| 394 | Ga0207641_10542132 | |||
| 395 | Ga0207674_11764468 | |||
| 396 | Ga0268266_10887590 | |||
| 397 | Ga0307515_10016038 | |||
| 398 | Ga0307515_10022050 | |||
| 399 | Ga0307515_10059507 | |||
| 400 | Ga0265332_10095990 | |||
| 401 | Ga0265316_10160023 | |||
| 402 | Ga0265316_10507320 | |||
| 403 | Ga0307509_10458974 | |||
| 404 | Ga0307408_100004065 | |||
| 405 | Ga0307413_10216910 | |||
| 406 | Ga0307407_10096441 | |||
| 407 | Ga0307412_11311793 | |||
| 408 | Ga0307409_100432674 | |||
| 409 | Ga0307409_101831464 | |||
| 410 | Ga0307409_102081888 | |||
| 411 | Ga0307416_100129112 | |||
| 412 | Ga0307414_10007852 | |||
| 413 | Ga0307411_10000141 | |||
| 414 | Ga0307411_10059091 | |||
| 415 | Ga0307411_10170656 | |||
| 416 | Ga0395899_0000012 | |||
| 417 | Ga0395905_0000071 | |||
| 418 | Ga0451804_0630534 | |||
| 419 | Ga0451835_0719800 | |||
| 420 | Ga0439432_128931 | |||
| 421 | Ga0450897_039684 | |||
| 422 | Ga0450898_067136 | |||
| 423 | Ga0439446_0025215 | |||
| 424 | Ga0439434_0319194 | |||
| 425 | Ga0439459_0021138 | |||
| 426 | Ga0466969_0003753 | |||
| 427 | Ga0466969_0004754 | |||
| 428 | Ga0466969_0490992 | |||
| 429 | Ga0466972_0278302 | |||
| 430 | Ga0466965_0215110 | |||
| 431 | Ga0466966_0000303 | |||
| 432 | Ga0466966_0052061 | |||
| 433 | Ga0466961_0000482 | |||
| 434 | Ga0466964_0018915 | |||
| 435 | Ga0466971_0001240 | |||
| 436 | Ga0466968_0035120 | |||
| 437 | Ga0466970_0000842 | |||
| 438 | Ga0466970_0378724 | |||
| 439 | Ga0466957_0035011 | |||
| 440 | Ga0466957_0102538 | |||
| 441 | Ga0466959_0005862 | |||
| 442 | Ga0466959_0015139 | |||
| 443 | Ga0466959_0414058 | |||
| 444 | Ga0466958_0105649 | |||
| 445 | Ga0495590_0001877 | |||
| 446 | Ga0495638_0000903 | |||
| 447 | Ga0495638_0010069 | |||
| 448 | Ga0495638_0012696 | |||
| 449 | Ga0495638_0065535 | |||
| 450 | Ga0495638_0066528 | |||
| 451 | Ga0495605_0216763 | |||
| 452 | Ga0495584_0000002 | |||
| 453 | Ga0495585_0036368 | |||
| 454 | Ga0495596_0089209 | |||
| 455 | Ga0495607_0046161 | |||
| 456 | Ga0495583_0000008 | |||
| 457 | Ga0495606_0017850 | |||
| 458 | Ga0495606_0048640 | |||
| 459 | Ga0495606_0060830 | |||
| 460 | Ga0495606_0095735 | |||
| 461 | Ga0495610_0017631 | |||
| 462 | Ga0495610_0093120 | |||
| 463 | Ga0495610_0152715 | |||
| 464 | Ga0495616_0001054 | |||
| 465 | Ga0495616_0001840 | |||
| 466 | Ga0495631_0016244 | |||
| 467 | Ga0495632_0014086 | |||
| 468 | Ga0495632_0026064 | |||
| 469 | Ga0495632_0034959 | |||
| 470 | Ga0495637_0002140 | |||
| 471 | Ga0495637_0025735 | |||
| 472 | Ga0495643_0052865 | |||
| 473 | Ga0495643_0055723 | |||
| 474 | Ga0495644_0025011 | |||
| 475 | Ga0495648_0000176 | |||
| 476 | Ga0495648_0306600 | |||
| 477 | Ga0495666_0280042 | |||
| 478 | Ga0495642_0172619 | |||
| 479 | Ga0495654_0114649 | |||
| 480 | Ga0495587_0067524 | |||
| 481 | Ga0495609_0022398 | |||
| 482 | Ga0495597_0025563 | |||
| 483 | Ga0495597_0061600 | |||
| 484 | Ga0495597_0175499 | |||
| 485 | Ga0495597_0248909 | |||
| 486 | Ga0495645_0693160 | |||
| 487 | Ga0495633_0495819 | |||
| 488 | Ga0495633_0496256 | |||
| 489 | Ga0495668_0001203 | |||
| 490 | Ga0495668_0007240 | |||
| 491 | Ga0495668_0091304 | |||
| 492 | Ga0495625_0000143 | |||
| 493 | Ga0495625_0001739 | |||
| 494 | Ga0495625_0007256 | |||
| 495 | Ga0495625_0156657 | |||
| 496 | Ga0495625_0159778 | |||
| 497 | Ga0495625_0274319 | |||
| 498 | Ga0495625_0302561 | |||
| 499 | Ga0495659_0306091 | |||
| 500 | Ga0495659_0367339 | |||
| 501 | Ga0495659_0530518 | |||
| 502 | Ga0495661_0022755 | |||
| 503 | Ga0495670_0212811 | |||
| 504 | Ga0495671_0252121 | |||
| 505 | Ga0495671_0361071 | |||
| 506 | Ga0495589_0141187 | |||
| 507 | Ga0495660_0013064 | |||
| 508 | Ga0495683_0108721 | |||
| 509 | Ga0495675_0536188 | |||
| 510 | Ga0495677_0006907 | |||
| 511 | Ga0495685_118811 | |||
| 512 | Ga0495673_0000416 | |||
| 513 | Ga0495673_0030394 | |||
| 514 | Ga0495681_0015104 | |||
| 515 | Ga0495686_0001382 | |||
| 516 | Ga0495686_0320763 | |||
| 517 | Ga0495626_0053287 | |||
| 518 | Ga0496102_0826390 | |||
| 519 | Ga0496115_0858889 | |||
| 520 | Ga0496117_0001963 | |||
| 521 | Ga0496118_0002437 | |||
| 522 | Ga0496118_0636958 | |||
| 523 | Ga0496124_0012047 | |||
| 524 | Ga0496125_0102968 | |||
| 525 | Ga0496126_0118279 | |||
| 526 | Ga0496126_0126632 | |||
| 527 | Ga0496126_0281926 | |||
| 528 | Ga0495678_003164 | |||
| 529 | Ga0501033_0008295 | |||
| 530 | Ga0501034_0003706 | |||
| 531 | Ga0501037_0048607 | |||
| 532 | Ga0501038_0923760 | |||
| 533 | Ga0501238_013337 | |||
| 534 | Ga0501262_035541 | |||
| 535 | Ga0501044_0000796 | |||
| 536 | nmdc:mga03683_398908_c1 | |||
| 537 | nmdc:mga0k408_468378_c1 | |||
| 538 | nmdc:mga07m45_878183_c1 | |||
| 539 | Ga0500578_0000389 | |||
| 540 | Ga0500578_0281793 | |||
| 541 | Ga0500643_095326 | |||
| 542 | Ga0500644_0000010 | |||
| 543 | Ga0500646_0349082 | |||
| 544 | Ga0500583_0352434 | |||
| 545 | Ga0500651_0354571 | |||
| 546 | Ga0500641_0037405 | |||
| 547 | Ga0500650_0299482 | |||
| 548 | Ga0500556_0001405 | |||
| 549 | Ga0500556_0085096 | |||
| 550 | Ga0500562_006506 | |||
| 551 | Ga0500572_266937 | |||
| 552 | Ga0500594_0000288 | |||
| 553 | Ga0500597_084092 | |||
| 554 | Ga0500608_000006 | |||
| 555 | Ga0500608_203736 | |||
| 556 | Ga0500618_000071 | |||
| 557 | Ga0500618_039362 | |||
| 558 | Ga0500642_0229961 | |||
| 559 | Ga0500655_002640 | |||
| 560 | Ga0500658_0045005 | |||
| 561 | Ga0500559_0000031 | |||
| 562 | Ga0500559_0002516 | |||
| 563 | Ga0500564_000049 | |||
| 564 | Ga0500564_322173 | |||
| 565 | Ga0500588_0027339 | |||
| 566 | Ga0500588_0048160 | |||
| 567 | Ga0500622_0003337 | |||
| 568 | Ga0500622_0006512 | |||
| 569 | Ga0500622_0011027 | |||
| 570 | Ga0500622_0035340 | |||
| 571 | Ga0500645_001497 | |||
| 572 | Ga0500609_000799 | |||
| 573 | Ga0500656_064297 | |||
| 574 | Ga0500599_059278 | |||
| 575 | Ga0466962_0031079 | |||
| 576 | 2585146253 | |||
| 577 | 2585155375 | |||
| 578 | 2585198939 | |||
| 579 | 2587919581 | |||
| 580 | 2643748246 | |||
| 581 | 2643779061 | |||
| 582 | 2643926213 | |||
| 583 | 2643927628 | |||
| 584 | 2644226486 | |||
| 585 | 2644235974 | |||
| 586 | 2644508303 | |||
| 587 | 2792459469 | |||
| 588 | 2819539568 | |||
| 589 | 2819648776 | |||
| 590 | 2843747193 | |||
| 591 | 2849560731 | |||
| 592 | 2849574252 | |||
| 593 | 2851158122 | |||
| 594 | 2857506801 | |||
| 595 | 2898330969 | |||
| 596 | 2928534004 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hhn-assembly1.cif.gz_A-2 | crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila | 0.9402 | 1 | 104 |
| 6hhn-assembly1.cif.gz_A-2 | crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila | 0.9312 | 1 | 104 |
| 1x8d-assembly2.cif.gz_D | crystal structure of e. coli yiil protein containing l-rhamnose | 0.9251 | 1 | 104 |
| 2qlw-assembly1.cif.gz_A | crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum | 0.922 | 2 | 104 |
| 2qlw-assembly1.cif.gz_A | crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum | 0.9056 | 2 | 104 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1x8dD01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9261 | 1 | 97 | 3.30.70.100 |
| 1x8dD01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9171 | 1 | 97 | 3.30.70.100 |
| 2qlxB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9064 | 2 | 97 | 3.30.70.100 |
| 2qlxB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8621 | 2 | 97 | 3.30.70.100 |
| af_Q9HDU7_108_202_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8 | 1 | 86 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H6VP17-F1-model_v4 | L-rhamnose mutarotase (EC 5.1.3.32) (Rhamnose 1-epimerase) (Type-3 mutarotase) | 0.966 | 1 | 104 |
GO:0005737
GO:0019301 GO:0062192 |
| AF-A0A286FEJ6-F1-model_v4 | L-rhamnose mutarotase (EC 5.1.3.32) | 0.9647 | 2 | 104 |
GO:0005737
GO:0016857 GO:0019301 |
| AF-B9TP76-F1-model_v4 | L-rhamnose mutarotase | 0.9629 | 2 | 104 |
GO:0005737
GO:0016857 GO:0019301 |
| AF-A0A2U0XV16-F1-model_v4 | deleted | 0.9625 | 1 | 104 |
|
| AF-A0A7U3ZIJ2-F1-model_v4 | L-rhamnose mutarotase (EC 5.1.3.32) | 0.9625 | 2 | 104 |
GO:0005737
GO:0016857 GO:0019301 |