F394435

General Info

Members Datasets Scaffolds Average Seq Length
298 216 596 104

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0192906|Ga0495638_0192906_554_904
Length 116
Sequence MSTQMGSTPTESRPLAFRMQLKPGVAAEYERRHDELWPDLAEALRNAGIHDYSIFLDEETMSLFAVLRLRPDHNKDALPLQPVMKRWWDYMADLMEVHPDNKPVEWPLKPVFYFEG

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
92 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
93 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
94 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
95 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
164 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
173 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
174 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
175 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
176 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
179 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
180 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
181 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
182 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
183 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
184 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
185 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
186 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
187 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
188 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
191 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
192 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
193 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
194 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
197 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
198 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
199 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
200 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
201 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
202 2643221583 Caulobacter sp. Root655 Isolate Unclassified
203 2643221584 Caulobacter sp. Root656 Isolate Unclassified
204 2643221640 Caulobacter sp. Root342 Isolate Unclassified
205 2643221642 Caulobacter sp. Root343 Isolate Unclassified
206 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
207 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
208 2818991435 Caulobacter henricii 536 Isolate Unclassified
209 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
210 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
211 2849560528 Caulobacter zeae 410 Isolate Unclassified
212 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
213 2851153111 Caulobacter radicis 736 Isolate Unclassified
214 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
215 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
216 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.95
Metatranscriptomes 0
Isolates 7.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.52
Nodule 0
Rhizoplane 1.01
Rhizosphere 62.42
Stem 0
Stem Tuber 0
Unclassified 3.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0192906 3300046460 Bacteria 1155
2 JGI25159J45721_1008424 3300002987 Bacteria 2831
3 rootL2_10059714 3300003322 Bacteria 3325
4 JGI25161J50226_1018642 3300003374 Bacteria 718
5 Ga0055537_1000076 3300003773 Bacteria 70798
6 Ga0055537_1000260 3300003773 Bacteria 38657
7 Ga0055524_1019935 3300003775 Bacteria 2276
8 Ga0055536_1003677 3300003781 Bacteria 8154
9 Ga0055536_1004268 3300003781 Bacteria 7374
10 Ga0055534_1000124 3300003784 Bacteria 57565
11 Ga0055528_1000184 3300003790 Bacteria 52910
12 Ga0055530_10002644 3300003791 Bacteria 11209
13 Ga0055530_10005916 3300003791 Bacteria 5641
14 Ga0055530_10071745 3300003791 Bacteria 745
15 Ga0055531_10000743 3300003794 Bacteria 27461
16 Ga0055531_10001300 3300003794 Bacteria 18805
17 Ga0055531_10046624 3300003794 Bacteria 1189
18 Ga0055543_1004162 3300004625 Bacteria 4017
19 Ga0065165_1000003 3300005262 Bacteria 390701
20 Ga0065165_1000906 3300005262 Bacteria 38225
21 Ga0070677_10332421 3300005333 Bacteria 782
22 Ga0070675_101056790 3300005354 Bacteria 746
23 Ga0070659_100956480 3300005366 Bacteria 750
24 Ga0070667_100407442 3300005367 Bacteria 1238
25 Ga0070713_101787274 3300005436 Bacteria 597
26 Ga0070662_100541745 3300005457 Bacteria 974
27 Ga0070685_10034006 3300005466 Bacteria 2869
28 Ga0070679_100418840 3300005530 Bacteria 1285
29 Ga0070684_101419330 3300005535 Bacteria 654
30 Ga0068853_100523465 3300005539 Bacteria 1121
31 Ga0070665_100513504 3300005548 Bacteria 1210
32 Ga0070664_100568771 3300005564 Bacteria 1049
33 Ga0068857_101272580 3300005577 Bacteria 713
34 Ga0068852_101623694 3300005616 Bacteria 669
35 Ga0068864_101199651 3300005618 Bacteria 757
36 Ga0075362_10124353 3300006177 Bacteria 1223
37 Ga0075366_10053242 3300006195 Bacteria 2404
38 Ga0075366_10584817 3300006195 Bacteria 692
39 Ga0105240_12792996 3300009093 Bacteria 502
40 Ga0105241_10089606 3300009174 Bacteria 2424
41 Ga0105237_10703569 3300009545 Bacteria 1017
42 Ga0105237_11264410 3300009545 Unclassified 744
43 Ga0105238_10010174 3300009551 Bacteria 9434
44 Ga0105239_11180562 3300010375 Bacteria 882
45 Ga0157347_1006291 3300012502 Bacteria 1158
46 Ga0157373_11537023 3300013100 Unclassified 509
47 Ga0157371_10085562 3300013102 Bacteria 2233
48 Ga0157371_10557496 3300013102 Unclassified 850
49 Ga0157370_10035177 3300013104 Bacteria 4871
50 Ga0157369_10186838 3300013105 Bacteria 2179
51 Ga0157369_12399258 3300013105 Bacteria 534
52 Ga0157378_10489283 3300013297 Bacteria 1227
53 Ga0157372_10505562 3300013307 Bacteria 1409
54 Ga0157372_11275366 3300013307 Bacteria 848
55 Ga0157375_10225527 3300013308 Bacteria 2033
56 Ga0157380_10538129 3300014326 Bacteria 1143
57 Ga0182008_10371916 3300014497 Bacteria 762
58 Ga0157379_10540196 3300014968 Bacteria 1084
59 Ga0157376_11524088 3300014969 Bacteria 702
60 Ga0163161_11202656 3300017792 Bacteria 655
61 Ga0209436_111549 3300025208 Bacteria 1545
62 Ga0209436_111557 3300025208 Bacteria 1544
63 Ga0209565_1000018 3300025263 Bacteria 460940
64 Ga0209673_1000006 3300025273 Bacteria 650600
65 Ga0209130_1000036 3300025284 Bacteria 284111
66 Ga0209130_1013336 3300025284 Bacteria 2108
67 Ga0209675_1000005 3300025291 Bacteria 849192
68 Ga0209675_1002720 3300025291 Bacteria 8856
69 Ga0209676_1001012 3300025292 Bacteria 32874
70 Ga0209564_1000144 3300025295 Bacteria 175328
71 Ga0209564_1002536 3300025295 Bacteria 14094
72 Ga0209564_1019060 3300025295 Bacteria 2582
73 Ga0209758_1000835 3300025297 Bacteria 42973
74 Ga0209050_1000633 3300025298 Bacteria 54643
75 Ga0209050_1021138 3300025298 Bacteria 2386
76 Ga0209256_1001475 3300025299 Bacteria 24067
77 Ga0209256_1003732 3300025299 Bacteria 10307
78 Ga0209256_1003816 3300025299 Bacteria 10095
79 Ga0209256_1045830 3300025299 Bacteria 1085
80 Ga0207426_1003756 3300025302 Bacteria 7920
81 Ga0209257_1000223 3300025304 Bacteria 134337
82 Ga0209257_1000506 3300025304 Bacteria 68402
83 Ga0207705_10765892 3300025909 Bacteria 750
84 Ga0207654_10046613 3300025911 Bacteria 2472
85 Ga0207707_10133163 3300025912 Bacteria 2174
86 Ga0207695_10430623 3300025913 Unclassified 1203
87 Ga0207671_10155875 3300025914 Bacteria 1766
88 Ga0207662_10185492 3300025918 Bacteria 1340
89 Ga0207657_10537164 3300025919 Bacteria 915
90 Ga0207694_10717942 3300025924 Bacteria 843
91 Ga0207659_10736873 3300025926 Bacteria 845
92 Ga0207669_11244769 3300025937 Bacteria 631
93 Ga0207661_10435721 3300025944 Bacteria 1192
94 Ga0207679_11206802 3300025945 Bacteria 694
95 Ga0207678_10700615 3300026067 Bacteria 891
96 Ga0207641_10542132 3300026088 Bacteria 1134
97 Ga0207674_11764468 3300026116 Bacteria 586
98 Ga0268266_10887590 3300028379 Bacteria 862
99 Ga0307515_10016038 3300028794 Bacteria 13751
100 Ga0307515_10022050 3300028794 Bacteria 11249
101 Ga0307515_10059507 3300028794 Bacteria 5472
102 Ga0265332_10095990 3300031238 Bacteria 1252
103 Ga0265316_10160023 3300031344 Bacteria 1684
104 Ga0265316_10507320 3300031344 Bacteria 861
105 Ga0307509_10458974 3300031507 Unclassified 966
106 Ga0307408_100004065 3300031548 Bacteria 9975
107 Ga0307413_10216910 3300031824 Bacteria 1394
108 Ga0307407_10096441 3300031903 Bacteria 1825
109 Ga0307412_11311793 3300031911 Bacteria 652
110 Ga0307409_100432674 3300031995 Bacteria 1265
111 Ga0307409_101831464 3300031995 Bacteria 636
112 Ga0307409_102081888 3300031995 Unclassified 597
113 Ga0307416_100129112 3300032002 Bacteria 2271
114 Ga0307414_10007852 3300032004 Bacteria 6017
115 Ga0307411_10000141 3300032005 Bacteria 22602
116 Ga0307411_10059091 3300032005 Bacteria 2540
117 Ga0307411_10170656 3300032005 Bacteria 1640
118 Ga0395899_0000012 3300037312 Bacteria 517561
119 Ga0395905_0000071 3300037471 Bacteria 174580
120 Ga0451804_0630534 3300041463 Bacteria 526
121 Ga0451835_0719800 3300041492 Bacteria 572
122 Ga0439432_128931 3300042006 Bacteria 747
123 Ga0450897_039684 3300042128 Bacteria 552
124 Ga0450898_067136 3300042134 Bacteria 713
125 Ga0439446_0025215 3300042156 Bacteria 1699
126 Ga0439434_0319194 3300042435 Bacteria 539
127 Ga0439459_0021138 3300042438 Bacteria 1247
128 Ga0466969_0003753 3300044656 Bacteria 8071
129 Ga0466969_0004754 3300044656 Bacteria 7226
130 Ga0466969_0490992 3300044656 Bacteria 560
131 Ga0466972_0278302 3300044658 Bacteria 782
132 Ga0466965_0215110 3300044683 Bacteria 1023
133 Ga0466966_0000303 3300044684 Bacteria 32389
134 Ga0466966_0052061 3300044684 Unclassified 2602
135 Ga0466961_0000482 3300044693 Bacteria 25345
136 Ga0466964_0018915 3300044706 Bacteria 2645
137 Ga0466971_0001240 3300044719 Bacteria 10615
138 Ga0466968_0035120 3300044735 Bacteria 2096
139 Ga0466970_0000842 3300044765 Bacteria 14765
140 Ga0466970_0378724 3300044765 Unclassified 805
141 Ga0466957_0035011 3300044842 Bacteria 3013
142 Ga0466957_0102538 3300044842 Bacteria 1805
143 Ga0466959_0005862 3300045049 Bacteria 8458
144 Ga0466959_0015139 3300045049 Bacteria 5617
145 Ga0466959_0414058 3300045049 Unclassified 915
146 Ga0466958_0105649 3300045836 Bacteria 1755
147 Ga0495590_0001877 3300046457 Bacteria 8887
148 Ga0495638_0000903 3300046460 Bacteria 30346
149 Ga0495638_0010069 3300046460 Bacteria 6590
150 Ga0495638_0012696 3300046460 Bacteria 5761
151 Ga0495638_0065535 3300046460 Bacteria 2235
152 Ga0495638_0066528 3300046460 Bacteria 2215
153 Ga0495605_0216763 3300046474 Bacteria 828
154 Ga0495584_0000002 3300046491 Bacteria 512179
155 Ga0495585_0036368 3300046492 Bacteria 2778
156 Ga0495596_0089209 3300046500 Bacteria 1196
157 Ga0495607_0046161 3300046501 Bacteria 2560
158 Ga0495583_0000008 3300046506 Bacteria 411092
159 Ga0495606_0017850 3300046507 Bacteria 5344
160 Ga0495606_0048640 3300046507 Bacteria 2787
161 Ga0495606_0060830 3300046507 Bacteria 2417
162 Ga0495606_0095735 3300046507 Bacteria 1817
163 Ga0495610_0017631 3300046512 Bacteria 4064
164 Ga0495610_0093120 3300046512 Bacteria 1362
165 Ga0495610_0152715 3300046512 Bacteria 983
166 Ga0495616_0001054 3300046513 Bacteria 19705
167 Ga0495616_0001840 3300046513 Bacteria 14361
168 Ga0495631_0016244 3300046518 Bacteria 3554
169 Ga0495632_0014086 3300046519 Bacteria 4537
170 Ga0495632_0026064 3300046519 Bacteria 3082
171 Ga0495632_0034959 3300046519 Bacteria 2568
172 Ga0495637_0002140 3300046520 Bacteria 11072
173 Ga0495637_0025735 3300046520 Bacteria 2649
174 Ga0495643_0052865 3300046522 Bacteria 2180
175 Ga0495643_0055723 3300046522 Bacteria 2112
176 Ga0495644_0025011 3300046523 Bacteria 2269
177 Ga0495648_0000176 3300046524 Bacteria 73832
178 Ga0495648_0306600 3300046524 Bacteria 741
179 Ga0495666_0280042 3300046526 Bacteria 756
180 Ga0495642_0172619 3300046528 Bacteria 939
181 Ga0495654_0114649 3300046530 Bacteria 1226
182 Ga0495587_0067524 3300046536 Bacteria 2084
183 Ga0495609_0022398 3300046538 Bacteria 2910
184 Ga0495597_0025563 3300046542 Bacteria 2717
185 Ga0495597_0061600 3300046542 Bacteria 1634
186 Ga0495597_0175499 3300046542 Bacteria 868
187 Ga0495597_0248909 3300046542 Bacteria 699
188 Ga0495645_0693160 3300046543 Bacteria 619
189 Ga0495633_0495819 3300046558 Bacteria 551
190 Ga0495633_0496256 3300046558 Bacteria 550
191 Ga0495668_0001203 3300046616 Bacteria 26299
192 Ga0495668_0007240 3300046616 Bacteria 7119
193 Ga0495668_0091304 3300046616 Bacteria 1668
194 Ga0495625_0000143 3300046660 Bacteria 110121
195 Ga0495625_0001739 3300046660 Bacteria 25182
196 Ga0495625_0007256 3300046660 Bacteria 9694
197 Ga0495625_0156657 3300046660 Bacteria 1528
198 Ga0495625_0159778 3300046660 Bacteria 1510
199 Ga0495625_0274319 3300046660 Bacteria 1087
200 Ga0495625_0302561 3300046660 Bacteria 1023
201 Ga0495659_0306091 3300046664 Bacteria 672
202 Ga0495659_0367339 3300046664 Bacteria 617
203 Ga0495659_0530518 3300046664 Bacteria 518
204 Ga0495661_0022755 3300046665 Bacteria 4074
205 Ga0495670_0212811 3300046691 Bacteria 1025
206 Ga0495671_0252121 3300046692 Bacteria 852
207 Ga0495671_0361071 3300046692 Bacteria 696
208 Ga0495589_0141187 3300046794 Bacteria 1153
209 Ga0495660_0013064 3300046810 Bacteria 4813
210 Ga0495683_0108721 3300047323 Bacteria 1325
211 Ga0495675_0536188 3300047444 Bacteria 669
212 Ga0495677_0006907 3300047445 Bacteria 4266
213 Ga0495685_118811 3300047447 Bacteria 868
214 Ga0495673_0000416 3300047469 Bacteria 49348
215 Ga0495673_0030394 3300047469 Bacteria 2536
216 Ga0495681_0015104 3300047470 Bacteria 4383
217 Ga0495686_0001382 3300047472 Bacteria 26955
218 Ga0495686_0320763 3300047472 Bacteria 849
219 Ga0495626_0053287 3300048091 Bacteria 1862
220 Ga0496102_0826390 3300048905 Bacteria 849
221 Ga0496115_0858889 3300048918 Bacteria 702
222 Ga0496117_0001963 3300048920 Bacteria 27350
223 Ga0496118_0002437 3300048921 Bacteria 25046
224 Ga0496118_0636958 3300048921 Bacteria 504
225 Ga0496124_0012047 3300048927 Bacteria 8591
226 Ga0496125_0102968 3300048928 Bacteria 2096
227 Ga0496126_0118279 3300048929 Bacteria 2301
228 Ga0496126_0126632 3300048929 Bacteria 2210
229 Ga0496126_0281926 3300048929 Bacteria 1376
230 Ga0495678_003164 3300049459 Bacteria 10386
231 Ga0501033_0008295 3300049570 Bacteria 8047
232 Ga0501034_0003706 3300049571 Bacteria 17261
233 Ga0501037_0048607 3300049573 Bacteria 3107
234 Ga0501038_0923760 3300049574 Bacteria 643
235 Ga0501238_013337 3300049671 Bacteria 1118
236 Ga0501262_035541 3300049759 Bacteria 730
237 Ga0501044_0000796 3300049823 Bacteria 38157
238 nmdc:mga03683_398908_c1 3300050489 Bacteria 656
239 nmdc:mga0k408_468378_c1 3300050493 Bacteria 748
240 nmdc:mga07m45_878183_c1 3300050496 Bacteria 513
241 Ga0500578_0000389 3300053086 Bacteria 53879
242 Ga0500578_0281793 3300053086 Bacteria 991
243 Ga0500643_095326 3300053087 Bacteria 809
244 Ga0500644_0000010 3300053088 Bacteria 127225
245 Ga0500646_0349082 3300053090 Bacteria 539
246 Ga0500583_0352434 3300053092 Unclassified 713
247 Ga0500651_0354571 3300053093 Bacteria 832
248 Ga0500641_0037405 3300053096 Bacteria 1946
249 Ga0500650_0299482 3300053098 Bacteria 712
250 Ga0500556_0001405 3300053104 Bacteria 10468
251 Ga0500556_0085096 3300053104 Bacteria 1201
252 Ga0500562_006506 3300053108 Bacteria 2943
253 Ga0500572_266937 3300053111 Bacteria 555
254 Ga0500594_0000288 3300053118 Bacteria 11527
255 Ga0500597_084092 3300053120 Bacteria 1381
256 Ga0500608_000006 3300053122 Bacteria 102722
257 Ga0500608_203736 3300053122 Bacteria 815
258 Ga0500618_000071 3300053125 Bacteria 85596
259 Ga0500618_039362 3300053125 Bacteria 1089
260 Ga0500642_0229961 3300053130 Bacteria 857
261 Ga0500655_002640 3300053133 Bacteria 3247
262 Ga0500658_0045005 3300053134 Bacteria 1783
263 Ga0500559_0000031 3300053136 Bacteria 114782
264 Ga0500559_0002516 3300053136 Bacteria 9415
265 Ga0500564_000049 3300053138 Bacteria 30793
266 Ga0500564_322173 3300053138 Bacteria 585
267 Ga0500588_0027339 3300053146 Bacteria 1606
268 Ga0500588_0048160 3300053146 Bacteria 1317
269 Ga0500622_0003337 3300053156 Bacteria 10824
270 Ga0500622_0006512 3300053156 Bacteria 6753
271 Ga0500622_0011027 3300053156 Bacteria 4932
272 Ga0500622_0035340 3300053156 Bacteria 2615
273 Ga0500645_001497 3300053730 Bacteria 11708
274 Ga0500609_000799 3300053731 Bacteria 4723
275 Ga0500656_064297 3300053732 Bacteria 555
276 Ga0500599_059278 3300053736 Bacteria 620
277 Ga0466962_0031079 3300061719 Bacteria 2556
278 2585146253 2582581279 Bacteria 4980720
279 2585155375 2582581280 Bacteria 5994497
280 2585198939 2582581293 Bacteria 5907401
281 2587919581 2585428106 Bacteria 5179711
282 2643748246 2643221545 Bacteria 5083237
283 2643779061 2643221552 Bacteria 5708754
284 2643926213 2643221583 Bacteria 5218014
285 2643927628 2643221584 Bacteria 5511711
286 2644226486 2643221640 Bacteria 5258820
287 2644235974 2643221642 Bacteria 5357871
288 2644508303 2643221691 Bacteria 5093099
289 2792459469 2791355048 Bacteria 5832535
290 2819539568 2818991435 Bacteria 5433759
291 2819648776 2818991454 Bacteria 5563326
292 2843747193 2843744320 Bacteria 5659202
293 2849560731 2849560528 Bacteria 5393480
294 2849574252 2849573788 Bacteria 5421256
295 2851158122 2851153111 Bacteria 5542585
296 2857506801 2857504554 Bacteria 5369913
297 2898330969 2898329390 Bacteria 5168154
298 2928534004 2928531327 Bacteria 5101314
299 Ga0495638_0192906
300 JGI25159J45721_1008424
301 rootL2_10059714
302 JGI25161J50226_1018642
303 Ga0055537_1000076
304 Ga0055537_1000260
305 Ga0055524_1019935
306 Ga0055536_1003677
307 Ga0055536_1004268
308 Ga0055534_1000124
309 Ga0055528_1000184
310 Ga0055530_10002644
311 Ga0055530_10005916
312 Ga0055530_10071745
313 Ga0055531_10000743
314 Ga0055531_10001300
315 Ga0055531_10046624
316 Ga0055543_1004162
317 Ga0065165_1000003
318 Ga0065165_1000906
319 Ga0070677_10332421
320 Ga0070675_101056790
321 Ga0070659_100956480
322 Ga0070667_100407442
323 Ga0070713_101787274
324 Ga0070662_100541745
325 Ga0070685_10034006
326 Ga0070679_100418840
327 Ga0070684_101419330
328 Ga0068853_100523465
329 Ga0070665_100513504
330 Ga0070664_100568771
331 Ga0068857_101272580
332 Ga0068852_101623694
333 Ga0068864_101199651
334 Ga0075362_10124353
335 Ga0075366_10053242
336 Ga0075366_10584817
337 Ga0105240_12792996
338 Ga0105241_10089606
339 Ga0105237_10703569
340 Ga0105237_11264410
341 Ga0105238_10010174
342 Ga0105239_11180562
343 Ga0157347_1006291
344 Ga0157373_11537023
345 Ga0157371_10085562
346 Ga0157371_10557496
347 Ga0157370_10035177
348 Ga0157369_10186838
349 Ga0157369_12399258
350 Ga0157378_10489283
351 Ga0157372_10505562
352 Ga0157372_11275366
353 Ga0157375_10225527
354 Ga0157380_10538129
355 Ga0182008_10371916
356 Ga0157379_10540196
357 Ga0157376_11524088
358 Ga0163161_11202656
359 Ga0209436_111549
360 Ga0209436_111557
361 Ga0209565_1000018
362 Ga0209673_1000006
363 Ga0209130_1000036
364 Ga0209130_1013336
365 Ga0209675_1000005
366 Ga0209675_1002720
367 Ga0209676_1001012
368 Ga0209564_1000144
369 Ga0209564_1002536
370 Ga0209564_1019060
371 Ga0209758_1000835
372 Ga0209050_1000633
373 Ga0209050_1021138
374 Ga0209256_1001475
375 Ga0209256_1003732
376 Ga0209256_1003816
377 Ga0209256_1045830
378 Ga0207426_1003756
379 Ga0209257_1000223
380 Ga0209257_1000506
381 Ga0207705_10765892
382 Ga0207654_10046613
383 Ga0207707_10133163
384 Ga0207695_10430623
385 Ga0207671_10155875
386 Ga0207662_10185492
387 Ga0207657_10537164
388 Ga0207694_10717942
389 Ga0207659_10736873
390 Ga0207669_11244769
391 Ga0207661_10435721
392 Ga0207679_11206802
393 Ga0207678_10700615
394 Ga0207641_10542132
395 Ga0207674_11764468
396 Ga0268266_10887590
397 Ga0307515_10016038
398 Ga0307515_10022050
399 Ga0307515_10059507
400 Ga0265332_10095990
401 Ga0265316_10160023
402 Ga0265316_10507320
403 Ga0307509_10458974
404 Ga0307408_100004065
405 Ga0307413_10216910
406 Ga0307407_10096441
407 Ga0307412_11311793
408 Ga0307409_100432674
409 Ga0307409_101831464
410 Ga0307409_102081888
411 Ga0307416_100129112
412 Ga0307414_10007852
413 Ga0307411_10000141
414 Ga0307411_10059091
415 Ga0307411_10170656
416 Ga0395899_0000012
417 Ga0395905_0000071
418 Ga0451804_0630534
419 Ga0451835_0719800
420 Ga0439432_128931
421 Ga0450897_039684
422 Ga0450898_067136
423 Ga0439446_0025215
424 Ga0439434_0319194
425 Ga0439459_0021138
426 Ga0466969_0003753
427 Ga0466969_0004754
428 Ga0466969_0490992
429 Ga0466972_0278302
430 Ga0466965_0215110
431 Ga0466966_0000303
432 Ga0466966_0052061
433 Ga0466961_0000482
434 Ga0466964_0018915
435 Ga0466971_0001240
436 Ga0466968_0035120
437 Ga0466970_0000842
438 Ga0466970_0378724
439 Ga0466957_0035011
440 Ga0466957_0102538
441 Ga0466959_0005862
442 Ga0466959_0015139
443 Ga0466959_0414058
444 Ga0466958_0105649
445 Ga0495590_0001877
446 Ga0495638_0000903
447 Ga0495638_0010069
448 Ga0495638_0012696
449 Ga0495638_0065535
450 Ga0495638_0066528
451 Ga0495605_0216763
452 Ga0495584_0000002
453 Ga0495585_0036368
454 Ga0495596_0089209
455 Ga0495607_0046161
456 Ga0495583_0000008
457 Ga0495606_0017850
458 Ga0495606_0048640
459 Ga0495606_0060830
460 Ga0495606_0095735
461 Ga0495610_0017631
462 Ga0495610_0093120
463 Ga0495610_0152715
464 Ga0495616_0001054
465 Ga0495616_0001840
466 Ga0495631_0016244
467 Ga0495632_0014086
468 Ga0495632_0026064
469 Ga0495632_0034959
470 Ga0495637_0002140
471 Ga0495637_0025735
472 Ga0495643_0052865
473 Ga0495643_0055723
474 Ga0495644_0025011
475 Ga0495648_0000176
476 Ga0495648_0306600
477 Ga0495666_0280042
478 Ga0495642_0172619
479 Ga0495654_0114649
480 Ga0495587_0067524
481 Ga0495609_0022398
482 Ga0495597_0025563
483 Ga0495597_0061600
484 Ga0495597_0175499
485 Ga0495597_0248909
486 Ga0495645_0693160
487 Ga0495633_0495819
488 Ga0495633_0496256
489 Ga0495668_0001203
490 Ga0495668_0007240
491 Ga0495668_0091304
492 Ga0495625_0000143
493 Ga0495625_0001739
494 Ga0495625_0007256
495 Ga0495625_0156657
496 Ga0495625_0159778
497 Ga0495625_0274319
498 Ga0495625_0302561
499 Ga0495659_0306091
500 Ga0495659_0367339
501 Ga0495659_0530518
502 Ga0495661_0022755
503 Ga0495670_0212811
504 Ga0495671_0252121
505 Ga0495671_0361071
506 Ga0495589_0141187
507 Ga0495660_0013064
508 Ga0495683_0108721
509 Ga0495675_0536188
510 Ga0495677_0006907
511 Ga0495685_118811
512 Ga0495673_0000416
513 Ga0495673_0030394
514 Ga0495681_0015104
515 Ga0495686_0001382
516 Ga0495686_0320763
517 Ga0495626_0053287
518 Ga0496102_0826390
519 Ga0496115_0858889
520 Ga0496117_0001963
521 Ga0496118_0002437
522 Ga0496118_0636958
523 Ga0496124_0012047
524 Ga0496125_0102968
525 Ga0496126_0118279
526 Ga0496126_0126632
527 Ga0496126_0281926
528 Ga0495678_003164
529 Ga0501033_0008295
530 Ga0501034_0003706
531 Ga0501037_0048607
532 Ga0501038_0923760
533 Ga0501238_013337
534 Ga0501262_035541
535 Ga0501044_0000796
536 nmdc:mga03683_398908_c1
537 nmdc:mga0k408_468378_c1
538 nmdc:mga07m45_878183_c1
539 Ga0500578_0000389
540 Ga0500578_0281793
541 Ga0500643_095326
542 Ga0500644_0000010
543 Ga0500646_0349082
544 Ga0500583_0352434
545 Ga0500651_0354571
546 Ga0500641_0037405
547 Ga0500650_0299482
548 Ga0500556_0001405
549 Ga0500556_0085096
550 Ga0500562_006506
551 Ga0500572_266937
552 Ga0500594_0000288
553 Ga0500597_084092
554 Ga0500608_000006
555 Ga0500608_203736
556 Ga0500618_000071
557 Ga0500618_039362
558 Ga0500642_0229961
559 Ga0500655_002640
560 Ga0500658_0045005
561 Ga0500559_0000031
562 Ga0500559_0002516
563 Ga0500564_000049
564 Ga0500564_322173
565 Ga0500588_0027339
566 Ga0500588_0048160
567 Ga0500622_0003337
568 Ga0500622_0006512
569 Ga0500622_0011027
570 Ga0500622_0035340
571 Ga0500645_001497
572 Ga0500609_000799
573 Ga0500656_064297
574 Ga0500599_059278
575 Ga0466962_0031079
576 2585146253
577 2585155375
578 2585198939
579 2587919581
580 2643748246
581 2643779061
582 2643926213
583 2643927628
584 2644226486
585 2644235974
586 2644508303
587 2792459469
588 2819539568
589 2819648776
590 2843747193
591 2849560731
592 2849574252
593 2851158122
594 2857506801
595 2898330969
596 2928534004

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

14

114

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.9402 1 104
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.9312 1 104
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.9251 1 104
2qlw-assembly1.cif.gz_A crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum 0.922 2 104
2qlw-assembly1.cif.gz_A crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum 0.9056 2 104
ID Description Score Start End Superfamily
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9261 1 97 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9171 1 97 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9064 2 97 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8621 2 97 3.30.70.100
af_Q9HDU7_108_202_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8 1 86 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1H6VP17-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) (Rhamnose 1-epimerase) (Type-3 mutarotase) 0.966 1 104 GO:0005737
GO:0019301
GO:0062192
AF-A0A286FEJ6-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.9647 2 104 GO:0005737
GO:0016857
GO:0019301
AF-B9TP76-F1-model_v4 L-rhamnose mutarotase 0.9629 2 104 GO:0005737
GO:0016857
GO:0019301
AF-A0A2U0XV16-F1-model_v4 deleted 0.9625 1 104
AF-A0A7U3ZIJ2-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.9625 2 104 GO:0005737
GO:0016857
GO:0019301

Map