F394635

General Info

Members Datasets Scaffolds Average Seq Length
299 191 599 240

Family's Representative Sequence

Representative Sequence 3300003791|Ga0055530_10000515|Ga0055530_1000051531
Length 255
Sequence VRPWIPAFAGMTGPRPIIRDMIRVLLVDDDPELRSLVSDYLSRYRMQVTTVPDGAGLRHALANAGSPPAFDVLLLDLMLPDANGLDLCRVVRQTSSLPIVMLTAQGDPASRVVGLELGADDYLPKPFEPRELVARINAVLRRTGSAPAAASAEAPVRRFNGWTFDRVRRQLTSPDHVMLALSSAEFRLLSAFVDHPRRVLSRERLLELTRVPGVDSTDRAIDLAISRLRQKLADPSLIRTVRGEGYAFEIDPPAP

Samples

Sample ID Description Type Environment
1 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
82 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
83 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
89 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
95 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
96 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
97 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
98 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
99 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
100 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
108 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
109 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
110 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
111 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
112 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
113 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
114 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
115 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
116 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
117 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
118 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
167 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
168 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
177 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
178 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
179 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
180 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
181 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
182 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
183 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
184 2643221585 Pelomonas sp. Root662 Isolate Unclassified
185 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
186 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
187 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
188 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
189 2643221656 Pelomonas sp. Root405 Isolate Unclassified
190 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
191 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 0
Isolates 4.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.44
Nodule 1.34
Rhizoplane 1.34
Rhizosphere 46.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10000515 3300003791 Bacteria 33601
2 JGI25152J39213_1000683 3300002773 Bacteria 17690
3 JGI25153J46596_10000448 3300003215 Bacteria 26516
4 rootH1_10028624 3300003316 Bacteria 1301
5 rootH1_10028624 3300003323 Bacteria 5060
6 rootH1_10094680 3300003323 Bacteria 5648
7 Ga0055526_1001528 3300003771 Bacteria 16371
8 Ga0055524_1000121 3300003775 Bacteria 91150
9 Ga0055524_1000183 3300003775 Bacteria 70460
10 Ga0055540_1000001 3300003792 Bacteria 466834
11 Ga0065165_1001455 3300005262 Bacteria 25574
12 Ga0070676_10008197 3300005328 Bacteria 5623
13 Ga0070676_10262530 3300005328 Bacteria 1157
14 Ga0070690_100076842 3300005330 Bacteria 2179
15 Ga0070670_100051664 3300005331 Bacteria 3529
16 Ga0070670_100104517 3300005331 Bacteria 2440
17 Ga0068869_100030886 3300005334 Bacteria 3765
18 Ga0068868_100102899 3300005338 Bacteria 2313
19 Ga0068868_100147747 3300005338 Bacteria 1934
20 Ga0070669_100001399 3300005353 Bacteria 17423
21 Ga0070675_100125403 3300005354 Bacteria 2184
22 Ga0070675_100205420 3300005354 Bacteria 1711
23 Ga0070671_100087131 3300005355 Bacteria 2613
24 Ga0070673_100223917 3300005364 Bacteria 1629
25 Ga0070667_100007921 3300005367 Bacteria 8812
26 Ga0070711_100264491 3300005439 Bacteria 1355
27 Ga0070663_100093166 3300005455 Bacteria 2235
28 Ga0070662_100065908 3300005457 Bacteria 2656
29 Ga0068867_100000041 3300005459 Bacteria 78472
30 Ga0068867_100004166 3300005459 Bacteria 10173
31 Ga0070706_100013486 3300005467 Bacteria 7560
32 Ga0070699_100474980 3300005518 Bacteria 1134
33 Ga0070699_100720224 3300005518 Bacteria 912
34 Ga0068853_100208010 3300005539 Bacteria 1783
35 Ga0070672_100168400 3300005543 Bacteria 1821
36 Ga0070665_100678840 3300005548 Bacteria 1043
37 Ga0068857_100019445 3300005577 Bacteria 5964
38 Ga0068857_100079907 3300005577 Bacteria 2919
39 Ga0068857_100592150 3300005577 Bacteria 1048
40 Ga0068866_10125774 3300005718 Bacteria 1451
41 Ga0075368_10001225 3300006042 Bacteria 8111
42 Ga0075368_10014616 3300006042 Bacteria 2902
43 Ga0075368_10029754 3300006042 Bacteria 2112
44 Ga0075368_10081044 3300006042 Bacteria 1321
45 Ga0075363_100020312 3300006048 Bacteria 3330
46 Ga0075364_10023342 3300006051 Bacteria 3917
47 Ga0075364_10208924 3300006051 Bacteria 1324
48 Ga0075364_10251508 3300006051 Bacteria 1201
49 Ga0075362_10000336 3300006177 Bacteria 13409
50 Ga0075362_10020704 3300006177 Bacteria 2751
51 Ga0075362_10027479 3300006177 Bacteria 2437
52 Ga0075362_10108984 3300006177 Bacteria 1302
53 Ga0075367_10012713 3300006178 Bacteria 4502
54 Ga0075367_10016034 3300006178 Bacteria 4085
55 Ga0075367_10016664 3300006178 Bacteria 4016
56 Ga0075367_10043485 3300006178 Bacteria 2631
57 Ga0075369_10006987 3300006186 Bacteria 4285
58 Ga0075369_10017589 3300006186 Bacteria 2900
59 Ga0075366_10006587 3300006195 Bacteria 6374
60 Ga0075366_10052976 3300006195 Bacteria 2410
61 Ga0075366_10062895 3300006195 Bacteria 2206
62 Ga0075366_10067875 3300006195 Bacteria 2122
63 Ga0075366_10132443 3300006195 Bacteria 1505
64 Ga0075370_10001494 3300006353 Bacteria 10200
65 Ga0075370_10002042 3300006353 Bacteria 9165
66 Ga0075370_10006778 3300006353 Bacteria 5789
67 Ga0068871_100521247 3300006358 Bacteria 1073
68 Ga0068865_100114114 3300006881 Bacteria 1998
69 Ga0079104_1000001 3300006946 Bacteria 521847
70 Ga0079104_1000273 3300006946 Bacteria 67267
71 Ga0105240_10384797 3300009093 Bacteria 1583
72 Ga0105245_10389220 3300009098 Bacteria 1390
73 Ga0105243_10001818 3300009148 Bacteria 18256
74 Ga0105243_10749200 3300009148 Bacteria 957
75 Ga0105237_10031289 3300009545 Bacteria 5397
76 Ga0105239_10035743 3300010375 Bacteria 5455
77 Ga0163162_10007560 3300013306 Bacteria 10585
78 Ga0157375_10017007 3300013308 Bacteria 6551
79 Ga0157375_10095842 3300013308 Bacteria 3039
80 Ga0157377_10000020 3300014745 Bacteria 151620
81 Ga0157377_10115018 3300014745 Bacteria 1622
82 Ga0157379_10082637 3300014968 Bacteria 2878
83 Ga0157379_10530755 3300014968 Bacteria 1093
84 Ga0207425_1000619 3300025245 Bacteria 20305
85 Ga0209129_1000062 3300025258 Bacteria 240655
86 Ga0209565_1015322 3300025263 Bacteria 1732
87 Ga0209673_1016242 3300025273 Bacteria 2793
88 Ga0209675_1005977 3300025291 Bacteria 4981
89 Ga0209675_1007412 3300025291 Bacteria 4212
90 Ga0209564_1000176 3300025295 Bacteria 152363
91 Ga0209758_1000126 3300025297 Bacteria 189761
92 Ga0209758_1000129 3300025297 Bacteria 185022
93 Ga0209050_1000118 3300025298 Bacteria 202586
94 Ga0209050_1001522 3300025298 Bacteria 24440
95 Ga0209050_1013629 3300025298 Bacteria 3591
96 Ga0209050_1015703 3300025298 Bacteria 3158
97 Ga0209256_1000015 3300025299 Bacteria 622953
98 Ga0209256_1000024 3300025299 Bacteria 448909
99 Ga0209051_1000018 3300025303 Bacteria 527061
100 Ga0209051_1020149 3300025303 Bacteria 2884
101 Ga0209257_1000084 3300025304 Bacteria 291502
102 Ga0209257_1008423 3300025304 Bacteria 5867
103 Ga0209257_1026869 3300025304 Bacteria 1929
104 Ga0207645_10008045 3300025907 Bacteria 7397
105 Ga0207645_10233902 3300025907 Bacteria 1213
106 Ga0207684_10003915 3300025910 Bacteria 14258
107 Ga0207663_10333973 3300025916 Bacteria 1143
108 Ga0207681_10003705 3300025923 Bacteria 9497
109 Ga0207650_10028138 3300025925 Bacteria 4028
110 Ga0207659_10409768 3300025926 Bacteria 1135
111 Ga0207644_10216844 3300025931 Bacteria 1515
112 Ga0207709_10003945 3300025935 Bacteria 8661
113 Ga0207691_10162835 3300025940 Bacteria 1956
114 Ga0207689_10063053 3300025942 Bacteria 3049
115 Ga0207651_10201910 3300025960 Bacteria 1594
116 Ga0207651_10220053 3300025960 Bacteria 1534
117 Ga0207658_10001854 3300025986 Bacteria 15830
118 Ga0207678_10019577 3300026067 Bacteria 5949
119 Ga0207648_10000026 3300026089 Bacteria 131314
120 Ga0207648_10002295 3300026089 Bacteria 20666
121 Ga0207648_10585612 3300026089 Bacteria 1027
122 Ga0207674_10013266 3300026116 Bacteria 9152
123 Ga0207674_10013681 3300026116 Bacteria 8989
124 Ga0207674_10558029 3300026116 Bacteria 1106
125 Ga0207675_100424442 3300026118 Bacteria 1314
126 Ga0207698_10004876 3300026142 Bacteria 8225
127 Ga0209281_1000151 3300027111 Bacteria 167268
128 Ga0209281_1000416 3300027111 Bacteria 64290
129 Ga0209813_10015590 3300027866 Bacteria 2062
130 Ga0209813_10021601 3300027866 Bacteria 1811
131 Ga0307517_10000174 3300028786 Bacteria 105578
132 Ga0307517_10101508 3300028786 Bacteria 2264
133 Ga0307517_10157341 3300028786 Bacteria 1537
134 Ga0307515_10001235 3300028794 Bacteria 58313
135 Ga0307515_10002229 3300028794 Bacteria 42507
136 Ga0307515_10004451 3300028794 Bacteria 29009
137 Ga0307515_10026743 3300028794 Bacteria 9909
138 Ga0307515_10069756 3300028794 Bacteria 4796
139 Ga0307512_10077429 3300030522 Bacteria 2416
140 Ga0307513_10001087 3300031456 Bacteria 39457
141 Ga0307513_10021443 3300031456 Bacteria 7626
142 Ga0307513_10115644 3300031456 Bacteria 2664
143 Ga0307513_10140439 3300031456 Bacteria 2343
144 Ga0307513_10209287 3300031456 Bacteria 1783
145 Ga0307509_10000225 3300031507 Bacteria 90913
146 Ga0307509_10003816 3300031507 Bacteria 22337
147 Ga0307509_10053865 3300031507 Bacteria 4286
148 Ga0307509_10306762 3300031507 Bacteria 1332
149 Ga0307408_100249055 3300031548 Bacteria 1464
150 Ga0307508_10000185 3300031616 Bacteria 75407
151 Ga0307508_10002202 3300031616 Bacteria 20788
152 Ga0307508_10003035 3300031616 Bacteria 17286
153 Ga0307514_10027208 3300031649 Bacteria 4620
154 Ga0307514_10113350 3300031649 Bacteria 1914
155 Ga0307514_10127369 3300031649 Bacteria 1761
156 Ga0307514_10154486 3300031649 Bacteria 1533
157 Ga0316575_10000291 3300031665 Bacteria 13928
158 Ga0307516_10001572 3300031730 Bacteria 31438
159 Ga0307516_10112120 3300031730 Bacteria 2528
160 Ga0307516_10193180 3300031730 Bacteria 1760
161 Ga0307516_10235902 3300031730 Bacteria 1530
162 Ga0307518_10375791 3300031838 Bacteria 810
163 Ga0307507_10041125 3300033179 Bacteria 4632
164 Ga0307507_10062731 3300033179 Bacteria 3448
165 Ga0307510_10002036 3300033180 Bacteria 22846
166 Ga0307510_10027956 3300033180 Bacteria 6449
167 Ga0307510_10177002 3300033180 Bacteria 1702
168 Ga0373930_0031514 3300034816 Bacteria 1093
169 Ga0373948_0045973 3300034817 Bacteria 926
170 Ga0373950_0006341 3300034818 Bacteria 1800
171 Ga0373958_0025123 3300034819 Bacteria 1132
172 Ga0373940_0005399 3300035088 Bacteria 2767
173 Ga0373951_0035703 3300035091 Bacteria 1184
174 Ga0373939_0000051 3300035114 Bacteria 41440
175 Ga0373939_0039450 3300035114 Bacteria 1413
176 Ga0373960_0002130 3300035121 Bacteria 4460
177 Ga0373931_0000141 3300035691 Bacteria 32173
178 Ga0373931_0006490 3300035691 Bacteria 5467
179 Ga0316582_0281180 3300036647 Bacteria 1142
180 Ga0373925_0016935 3300037068 Bacteria 5276
181 Ga0395905_0029897 3300037471 Bacteria 5135
182 Ga0436365_0560401 3300039437 Bacteria 2220
183 Ga0451833_0960283 3300041491 Bacteria 1678
184 Ga0451839_1431364 3300041496 Bacteria 1332
185 Ga0439437_000279 3300042000 Bacteria 4693
186 Ga0450913_000306 3300042117 Bacteria 1877
187 Ga0450919_000225 3300042121 Bacteria 6300
188 Ga0450888_000426 3300042126 Bacteria 3974
189 Ga0450890_001153 3300042127 Bacteria 3822
190 Ga0450891_002011 3300042129 Bacteria 2081
191 Ga0450889_000410 3300042144 Bacteria 4783
192 Ga0439434_0011422 3300042435 Bacteria 2626
193 Ga0450916_001412 3300042530 Bacteria 2398
194 Ga0450918_000006 3300042531 Bacteria 48279
195 Ga0450893_0001363 3300042532 Bacteria 3714
196 Ga0453684_0000015 3300044712 Bacteria 969198
197 Ga0453684_0000020 3300044712 Bacteria 879938
198 Ga0451576_0118473 3300045051 Bacteria 2756
199 Ga0495592_0001312 3300046454 Bacteria 17260
200 Ga0495629_0392526 3300046459 Bacteria 944
201 Ga0495638_0119564 3300046460 Bacteria 1558
202 Ga0495580_0042841 3300046472 Bacteria 3223
203 Ga0495605_0036110 3300046474 Bacteria 2494
204 Ga0495594_0071807 3300046499 Bacteria 1925
205 Ga0495610_0009884 3300046512 Bacteria 5972
206 Ga0495610_0093629 3300046512 Bacteria 1357
207 Ga0495616_0114686 3300046513 Bacteria 1249
208 Ga0495620_0027490 3300046515 Bacteria 2661
209 Ga0495628_0269551 3300046516 Bacteria 1267
210 Ga0495632_0004601 3300046519 Bacteria 9343
211 Ga0495632_0011043 3300046519 Bacteria 5292
212 Ga0495632_0013871 3300046519 Bacteria 4580
213 Ga0495632_0123535 3300046519 Bacteria 1208
214 Ga0495643_0085495 3300046522 Bacteria 1635
215 Ga0495666_0019510 3300046526 Bacteria 3363
216 Ga0495666_0170670 3300046526 Bacteria 1006
217 Ga0495597_0033794 3300046542 Bacteria 2313
218 Ga0495597_0099703 3300046542 Bacteria 1226
219 Ga0495611_0215807 3300046648 Bacteria 893
220 Ga0495625_0016651 3300046660 Bacteria 5775
221 Ga0495625_0023849 3300046660 Bacteria 4668
222 Ga0495647_0115723 3300046681 Bacteria 1123
223 Ga0495658_0174282 3300046683 Bacteria 1332
224 Ga0495624_0112982 3300046690 Bacteria 1670
225 Ga0495649_0002120 3300046694 Bacteria 14224
226 Ga0495649_0176105 3300046694 Bacteria 1118
227 Ga0495660_0023911 3300046810 Bacteria 3482
228 Ga0495604_0142712 3300047317 Bacteria 1709
229 Ga0495676_0176071 3300047321 Bacteria 1502
230 Ga0495687_001305 3300047443 Bacteria 23391
231 Ga0495687_011528 3300047443 Bacteria 4744
232 Ga0495686_0034912 3300047472 Bacteria 3235
233 Ga0495686_0082711 3300047472 Bacteria 1959
234 Ga0495593_0065482 3300047673 Bacteria 1895
235 Ga0495626_0129575 3300048091 Bacteria 1078
236 Ga0496102_0031335 3300048905 Bacteria 4769
237 Ga0496104_0404186 3300048907 Bacteria 1278
238 Ga0496114_0004522 3300048917 Bacteria 10794
239 Ga0496114_0047713 3300048917 Bacteria 3562
240 Ga0496116_0000215 3300048919 Bacteria 109085
241 Ga0496116_0063405 3300048919 Bacteria 2381
242 Ga0496121_0000198 3300048924 Bacteria 134224
243 Ga0495682_0052849 3300049460 Bacteria 1476
244 nmdc:mga03683_101276_c1 3300050489 Bacteria 1266
245 nmdc:mga03683_71349_c1 3300050489 Bacteria 1485
246 nmdc:mga03n38_15292_c1 3300050490 Bacteria 2960
247 nmdc:mga03n38_2718_c1 3300050490 Bacteria 5534
248 nmdc:mga00v17_153027_c1 3300050491 Bacteria 1482
249 nmdc:mga00v17_61901_c1 3300050491 Bacteria 2301
250 nmdc:mga0yw44_97892_c1 3300050492 Bacteria 1864
251 nmdc:mga0k408_10190_c1 3300050493 Bacteria 5081
252 nmdc:mga0k408_216498_c1 3300050493 Bacteria 1144
253 nmdc:mga0k408_275877_c1 3300050493 Bacteria 1004
254 nmdc:mga0k408_301041_c1 3300050493 Bacteria 957
255 nmdc:mga0k408_30374_c1 3300050493 Bacteria 3081
256 nmdc:mga0k408_34223_c1 3300050493 Bacteria 2908
257 nmdc:mga0k408_4585_c1 3300050493 Bacteria 7332
258 nmdc:mga0k408_51176_c1 3300050493 Bacteria 2393
259 nmdc:mga0k408_7127_c1 3300050493 Bacteria 2602
260 nmdc:mga0k408_80622_c1 3300050493 Bacteria 1905
261 nmdc:mga0k408_93119_c1 3300050493 Bacteria 1772
262 nmdc:mga06z11_22404_c1 3300050494 Bacteria 2950
263 nmdc:mga07m45_1253_c1 3300050496 Bacteria 11546
264 nmdc:mga07m45_14379_c1 3300050496 Bacteria 4215
265 nmdc:mga07m45_144263_c1 3300050496 Bacteria 1380
266 nmdc:mga07m45_1902_c1 3300050496 Bacteria 9628
267 nmdc:mga07m45_32138_c1 3300050496 Bacteria 2911
268 nmdc:mga07m45_748_c1 3300050496 Bacteria 13891
269 nmdc:mga07m45_82020_c1 3300050496 Bacteria 1841
270 nmdc:mga0sz30_47240_c1 3300050516 Bacteria 1819
271 Ga0500578_0000079 3300053086 Bacteria 107137
272 Ga0500644_0092830 3300053088 Bacteria 1133
273 Ga0500651_0029691 3300053093 Bacteria 3439
274 Ga0500594_0000517 3300053118 Bacteria 8374
275 Ga0500607_119971 3300053121 Bacteria 1274
276 Ga0500623_065290 3300053127 Bacteria 1783
277 Ga0500652_000624 3300053131 Bacteria 12146
278 Ga0500655_002479 3300053133 Bacteria 3362
279 Ga0500658_0043805 3300053134 Bacteria 1803
280 Ga0500559_0000329 3300053136 Bacteria 35808
281 Ga0500564_131070 3300053138 Bacteria 1085
282 Ga0500568_0034126 3300053139 Bacteria 2083
283 Ga0500568_0049439 3300053139 Bacteria 1659
284 Ga0500622_0000053 3300053156 Bacteria 145070
285 Ga0500627_0231553 3300053158 Bacteria 822
286 Ga0500570_068147 3300053724 Bacteria 1677
287 Ga0500587_000776 3300053739 Bacteria 4138
288 2587728137 2585428057 Bacteria 6737412
289 2587731195 2585428058 Bacteria 6853932
290 2587759977 2585428062 Bacteria 6842168
291 2588289948 2588253510 Bacteria 6901809
292 2643743355 2643221544 Bacteria 5886209
293 2643932633 2643221585 Bacteria 5812563
294 2643972262 2643221592 Bacteria 6608788
295 2644141627 2643221625 Bacteria 6512927
296 2644246504 2643221644 Bacteria 6865017
297 2644275602 2643221648 Bacteria 6521465
298 2644313883 2643221656 Bacteria 5809961
299 2808903937 2808606373 Bacteria 4423627
300 639788781 639633007 Bacteria 4376040
301 Ga0055530_10000515
302 JGI25152J39213_1000683
303 JGI25153J46596_10000448
304 rootH1_10028624
305 rootH1_10094680
306 Ga0055526_1001528
307 Ga0055524_1000121
308 Ga0055524_1000183
309 Ga0055540_1000001
310 Ga0065165_1001455
311 Ga0070676_10008197
312 Ga0070676_10262530
313 Ga0070690_100076842
314 Ga0070670_100051664
315 Ga0070670_100104517
316 Ga0068869_100030886
317 Ga0068868_100102899
318 Ga0068868_100147747
319 Ga0070669_100001399
320 Ga0070675_100125403
321 Ga0070675_100205420
322 Ga0070671_100087131
323 Ga0070673_100223917
324 Ga0070667_100007921
325 Ga0070711_100264491
326 Ga0070663_100093166
327 Ga0070662_100065908
328 Ga0068867_100000041
329 Ga0068867_100004166
330 Ga0070706_100013486
331 Ga0070699_100474980
332 Ga0070699_100720224
333 Ga0068853_100208010
334 Ga0070672_100168400
335 Ga0070665_100678840
336 Ga0068857_100019445
337 Ga0068857_100079907
338 Ga0068857_100592150
339 Ga0068866_10125774
340 Ga0075368_10001225
341 Ga0075368_10014616
342 Ga0075368_10029754
343 Ga0075368_10081044
344 Ga0075363_100020312
345 Ga0075364_10023342
346 Ga0075364_10208924
347 Ga0075364_10251508
348 Ga0075362_10000336
349 Ga0075362_10020704
350 Ga0075362_10027479
351 Ga0075362_10108984
352 Ga0075367_10012713
353 Ga0075367_10016034
354 Ga0075367_10016664
355 Ga0075367_10043485
356 Ga0075369_10006987
357 Ga0075369_10017589
358 Ga0075366_10006587
359 Ga0075366_10052976
360 Ga0075366_10062895
361 Ga0075366_10067875
362 Ga0075366_10132443
363 Ga0075370_10001494
364 Ga0075370_10002042
365 Ga0075370_10006778
366 Ga0068871_100521247
367 Ga0068865_100114114
368 Ga0079104_1000001
369 Ga0079104_1000273
370 Ga0105240_10384797
371 Ga0105245_10389220
372 Ga0105243_10001818
373 Ga0105243_10749200
374 Ga0105237_10031289
375 Ga0105239_10035743
376 Ga0163162_10007560
377 Ga0157375_10017007
378 Ga0157375_10095842
379 Ga0157377_10000020
380 Ga0157377_10115018
381 Ga0157379_10082637
382 Ga0157379_10530755
383 Ga0207425_1000619
384 Ga0209129_1000062
385 Ga0209565_1015322
386 Ga0209673_1016242
387 Ga0209675_1005977
388 Ga0209675_1007412
389 Ga0209564_1000176
390 Ga0209758_1000126
391 Ga0209758_1000129
392 Ga0209050_1000118
393 Ga0209050_1001522
394 Ga0209050_1013629
395 Ga0209050_1015703
396 Ga0209256_1000015
397 Ga0209256_1000024
398 Ga0209051_1000018
399 Ga0209051_1020149
400 Ga0209257_1000084
401 Ga0209257_1008423
402 Ga0209257_1026869
403 Ga0207645_10008045
404 Ga0207645_10233902
405 Ga0207684_10003915
406 Ga0207663_10333973
407 Ga0207681_10003705
408 Ga0207650_10028138
409 Ga0207659_10409768
410 Ga0207644_10216844
411 Ga0207709_10003945
412 Ga0207691_10162835
413 Ga0207689_10063053
414 Ga0207651_10201910
415 Ga0207651_10220053
416 Ga0207658_10001854
417 Ga0207678_10019577
418 Ga0207648_10000026
419 Ga0207648_10002295
420 Ga0207648_10585612
421 Ga0207674_10013266
422 Ga0207674_10013681
423 Ga0207674_10558029
424 Ga0207675_100424442
425 Ga0207698_10004876
426 Ga0209281_1000151
427 Ga0209281_1000416
428 Ga0209813_10015590
429 Ga0209813_10021601
430 Ga0307517_10000174
431 Ga0307517_10101508
432 Ga0307517_10157341
433 Ga0307515_10001235
434 Ga0307515_10002229
435 Ga0307515_10004451
436 Ga0307515_10026743
437 Ga0307515_10069756
438 Ga0307512_10077429
439 Ga0307513_10001087
440 Ga0307513_10021443
441 Ga0307513_10115644
442 Ga0307513_10140439
443 Ga0307513_10209287
444 Ga0307509_10000225
445 Ga0307509_10003816
446 Ga0307509_10053865
447 Ga0307509_10306762
448 Ga0307408_100249055
449 Ga0307508_10000185
450 Ga0307508_10002202
451 Ga0307508_10003035
452 Ga0307514_10027208
453 Ga0307514_10113350
454 Ga0307514_10127369
455 Ga0307514_10154486
456 Ga0316575_10000291
457 Ga0307516_10001572
458 Ga0307516_10112120
459 Ga0307516_10193180
460 Ga0307516_10235902
461 Ga0307518_10375791
462 Ga0307507_10041125
463 Ga0307507_10062731
464 Ga0307510_10002036
465 Ga0307510_10027956
466 Ga0307510_10177002
467 Ga0373930_0031514
468 Ga0373948_0045973
469 Ga0373950_0006341
470 Ga0373958_0025123
471 Ga0373940_0005399
472 Ga0373951_0035703
473 Ga0373939_0000051
474 Ga0373939_0039450
475 Ga0373960_0002130
476 Ga0373931_0000141
477 Ga0373931_0006490
478 Ga0316582_0281180
479 Ga0373925_0016935
480 Ga0395905_0029897
481 Ga0436365_0560401
482 Ga0451833_0960283
483 Ga0451839_1431364
484 Ga0439437_000279
485 Ga0450913_000306
486 Ga0450919_000225
487 Ga0450888_000426
488 Ga0450890_001153
489 Ga0450891_002011
490 Ga0450889_000410
491 Ga0439434_0011422
492 Ga0450916_001412
493 Ga0450918_000006
494 Ga0450893_0001363
495 Ga0453684_0000015
496 Ga0453684_0000020
497 Ga0451576_0118473
498 Ga0495592_0001312
499 Ga0495629_0392526
500 Ga0495638_0119564
501 Ga0495580_0042841
502 Ga0495605_0036110
503 Ga0495594_0071807
504 Ga0495610_0009884
505 Ga0495610_0093629
506 Ga0495616_0114686
507 Ga0495620_0027490
508 Ga0495628_0269551
509 Ga0495632_0004601
510 Ga0495632_0011043
511 Ga0495632_0013871
512 Ga0495632_0123535
513 Ga0495643_0085495
514 Ga0495666_0019510
515 Ga0495666_0170670
516 Ga0495597_0033794
517 Ga0495597_0099703
518 Ga0495611_0215807
519 Ga0495625_0016651
520 Ga0495625_0023849
521 Ga0495647_0115723
522 Ga0495658_0174282
523 Ga0495624_0112982
524 Ga0495649_0002120
525 Ga0495649_0176105
526 Ga0495660_0023911
527 Ga0495604_0142712
528 Ga0495676_0176071
529 Ga0495687_001305
530 Ga0495687_011528
531 Ga0495686_0034912
532 Ga0495686_0082711
533 Ga0495593_0065482
534 Ga0495626_0129575
535 Ga0496102_0031335
536 Ga0496104_0404186
537 Ga0496114_0004522
538 Ga0496114_0047713
539 Ga0496116_0000215
540 Ga0496116_0063405
541 Ga0496121_0000198
542 Ga0495682_0052849
543 nmdc:mga03683_101276_c1
544 nmdc:mga03683_71349_c1
545 nmdc:mga03n38_15292_c1
546 nmdc:mga03n38_2718_c1
547 nmdc:mga00v17_153027_c1
548 nmdc:mga00v17_61901_c1
549 nmdc:mga0yw44_97892_c1
550 nmdc:mga0k408_10190_c1
551 nmdc:mga0k408_216498_c1
552 nmdc:mga0k408_275877_c1
553 nmdc:mga0k408_301041_c1
554 nmdc:mga0k408_30374_c1
555 nmdc:mga0k408_34223_c1
556 nmdc:mga0k408_4585_c1
557 nmdc:mga0k408_51176_c1
558 nmdc:mga0k408_7127_c1
559 nmdc:mga0k408_80622_c1
560 nmdc:mga0k408_93119_c1
561 nmdc:mga06z11_22404_c1
562 nmdc:mga07m45_1253_c1
563 nmdc:mga07m45_14379_c1
564 nmdc:mga07m45_144263_c1
565 nmdc:mga07m45_1902_c1
566 nmdc:mga07m45_32138_c1
567 nmdc:mga07m45_748_c1
568 nmdc:mga07m45_82020_c1
569 nmdc:mga0sz30_47240_c1
570 Ga0500578_0000079
571 Ga0500644_0092830
572 Ga0500651_0029691
573 Ga0500594_0000517
574 Ga0500607_119971
575 Ga0500623_065290
576 Ga0500652_000624
577 Ga0500655_002479
578 Ga0500658_0043805
579 Ga0500559_0000329
580 Ga0500564_131070
581 Ga0500568_0034126
582 Ga0500568_0049439
583 Ga0500622_0000053
584 Ga0500627_0231553
585 Ga0500570_068147
586 Ga0500587_000776
587 2587728137
588 2587731195
589 2587759977
590 2588289948
591 2643743355
592 2643932633
593 2643972262
594 2644141627
595 2644246504
596 2644275602
597 2644313883
598 2808903937
599 639788781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

24

137

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9503 1 123
3nhz-assembly2.cif.gz_B structure of n-terminal domain of mtra 0.9448 1 119
2ftk-assembly2.cif.gz_H berylloflouride spo0f complex with spo0b 0.9393 1 120
7e90-assembly1.cif.gz_B crystal structure of the receiver domain (d51e) of the response regulator vbrr from vibrio parahaemolyticus 0.9386 1 122
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9384 3 123
ID Description Score Start End Superfamily
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9636 3 89 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9595 1 84 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.957 2 84 3.40.50.2300
af_P0A9Q1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9552 3 90 3.40.50.2300
3dzdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9495 3 125 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6N2VE22-F1-model_v4 Stage 0 sporulation protein A homolog 0.9342 2 126 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3B1DD72-F1-model_v4 Response regulator 0.9296 2 126 GO:0000155
AF-A0A7C4J786-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9288 2 122 GO:0000155
GO:0005524
GO:0006355
AF-A0A3M1TH77-F1-model_v4 Diguanylate cyclase 0.9253 2 126 GO:0000160
GO:0005886
GO:0043709
GO:0052621
GO:1902201
AF-A0A7C4MM60-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9236 3 125 GO:0000155
GO:0005524

Map