F394440

General Info

Members Datasets Scaffolds Average Seq Length
298 175 596 267

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0000067|Ga0495605_0000067_20759_21748
Length 329
Sequence MRCVRLDRSGWIWGRFAAHRLQARLSRLRQKRSFGAATLSQAPSHHGLSSFIPSARSFTIKERSDRNIDLTGKTALVTGSTLGIGYAIAKGLAGTGAQVIVNGRKQEAVDAAVANIQREVPNAKVRGVATDVGSASGCEELVAAVPNVDILINNVGIYGPQDFFETPDDVWQRFFDVNIMSGIRLSRAYAQAMAQRGWGRIVFISSESALNIPADMIHYGFTKTSNLSVSRGLAKRMAGTGVTVNAVLPGPTLSEGVAEMLKDEVAKTGKSLEDAAADFVMAHRPSSIIQRAASIEEVANMVVYVSSKQASATTGAALRVDGGVVDTIA

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
49 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
76 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
100 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
169 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
172 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
173 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
174 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
175 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.11
Nodule 0.67
Rhizoplane 3.02
Rhizosphere 72.48
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0000067 3300046474 Bacteria 138871
2 JGI25151J46595_10000235 3300003187 Bacteria 65683
3 rootH1_10141797 3300003316 Bacteria 2794
4 rootH1_10034663 3300003323 Bacteria 4736
5 Ga0055532_1000689 3300003758 Bacteria 12747
6 Ga0055527_1000219 3300003760 Bacteria 37189
7 Ga0055535_1000464 3300003761 Bacteria 37189
8 Ga0055535_1000514 3300003761 Bacteria 33751
9 Ga0055542_1000535 3300003762 Bacteria 33751
10 Ga0055542_1000836 3300003762 Bacteria 21873
11 Ga0055529_1000131 3300003763 Bacteria 105530
12 Ga0055529_1004608 3300003763 Bacteria 2078
13 Ga0055524_1000139 3300003775 Bacteria 86430
14 Ga0055528_1016021 3300003790 Bacteria 2674
15 Ga0055530_10001272 3300003791 Bacteria 19049
16 Ga0055540_1000090 3300003792 Bacteria 99454
17 Ga0055540_1000091 3300003792 Bacteria 99089
18 Ga0065165_1031373 3300005262 Bacteria 1680
19 Ga0070677_10025338 3300005333 Bacteria 2214
20 Ga0070674_100090857 3300005356 Bacteria 2203
21 Ga0070659_100000064 3300005366 Bacteria 83862
22 Ga0070714_100274783 3300005435 Bacteria 1563
23 Ga0070663_100000667 3300005455 Bacteria 18469
24 Ga0070663_100387263 3300005455 Bacteria 1140
25 Ga0070678_100037120 3300005456 Bacteria 3418
26 Ga0070679_100600166 3300005530 Bacteria 1044
27 Ga0068855_100056681 3300005563 Bacteria 4596
28 Ga0068857_100168636 3300005577 Bacteria 1989
29 Ga0068852_100088440 3300005616 Bacteria 2767
30 Ga0068859_100708379 3300005617 Bacteria 1097
31 Ga0070717_10145779 3300006028 Bacteria 2045
32 Ga0075362_10012390 3300006177 Bacteria 3386
33 Ga0075366_10082204 3300006195 Bacteria 1924
34 Ga0097620_100708400 3300006931 Bacteria 1097
35 Ga0079104_1000916 3300006946 Bacteria 23741
36 Ga0105251_10000179 3300009011 Bacteria 63707
37 Ga0105251_10046168 3300009011 Bacteria 2097
38 Ga0105250_10000097 3300009092 Bacteria 78303
39 Ga0105240_10004587 3300009093 Bacteria 20940
40 Ga0105240_10024228 3300009093 Bacteria 8008
41 Ga0111539_10353711 3300009094 Bacteria 1710
42 Ga0105243_10687608 3300009148 Bacteria 996
43 Ga0105237_10018313 3300009545 Bacteria 7247
44 Ga0105238_10012130 3300009551 Bacteria 8685
45 Ga0105239_10443869 3300010375 Bacteria 1471
46 Ga0157373_10042127 3300013100 Bacteria 3263
47 Ga0157370_10102459 3300013104 Bacteria 2680
48 Ga0157369_10331508 3300013105 Bacteria 1581
49 Ga0157369_10352450 3300013105 Bacteria 1528
50 Ga0209566_100145 3300025225 Bacteria 83624
51 Ga0209674_101475 3300025226 Bacteria 6141
52 Ga0209672_100015 3300025228 Bacteria 529352
53 Ga0209672_100031 3300025228 Bacteria 332889
54 Ga0209147_100016 3300025229 Bacteria 527606
55 Ga0209147_100034 3300025229 Bacteria 346646
56 Ga0209147_100040 3300025229 Bacteria 307612
57 Ga0209258_100026 3300025242 Bacteria 527606
58 Ga0209258_100061 3300025242 Bacteria 313501
59 Ga0209148_1000070 3300025254 Bacteria 332889
60 Ga0209148_1000510 3300025254 Bacteria 39093
61 Ga0209148_1000738 3300025254 Bacteria 25396
62 Ga0209759_1005129 3300025256 Bacteria 4670
63 Ga0209565_1021268 3300025263 Bacteria 1359
64 Ga0209455_1000069 3300025272 Bacteria 308247
65 Ga0209455_1000260 3300025272 Bacteria 60857
66 Ga0209455_1000638 3300025272 Bacteria 21512
67 Ga0209673_1000026 3300025273 Bacteria 373739
68 Ga0209675_1025528 3300025291 Bacteria 1488
69 Ga0209564_1006577 3300025295 Bacteria 6235
70 Ga0209050_1000326 3300025298 Bacteria 95495
71 Ga0209050_1000967 3300025298 Bacteria 36985
72 Ga0209256_1000019 3300025299 Bacteria 558627
73 Ga0209051_1000133 3300025303 Bacteria 139014
74 Ga0209257_1000038 3300025304 Bacteria 609032
75 Ga0207696_1000103 3300025711 Bacteria 165814
76 Ga0207696_1043126 3300025711 Bacteria 1313
77 Ga0207713_1000020 3300025735 Bacteria 359258
78 Ga0207713_1000087 3300025735 Bacteria 157009
79 Ga0207647_10008991 3300025904 Bacteria 7117
80 Ga0207699_10314824 3300025906 Bacteria 1096
81 Ga0207695_10003801 3300025913 Bacteria 20935
82 Ga0207695_10024465 3300025913 Bacteria 6793
83 Ga0207693_10005157 3300025915 Bacteria 10936
84 Ga0207657_10000097 3300025919 Bacteria 83815
85 Ga0207694_10103259 3300025924 Bacteria 2260
86 Ga0207644_10203692 3300025931 Bacteria 1562
87 Ga0207690_10000079 3300025932 Bacteria 83880
88 Ga0207669_10089401 3300025937 Bacteria 2000
89 Ga0207691_10125116 3300025940 Bacteria 2275
90 Ga0207667_10249144 3300025949 Bacteria 1817
91 Ga0207703_10240569 3300026035 Bacteria 1627
92 Ga0207678_10012546 3300026067 Bacteria 7443
93 Ga0207678_10120568 3300026067 Bacteria 2238
94 Ga0207674_10229527 3300026116 Bacteria 1804
95 Ga0207683_10230844 3300026121 Bacteria 1688
96 Ga0209281_1000935 3300027111 Bacteria 24025
97 Ga0209371_1001341 3300027312 Bacteria 17089
98 Ga0268266_10056698 3300028379 Bacteria 3370
99 Ga0268265_10199447 3300028380 Bacteria 1735
100 Ga0268256_1001150 3300030500 Bacteria 17089
101 Ga0307513_10009552 3300031456 Bacteria 12262
102 Ga0316583_10012720 3300032133 Bacteria 3037
103 Ga0316593_10011615 3300032168 Bacteria 2564
104 Ga0316592_1005989 3300033524 Bacteria 2329
105 Ga0316596_1003281 3300033541 Bacteria 3525
106 Ga0316584_0100914 3300036712 Bacteria 2161
107 Ga0395899_0030107 3300037312 Bacteria 4083
108 Ga0395900_0044779 3300037418 Bacteria 4558
109 Ga0395900_0180903 3300037418 Bacteria 2142
110 Ga0395900_0447343 3300037418 Bacteria 1249
111 Ga0395898_0055970 3300037466 Bacteria 3846
112 Ga0395905_0146960 3300037471 Bacteria 2218
113 Ga0395901_0150964 3300038443 Bacteria 2441
114 Ga0436360_0190356 3300039438 Bacteria 1954
115 Ga0436360_0833446 3300039438 Bacteria 4849
116 Ga0436363_0637488 3300039450 Bacteria 6217
117 Ga0436363_0754988 3300039450 Bacteria 6542
118 Ga0451843_0863492 3300041509 Bacteria 2301
119 Ga0439463_000307 3300042016 Bacteria 13720
120 Ga0451577_0049588 3300042876 Bacteria 3749
121 Ga0466961_0014243 3300044693 Bacteria 5104
122 Ga0495617_000788 3300046452 Bacteria 15320
123 Ga0495617_087265 3300046452 Bacteria 1020
124 Ga0495627_004277 3300046453 Bacteria 6015
125 Ga0495590_0000415 3300046457 Bacteria 21518
126 Ga0495591_000348 3300046458 Bacteria 40857
127 Ga0495591_000851 3300046458 Bacteria 21472
128 Ga0495591_001795 3300046458 Bacteria 12718
129 Ga0495638_0003574 3300046460 Bacteria 12177
130 Ga0495650_0000180 3300046471 Bacteria 137884
131 Ga0495650_0000713 3300046471 Bacteria 42386
132 Ga0495650_0004706 3300046471 Bacteria 9204
133 Ga0495580_0031092 3300046472 Bacteria 3861
134 Ga0495605_0000272 3300046474 Bacteria 58560
135 Ga0495605_0111444 3300046474 Bacteria 1248
136 Ga0495584_0001596 3300046491 Bacteria 13383
137 Ga0495584_0091774 3300046491 Bacteria 1531
138 Ga0495584_0126700 3300046491 Bacteria 1294
139 Ga0495585_0004540 3300046492 Bacteria 8985
140 Ga0495594_0002003 3300046499 Bacteria 10611
141 Ga0495594_0040605 3300046499 Bacteria 2547
142 Ga0495607_0032985 3300046501 Bacteria 3154
143 Ga0495607_0147864 3300046501 Bacteria 1205
144 Ga0495607_0167577 3300046501 Bacteria 1112
145 Ga0495583_0000114 3300046506 Bacteria 136026
146 Ga0495583_0000118 3300046506 Bacteria 133498
147 Ga0495583_0000752 3300046506 Bacteria 41177
148 Ga0495583_0001123 3300046506 Bacteria 29446
149 Ga0495583_0004055 3300046506 Bacteria 10764
150 Ga0495606_0000328 3300046507 Bacteria 81999
151 Ga0495606_0000548 3300046507 Bacteria 60206
152 Ga0495606_0001305 3300046507 Bacteria 34342
153 Ga0495606_0010517 3300046507 Bacteria 7665
154 Ga0495610_0004558 3300046512 Bacteria 10189
155 Ga0495610_0011212 3300046512 Bacteria 5495
156 Ga0495610_0013386 3300046512 Bacteria 4878
157 Ga0495610_0067775 3300046512 Bacteria 1675
158 Ga0495616_0008686 3300046513 Bacteria 5993
159 Ga0495616_0012150 3300046513 Bacteria 4900
160 Ga0495616_0065239 3300046513 Bacteria 1774
161 Ga0495620_0000203 3300046515 Bacteria 44714
162 Ga0495620_0004580 3300046515 Bacteria 7782
163 Ga0495631_0007724 3300046518 Bacteria 5458
164 Ga0495631_0011713 3300046518 Bacteria 4302
165 Ga0495631_0041361 3300046518 Unclassified 2040
166 Ga0495632_0000496 3300046519 Bacteria 37085
167 Ga0495632_0003392 3300046519 Bacteria 11347
168 Ga0495632_0008746 3300046519 Bacteria 6172
169 Ga0495637_0000173 3300046520 Bacteria 49751
170 Ga0495637_0000203 3300046520 Bacteria 46434
171 Ga0495637_0001622 3300046520 Bacteria 13055
172 Ga0495643_0007098 3300046522 Bacteria 7269
173 Ga0495643_0008179 3300046522 Bacteria 6651
174 Ga0495643_0023408 3300046522 Bacteria 3512
175 Ga0495643_0065379 3300046522 Bacteria 1920
176 Ga0495643_0074137 3300046522 Bacteria 1783
177 Ga0495643_0076427 3300046522 Unclassified 1751
178 Ga0495644_0003462 3300046523 Bacteria 6244
179 Ga0495648_0000793 3300046524 Bacteria 33549
180 Ga0495648_0000946 3300046524 Bacteria 30092
181 Ga0495648_0002051 3300046524 Bacteria 19107
182 Ga0495648_0007623 3300046524 Bacteria 8636
183 Ga0495648_0017406 3300046524 Bacteria 5136
184 Ga0495648_0058532 3300046524 Bacteria 2304
185 Ga0495666_0026905 3300046526 Bacteria 2831
186 Ga0495654_0001513 3300046530 Bacteria 15863
187 Ga0495654_0008427 3300046530 Bacteria 5696
188 Ga0495654_0032758 3300046530 Bacteria 2633
189 Ga0495654_0058839 3300046530 Bacteria 1852
190 Ga0495654_0060772 3300046530 Bacteria 1815
191 Ga0495665_0020328 3300046531 Bacteria 3567
192 Ga0495598_0082496 3300046537 Bacteria 1034
193 Ga0495609_0000087 3300046538 Bacteria 110204
194 Ga0495609_0000181 3300046538 Bacteria 63857
195 Ga0495609_0000270 3300046538 Bacteria 48509
196 Ga0495609_0059635 3300046538 Bacteria 1687
197 Ga0495621_0010850 3300046539 Bacteria 2802
198 Ga0495597_0001224 3300046542 Bacteria 19111
199 Ga0495597_0002828 3300046542 Bacteria 10636
200 Ga0495597_0009331 3300046542 Bacteria 4854
201 Ga0495597_0030670 3300046542 Bacteria 2449
202 Ga0495597_0073628 3300046542 Bacteria 1468
203 Ga0495622_0003902 3300046557 Bacteria 6966
204 Ga0495622_0104104 3300046557 Bacteria 1300
205 Ga0495633_0000010 3300046558 Bacteria 280844
206 Ga0495633_0034867 3300046558 Bacteria 2418
207 Ga0495668_0011894 3300046616 Bacteria 5185
208 Ga0495668_0015199 3300046616 Bacteria 4498
209 Ga0495668_0021625 3300046616 Bacteria 3686
210 Ga0495611_0000541 3300046648 Bacteria 22183
211 Ga0495611_0002511 3300046648 Bacteria 8345
212 Ga0495611_0081030 3300046648 Bacteria 1492
213 Ga0495625_0000163 3300046660 Bacteria 103308
214 Ga0495625_0001103 3300046660 Bacteria 35026
215 Ga0495625_0001726 3300046660 Bacteria 25344
216 Ga0495661_0000005 3300046665 Bacteria 433622
217 Ga0495661_0000359 3300046665 Bacteria 49499
218 Ga0495661_0000584 3300046665 Bacteria 37684
219 Ga0495661_0001594 3300046665 Bacteria 18676
220 Ga0495661_0018913 3300046665 Bacteria 4521
221 Ga0495624_0175229 3300046690 Bacteria 1308
222 Ga0495670_0000018 3300046691 Bacteria 115019
223 Ga0495670_0008806 3300046691 Bacteria 4968
224 Ga0495671_0001930 3300046692 Bacteria 13310
225 Ga0495671_0014470 3300046692 Bacteria 4244
226 Ga0495671_0016410 3300046692 Bacteria 3954
227 Ga0495649_0013950 3300046694 Bacteria 4622
228 Ga0495589_0000793 3300046794 Bacteria 20055
229 Ga0495589_0001487 3300046794 Bacteria 13482
230 Ga0495660_0002936 3300046810 Bacteria 10673
231 Ga0495660_0022164 3300046810 Bacteria 3629
232 Ga0495604_0064604 3300047317 Bacteria 2788
233 Ga0495674_0132066 3300047319 Bacteria 2103
234 Ga0495672_0001369 3300047320 Bacteria 24135
235 Ga0495672_0008095 3300047320 Bacteria 7807
236 Ga0495672_0025384 3300047320 Bacteria 3794
237 Ga0495676_0000074 3300047321 Bacteria 73520
238 Ga0495676_0073129 3300047321 Bacteria 2630
239 Ga0495680_0000724 3300047322 Bacteria 37103
240 Ga0495683_0000031 3300047323 Bacteria 150363
241 Ga0495683_0000456 3300047323 Bacteria 32056
242 Ga0495683_0059795 3300047323 Bacteria 1890
243 Ga0495683_0082085 3300047323 Bacteria 1571
244 Ga0495687_133696 3300047443 Bacteria 874
245 Ga0495679_000185 3300047446 Bacteria 55225
246 Ga0495679_000239 3300047446 Bacteria 45720
247 Ga0495673_0000477 3300047469 Bacteria 43268
248 Ga0495673_0000530 3300047469 Bacteria 39656
249 Ga0495673_0000688 3300047469 Bacteria 33080
250 Ga0495673_0003382 3300047469 Bacteria 10542
251 Ga0495673_0010465 3300047469 Bacteria 5039
252 Ga0495673_0014205 3300047469 Bacteria 4147
253 Ga0495681_0000116 3300047470 Bacteria 69786
254 Ga0495681_0001047 3300047470 Bacteria 21092
255 Ga0495686_0005445 3300047472 Bacteria 10040
256 Ga0495686_0070523 3300047472 Bacteria 2153
257 Ga0495686_0101440 3300047472 Bacteria 1735
258 Ga0495626_0000117 3300048091 Bacteria 104166
259 Ga0495626_0000162 3300048091 Bacteria 81809
260 Ga0495626_0000185 3300048091 Bacteria 75817
261 Ga0496100_0072160 3300048903 Bacteria 2307
262 Ga0496101_0184341 3300048904 Bacteria 1608
263 Ga0496102_0049273 3300048905 Bacteria 3832
264 Ga0496102_0628220 3300048905 Bacteria 997
265 Ga0496104_0083714 3300048907 Bacteria 3042
266 Ga0496104_0552527 3300048907 Bacteria 1062
267 Ga0496110_0168724 3300048913 Bacteria 1985
268 Ga0496111_0325469 3300048914 Bacteria 1138
269 Ga0496113_0202842 3300048916 Bacteria 1576
270 Ga0496116_0039645 3300048919 Bacteria 3254
271 Ga0496117_0149851 3300048920 Bacteria 1382
272 Ga0496117_0152289 3300048920 Bacteria 1367
273 Ga0496121_0002207 3300048924 Bacteria 30411
274 Ga0496121_0028674 3300048924 Bacteria 5176
275 Ga0496122_0000881 3300048925 Bacteria 56093
276 Ga0496123_0000315 3300048926 Bacteria 92845
277 Ga0496123_0035856 3300048926 Bacteria 3528
278 Ga0496123_0162581 3300048926 Bacteria 1188
279 Ga0496124_0004978 3300048927 Bacteria 15204
280 Ga0496124_0024734 3300048927 Bacteria 5454
281 Ga0496125_0001815 3300048928 Bacteria 29483
282 Ga0496125_0120131 3300048928 Bacteria 1877
283 Ga0495678_000143 3300049459 Bacteria 86601
284 Ga0495678_000375 3300049459 Bacteria 45295
285 Ga0495678_007733 3300049459 Bacteria 5538
286 Ga0495678_010077 3300049459 Bacteria 4614
287 Ga0495678_017517 3300049459 Bacteria 3244
288 Ga0495682_0009490 3300049460 Bacteria 3796
289 nmdc:mga03683_118414_c1 3300050489 Bacteria 1176
290 nmdc:mga0k408_48884_c1 3300050493 Bacteria 2448
291 Ga0500644_0011545 3300053088 Bacteria 2416
292 Ga0500641_0001040 3300053096 Bacteria 9872
293 Ga0500568_0020732 3300053139 Bacteria 2839
294 Ga0500590_018122 3300053148 Bacteria 3644
295 Ga0500634_0105635 3300053161 Bacteria 1400
296 Ga0500637_0006835 3300053178 Bacteria 5660
297 Ga0500570_079330 3300053724 Bacteria 1488
298 Ga0500587_003204 3300053739 Bacteria 2302
299 Ga0495605_0000067
300 JGI25151J46595_10000235
301 rootH1_10141797
302 rootH1_10034663
303 Ga0055532_1000689
304 Ga0055527_1000219
305 Ga0055535_1000464
306 Ga0055535_1000514
307 Ga0055542_1000535
308 Ga0055542_1000836
309 Ga0055529_1000131
310 Ga0055529_1004608
311 Ga0055524_1000139
312 Ga0055528_1016021
313 Ga0055530_10001272
314 Ga0055540_1000090
315 Ga0055540_1000091
316 Ga0065165_1031373
317 Ga0070677_10025338
318 Ga0070674_100090857
319 Ga0070659_100000064
320 Ga0070714_100274783
321 Ga0070663_100000667
322 Ga0070663_100387263
323 Ga0070678_100037120
324 Ga0070679_100600166
325 Ga0068855_100056681
326 Ga0068857_100168636
327 Ga0068852_100088440
328 Ga0068859_100708379
329 Ga0070717_10145779
330 Ga0075362_10012390
331 Ga0075366_10082204
332 Ga0097620_100708400
333 Ga0079104_1000916
334 Ga0105251_10000179
335 Ga0105251_10046168
336 Ga0105250_10000097
337 Ga0105240_10004587
338 Ga0105240_10024228
339 Ga0111539_10353711
340 Ga0105243_10687608
341 Ga0105237_10018313
342 Ga0105238_10012130
343 Ga0105239_10443869
344 Ga0157373_10042127
345 Ga0157370_10102459
346 Ga0157369_10331508
347 Ga0157369_10352450
348 Ga0209566_100145
349 Ga0209674_101475
350 Ga0209672_100015
351 Ga0209672_100031
352 Ga0209147_100016
353 Ga0209147_100034
354 Ga0209147_100040
355 Ga0209258_100026
356 Ga0209258_100061
357 Ga0209148_1000070
358 Ga0209148_1000510
359 Ga0209148_1000738
360 Ga0209759_1005129
361 Ga0209565_1021268
362 Ga0209455_1000069
363 Ga0209455_1000260
364 Ga0209455_1000638
365 Ga0209673_1000026
366 Ga0209675_1025528
367 Ga0209564_1006577
368 Ga0209050_1000326
369 Ga0209050_1000967
370 Ga0209256_1000019
371 Ga0209051_1000133
372 Ga0209257_1000038
373 Ga0207696_1000103
374 Ga0207696_1043126
375 Ga0207713_1000020
376 Ga0207713_1000087
377 Ga0207647_10008991
378 Ga0207699_10314824
379 Ga0207695_10003801
380 Ga0207695_10024465
381 Ga0207693_10005157
382 Ga0207657_10000097
383 Ga0207694_10103259
384 Ga0207644_10203692
385 Ga0207690_10000079
386 Ga0207669_10089401
387 Ga0207691_10125116
388 Ga0207667_10249144
389 Ga0207703_10240569
390 Ga0207678_10012546
391 Ga0207678_10120568
392 Ga0207674_10229527
393 Ga0207683_10230844
394 Ga0209281_1000935
395 Ga0209371_1001341
396 Ga0268266_10056698
397 Ga0268265_10199447
398 Ga0268256_1001150
399 Ga0307513_10009552
400 Ga0316583_10012720
401 Ga0316593_10011615
402 Ga0316592_1005989
403 Ga0316596_1003281
404 Ga0316584_0100914
405 Ga0395899_0030107
406 Ga0395900_0044779
407 Ga0395900_0180903
408 Ga0395900_0447343
409 Ga0395898_0055970
410 Ga0395905_0146960
411 Ga0395901_0150964
412 Ga0436360_0190356
413 Ga0436360_0833446
414 Ga0436363_0637488
415 Ga0436363_0754988
416 Ga0451843_0863492
417 Ga0439463_000307
418 Ga0451577_0049588
419 Ga0466961_0014243
420 Ga0495617_000788
421 Ga0495617_087265
422 Ga0495627_004277
423 Ga0495590_0000415
424 Ga0495591_000348
425 Ga0495591_000851
426 Ga0495591_001795
427 Ga0495638_0003574
428 Ga0495650_0000180
429 Ga0495650_0000713
430 Ga0495650_0004706
431 Ga0495580_0031092
432 Ga0495605_0000272
433 Ga0495605_0111444
434 Ga0495584_0001596
435 Ga0495584_0091774
436 Ga0495584_0126700
437 Ga0495585_0004540
438 Ga0495594_0002003
439 Ga0495594_0040605
440 Ga0495607_0032985
441 Ga0495607_0147864
442 Ga0495607_0167577
443 Ga0495583_0000114
444 Ga0495583_0000118
445 Ga0495583_0000752
446 Ga0495583_0001123
447 Ga0495583_0004055
448 Ga0495606_0000328
449 Ga0495606_0000548
450 Ga0495606_0001305
451 Ga0495606_0010517
452 Ga0495610_0004558
453 Ga0495610_0011212
454 Ga0495610_0013386
455 Ga0495610_0067775
456 Ga0495616_0008686
457 Ga0495616_0012150
458 Ga0495616_0065239
459 Ga0495620_0000203
460 Ga0495620_0004580
461 Ga0495631_0007724
462 Ga0495631_0011713
463 Ga0495631_0041361
464 Ga0495632_0000496
465 Ga0495632_0003392
466 Ga0495632_0008746
467 Ga0495637_0000173
468 Ga0495637_0000203
469 Ga0495637_0001622
470 Ga0495643_0007098
471 Ga0495643_0008179
472 Ga0495643_0023408
473 Ga0495643_0065379
474 Ga0495643_0074137
475 Ga0495643_0076427
476 Ga0495644_0003462
477 Ga0495648_0000793
478 Ga0495648_0000946
479 Ga0495648_0002051
480 Ga0495648_0007623
481 Ga0495648_0017406
482 Ga0495648_0058532
483 Ga0495666_0026905
484 Ga0495654_0001513
485 Ga0495654_0008427
486 Ga0495654_0032758
487 Ga0495654_0058839
488 Ga0495654_0060772
489 Ga0495665_0020328
490 Ga0495598_0082496
491 Ga0495609_0000087
492 Ga0495609_0000181
493 Ga0495609_0000270
494 Ga0495609_0059635
495 Ga0495621_0010850
496 Ga0495597_0001224
497 Ga0495597_0002828
498 Ga0495597_0009331
499 Ga0495597_0030670
500 Ga0495597_0073628
501 Ga0495622_0003902
502 Ga0495622_0104104
503 Ga0495633_0000010
504 Ga0495633_0034867
505 Ga0495668_0011894
506 Ga0495668_0015199
507 Ga0495668_0021625
508 Ga0495611_0000541
509 Ga0495611_0002511
510 Ga0495611_0081030
511 Ga0495625_0000163
512 Ga0495625_0001103
513 Ga0495625_0001726
514 Ga0495661_0000005
515 Ga0495661_0000359
516 Ga0495661_0000584
517 Ga0495661_0001594
518 Ga0495661_0018913
519 Ga0495624_0175229
520 Ga0495670_0000018
521 Ga0495670_0008806
522 Ga0495671_0001930
523 Ga0495671_0014470
524 Ga0495671_0016410
525 Ga0495649_0013950
526 Ga0495589_0000793
527 Ga0495589_0001487
528 Ga0495660_0002936
529 Ga0495660_0022164
530 Ga0495604_0064604
531 Ga0495674_0132066
532 Ga0495672_0001369
533 Ga0495672_0008095
534 Ga0495672_0025384
535 Ga0495676_0000074
536 Ga0495676_0073129
537 Ga0495680_0000724
538 Ga0495683_0000031
539 Ga0495683_0000456
540 Ga0495683_0059795
541 Ga0495683_0082085
542 Ga0495687_133696
543 Ga0495679_000185
544 Ga0495679_000239
545 Ga0495673_0000477
546 Ga0495673_0000530
547 Ga0495673_0000688
548 Ga0495673_0003382
549 Ga0495673_0010465
550 Ga0495673_0014205
551 Ga0495681_0000116
552 Ga0495681_0001047
553 Ga0495686_0005445
554 Ga0495686_0070523
555 Ga0495686_0101440
556 Ga0495626_0000117
557 Ga0495626_0000162
558 Ga0495626_0000185
559 Ga0496100_0072160
560 Ga0496101_0184341
561 Ga0496102_0049273
562 Ga0496102_0628220
563 Ga0496104_0083714
564 Ga0496104_0552527
565 Ga0496110_0168724
566 Ga0496111_0325469
567 Ga0496113_0202842
568 Ga0496116_0039645
569 Ga0496117_0149851
570 Ga0496117_0152289
571 Ga0496121_0002207
572 Ga0496121_0028674
573 Ga0496122_0000881
574 Ga0496123_0000315
575 Ga0496123_0035856
576 Ga0496123_0162581
577 Ga0496124_0004978
578 Ga0496124_0024734
579 Ga0496125_0001815
580 Ga0496125_0120131
581 Ga0495678_000143
582 Ga0495678_000375
583 Ga0495678_007733
584 Ga0495678_010077
585 Ga0495678_017517
586 Ga0495682_0009490
587 nmdc:mga03683_118414_c1
588 nmdc:mga0k408_48884_c1
589 Ga0500644_0011545
590 Ga0500641_0001040
591 Ga0500568_0020732
592 Ga0500590_018122
593 Ga0500634_0105635
594 Ga0500637_0006835
595 Ga0500570_079330
596 Ga0500587_003204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

73

265

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

79

325

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

75

227

0.86

PF08659

KR

KR domain

73

221

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g9m-assembly1.cif.gz_A acinetobacter_baumannii short-chain dehydrogenase 0.9627 1 257
8g9m-assembly1.cif.gz_A acinetobacter_baumannii short-chain dehydrogenase 0.9539 1 257
3t4x-assembly1.cif.gz_A short chain dehydrogenase/reductase family oxidoreductase from bacillus anthracis str. ames ancestor 0.9358 1 263
3t4x-assembly1.cif.gz_A short chain dehydrogenase/reductase family oxidoreductase from bacillus anthracis str. ames ancestor 0.9324 1 263
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9202 3 259
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9531 6 79 3.40.50.720
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9332 3 80 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9269 91 190 3.40.50.720
af_Q53GQ0_49_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9247 7 187 3.40.50.720
3t4xA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9238 3 263 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A356PIE7-F1-model_v4 deleted 0.9883 1 186
AF-A0A7Y4ZSC5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9875 1 140
AF-A0A401TZI0-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.9857 1 157
AF-A0A4Q8WSW0-F1-model_v4 deleted 0.9852 1 143
AF-A0A356PIE7-F1-model_v4 deleted 0.983 1 186

Map