F394835
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 148 | 299 | 460 |
Family's Representative Sequence
| Representative Sequence | 3300013100|Ga0157373_10004883|Ga0157373_100048837 |
| Length | 508 |
| Sequence | LPCGLASLHTRSAYGSGHFLWFFLCASKERTEQYQKVKEEKNIFIKITCMKKTTVILILFAAISSFTFITKFSEDKPVPIPPSKQRTNGDAKEGYSYLVTGDYVKGGLPLNIFLLGTFGQKTYLQRDGLNKNIGFAYTAIKSDNGETLVAPNCLQCHAQVFEDQLIIGLGNSLSDFTKGQKLNTANIDILEKLLKANAPKQYEASAPFINITKTIAPYLFAEVKGVNIADKLAAILVAHRDPKNFKWSDSALMPIPNELIPTDTPPWWLLKKKNAMFYNGFGRGDFGRFLMASNLLTVRDTAESRSVDEHMPDVLAYIYSLQAPEYPKTIDQSLAGKGKTIFERNCSDCHGTYGANSTYPNLLIPESIIKTDSFLYKSNYSNPQFVNWFNKSWFTKGDHPAELVPFNGYIAPPLDGIWITAPYLHNGSVPTLEALLNSKLRPQFWSRDFEHPQYDYDNPGWKYKAEEKPLNTSTYNTNLPGYGNYGHYFGDDLTDEERKAVIEYLKTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 111 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 114 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 115 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 118 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 119 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 120 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 124 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 125 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 128 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 137 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 138 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 139 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 142 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 143 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 144 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 145 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 146 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 147 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 148 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.67 |
| Nodule | 0 |
| Rhizoplane | 1 |
| Rhizosphere | 95.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10000330 | 3300005328 | Bacteria | 21473 |
| 2 | Ga0070683_100000286 | 3300005329 | Bacteria | 34774 |
| 3 | Ga0070690_100016373 | 3300005330 | Bacteria | 4440 |
| 4 | Ga0070690_100047962 | 3300005330 | Unclassified | 2719 |
| 5 | Ga0070670_100052356 | 3300005331 | Bacteria | 3506 |
| 6 | Ga0068869_100002167 | 3300005334 | Bacteria | 11815 |
| 7 | Ga0068869_100003358 | 3300005334 | Bacteria | 9772 |
| 8 | Ga0070666_10000108 | 3300005335 | Bacteria | 56931 |
| 9 | Ga0070666_10002230 | 3300005335 | Bacteria | 11725 |
| 10 | Ga0070666_10008727 | 3300005335 | Bacteria | 6301 |
| 11 | Ga0070680_100005869 | 3300005336 | Bacteria | 9319 |
| 12 | Ga0068868_100004617 | 3300005338 | Bacteria | 9662 |
| 13 | Ga0068868_100009797 | 3300005338 | Bacteria | 6913 |
| 14 | Ga0068868_100099400 | 3300005338 | Bacteria | 2353 |
| 15 | Ga0070689_100006824 | 3300005340 | Bacteria | 7942 |
| 16 | Ga0070691_10003764 | 3300005341 | Bacteria | 6856 |
| 17 | Ga0070661_100000587 | 3300005344 | Bacteria | 27509 |
| 18 | Ga0070661_100003896 | 3300005344 | Bacteria | 10271 |
| 19 | Ga0070668_100003226 | 3300005347 | Bacteria | 12022 |
| 20 | Ga0070668_100044716 | 3300005347 | Bacteria | 3397 |
| 21 | Ga0070675_100094034 | 3300005354 | Bacteria | 2515 |
| 22 | Ga0070671_100097102 | 3300005355 | Bacteria | 2471 |
| 23 | Ga0070671_100206371 | 3300005355 | Bacteria | 1666 |
| 24 | Ga0070673_100000514 | 3300005364 | Bacteria | 20769 |
| 25 | Ga0070673_100006161 | 3300005364 | Bacteria | 7772 |
| 26 | Ga0070673_100117252 | 3300005364 | Bacteria | 2216 |
| 27 | Ga0070667_100001246 | 3300005367 | Bacteria | 23117 |
| 28 | Ga0070667_100010294 | 3300005367 | Bacteria | 7727 |
| 29 | Ga0070667_100045835 | 3300005367 | Bacteria | 3678 |
| 30 | Ga0070667_100077102 | 3300005367 | Bacteria | 2846 |
| 31 | Ga0070678_100100687 | 3300005456 | Bacteria | 2239 |
| 32 | Ga0070662_100004186 | 3300005457 | Bacteria | 9092 |
| 33 | Ga0070662_100058360 | 3300005457 | Bacteria | 2808 |
| 34 | Ga0068867_100001763 | 3300005459 | Bacteria | 15045 |
| 35 | Ga0070685_10030182 | 3300005466 | Bacteria | 3019 |
| 36 | Ga0070679_100017094 | 3300005530 | Bacteria | 7012 |
| 37 | Ga0070684_100000500 | 3300005535 | Bacteria | 26969 |
| 38 | Ga0070684_100033137 | 3300005535 | Bacteria | 4408 |
| 39 | Ga0070684_100111528 | 3300005535 | Bacteria | 2453 |
| 40 | Ga0068853_100003668 | 3300005539 | Bacteria | 11773 |
| 41 | Ga0070672_100001332 | 3300005543 | Bacteria | 15233 |
| 42 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 43 | Ga0070665_100001684 | 3300005548 | Bacteria | 25484 |
| 44 | Ga0068855_100005843 | 3300005563 | Bacteria | 15020 |
| 45 | Ga0068855_100007837 | 3300005563 | Bacteria | 12905 |
| 46 | Ga0068855_100034235 | 3300005563 | Bacteria | 6059 |
| 47 | Ga0068855_100140368 | 3300005563 | Bacteria | 2755 |
| 48 | Ga0068855_100210936 | 3300005563 | Unclassified | 2182 |
| 49 | Ga0070664_100000321 | 3300005564 | Bacteria | 34876 |
| 50 | Ga0070664_100009066 | 3300005564 | Bacteria | 8073 |
| 51 | Ga0070664_100043219 | 3300005564 | Bacteria | 3802 |
| 52 | Ga0070664_100145489 | 3300005564 | Bacteria | 2090 |
| 53 | Ga0068857_100001617 | 3300005577 | Bacteria | 18082 |
| 54 | Ga0068857_100003983 | 3300005577 | Bacteria | 12439 |
| 55 | Ga0068857_100030332 | 3300005577 | Bacteria | 4774 |
| 56 | Ga0068857_100037888 | 3300005577 | Bacteria | 4271 |
| 57 | Ga0068854_100017088 | 3300005578 | Bacteria | 4851 |
| 58 | Ga0068854_100075584 | 3300005578 | Bacteria | 2474 |
| 59 | Ga0068852_100002055 | 3300005616 | Bacteria | 13725 |
| 60 | Ga0068852_100002358 | 3300005616 | Bacteria | 13008 |
| 61 | Ga0068852_100112453 | 3300005616 | Bacteria | 2478 |
| 62 | Ga0068852_100125210 | 3300005616 | Bacteria | 2359 |
| 63 | Ga0068852_100164683 | 3300005616 | Unclassified | 2073 |
| 64 | Ga0068859_100000029 | 3300005617 | Bacteria | 178422 |
| 65 | Ga0068859_100030033 | 3300005617 | Bacteria | 5453 |
| 66 | Ga0068859_100167859 | 3300005617 | Bacteria | 2275 |
| 67 | Ga0068864_100001887 | 3300005618 | Bacteria | 17220 |
| 68 | Ga0068864_100023507 | 3300005618 | Bacteria | 5176 |
| 69 | Ga0068851_10003648 | 3300005834 | Bacteria | 6873 |
| 70 | Ga0068863_100004766 | 3300005841 | Bacteria | 13362 |
| 71 | Ga0068858_100001989 | 3300005842 | Bacteria | 20897 |
| 72 | Ga0068858_100075998 | 3300005842 | Unclassified | 3120 |
| 73 | Ga0068858_100099909 | 3300005842 | Bacteria | 2706 |
| 74 | Ga0068860_100000059 | 3300005843 | Bacteria | 196400 |
| 75 | Ga0068860_100000888 | 3300005843 | Bacteria | 33230 |
| 76 | Ga0068860_100003084 | 3300005843 | Bacteria | 17232 |
| 77 | Ga0068860_100015404 | 3300005843 | Bacteria | 7470 |
| 78 | Ga0068860_100016463 | 3300005843 | Bacteria | 7209 |
| 79 | Ga0068860_100026436 | 3300005843 | Bacteria | 5595 |
| 80 | Ga0070715_10005688 | 3300006163 | Bacteria | 4181 |
| 81 | Ga0097621_100002677 | 3300006237 | Bacteria | 12189 |
| 82 | Ga0097621_100007373 | 3300006237 | Bacteria | 7868 |
| 83 | Ga0068871_100001146 | 3300006358 | Bacteria | 17773 |
| 84 | Ga0068865_100183500 | 3300006881 | Bacteria | 1613 |
| 85 | Ga0097620_100000029 | 3300006931 | Bacteria | 178422 |
| 86 | Ga0097620_100030034 | 3300006931 | Bacteria | 5453 |
| 87 | Ga0097620_100167868 | 3300006931 | Bacteria | 2275 |
| 88 | Ga0105240_10000635 | 3300009093 | Bacteria | 64838 |
| 89 | Ga0105240_10001276 | 3300009093 | Bacteria | 43565 |
| 90 | Ga0105240_10015788 | 3300009093 | Bacteria | 10246 |
| 91 | Ga0105240_10032432 | 3300009093 | Bacteria | 6763 |
| 92 | Ga0105240_10049565 | 3300009093 | Bacteria | 5299 |
| 93 | Ga0105240_10054040 | 3300009093 | Bacteria | 5035 |
| 94 | Ga0111539_10163848 | 3300009094 | Bacteria | 2600 |
| 95 | Ga0105245_10086554 | 3300009098 | Bacteria | 2874 |
| 96 | Ga0105247_10004971 | 3300009101 | Bacteria | 8450 |
| 97 | Ga0105241_10000176 | 3300009174 | Bacteria | 47237 |
| 98 | Ga0105241_10000468 | 3300009174 | Bacteria | 30529 |
| 99 | Ga0105241_10014766 | 3300009174 | Bacteria | 5717 |
| 100 | Ga0105241_10033608 | 3300009174 | Bacteria | 3850 |
| 101 | Ga0105242_10083194 | 3300009176 | Bacteria | 2679 |
| 102 | Ga0105248_10010536 | 3300009177 | Bacteria | 10183 |
| 103 | Ga0105237_10002948 | 3300009545 | Bacteria | 20606 |
| 104 | Ga0105237_10003565 | 3300009545 | Bacteria | 18450 |
| 105 | Ga0105237_10005809 | 3300009545 | Bacteria | 13841 |
| 106 | Ga0105237_10013969 | 3300009545 | Bacteria | 8403 |
| 107 | Ga0105238_10076990 | 3300009551 | Unclassified | 3328 |
| 108 | Ga0105249_10022097 | 3300009553 | Bacteria | 5698 |
| 109 | Ga0105249_10115179 | 3300009553 | Unclassified | 2546 |
| 110 | Ga0105249_10116721 | 3300009553 | Bacteria | 2531 |
| 111 | Ga0105239_10000368 | 3300010375 | Bacteria | 66186 |
| 112 | Ga0105239_10001098 | 3300010375 | Bacteria | 37369 |
| 113 | Ga0105239_10014739 | 3300010375 | Bacteria | 8669 |
| 114 | Ga0105239_10016867 | 3300010375 | Bacteria | 8072 |
| 115 | Ga0105239_10031635 | 3300010375 | Bacteria | 5817 |
| 116 | Ga0105239_10045454 | 3300010375 | Bacteria | 4812 |
| 117 | Ga0105239_10074811 | 3300010375 | Bacteria | 3724 |
| 118 | Ga0105239_10212132 | 3300010375 | Bacteria | 2171 |
| 119 | Ga0105246_10013173 | 3300011119 | Bacteria | 5178 |
| 120 | Ga0157373_10004883 | 3300013100 | Bacteria | 10090 |
| 121 | Ga0157373_10027129 | 3300013100 | Unclassified | 4133 |
| 122 | Ga0157371_10062662 | 3300013102 | Unclassified | 2636 |
| 123 | Ga0157370_10080827 | 3300013104 | Bacteria | 3060 |
| 124 | Ga0157374_10000009 | 3300013296 | Bacteria | 564330 |
| 125 | Ga0157374_10000719 | 3300013296 | Bacteria | 28944 |
| 126 | Ga0157374_10002649 | 3300013296 | Bacteria | 15078 |
| 127 | Ga0157374_10237583 | 3300013296 | Unclassified | 1791 |
| 128 | Ga0157378_10001526 | 3300013297 | Bacteria | 20962 |
| 129 | Ga0157378_10026410 | 3300013297 | Bacteria | 5119 |
| 130 | Ga0157378_10033354 | 3300013297 | Bacteria | 4551 |
| 131 | Ga0157378_10081529 | 3300013297 | Bacteria | 2924 |
| 132 | Ga0163162_10000548 | 3300013306 | Bacteria | 34707 |
| 133 | Ga0163162_10000921 | 3300013306 | Bacteria | 27280 |
| 134 | Ga0163162_10004967 | 3300013306 | Bacteria | 12809 |
| 135 | Ga0163162_10021258 | 3300013306 | Bacteria | 6387 |
| 136 | Ga0163162_10093377 | 3300013306 | Bacteria | 3094 |
| 137 | Ga0163162_10129643 | 3300013306 | Bacteria | 2630 |
| 138 | Ga0157372_10000983 | 3300013307 | Bacteria | 31129 |
| 139 | Ga0157372_10013075 | 3300013307 | Bacteria | 8856 |
| 140 | Ga0157372_10072301 | 3300013307 | Bacteria | 3887 |
| 141 | Ga0157372_10089224 | 3300013307 | Unclassified | 3503 |
| 142 | Ga0157375_10002668 | 3300013308 | Bacteria | 15450 |
| 143 | Ga0157375_10046420 | 3300013308 | Bacteria | 4235 |
| 144 | Ga0157375_10127429 | 3300013308 | Bacteria | 2662 |
| 145 | Ga0163163_10000725 | 3300014325 | Bacteria | 28014 |
| 146 | Ga0163163_10005950 | 3300014325 | Bacteria | 10612 |
| 147 | Ga0163163_10006754 | 3300014325 | Bacteria | 10058 |
| 148 | Ga0163163_10089335 | 3300014325 | Unclassified | 3093 |
| 149 | Ga0157380_10006592 | 3300014326 | Bacteria | 8191 |
| 150 | Ga0157379_10005710 | 3300014968 | Bacteria | 10701 |
| 151 | Ga0157379_10113222 | 3300014968 | Bacteria | 2438 |
| 152 | Ga0157379_10177232 | 3300014968 | Bacteria | 1925 |
| 153 | Ga0157376_10000695 | 3300014969 | Bacteria | 21776 |
| 154 | Ga0157376_10006626 | 3300014969 | Bacteria | 8198 |
| 155 | Ga0157376_10009987 | 3300014969 | Bacteria | 6925 |
| 156 | Ga0157376_10023944 | 3300014969 | Bacteria | 4788 |
| 157 | Ga0163161_10002189 | 3300017792 | Bacteria | 14093 |
| 158 | Ga0163161_10079746 | 3300017792 | Bacteria | 2408 |
| 159 | Ga0207656_10008282 | 3300025321 | Bacteria | 3819 |
| 160 | Ga0207710_10000574 | 3300025900 | Bacteria | 21862 |
| 161 | Ga0207680_10000016 | 3300025903 | Bacteria | 134657 |
| 162 | Ga0207680_10000684 | 3300025903 | Bacteria | 16006 |
| 163 | Ga0207680_10031735 | 3300025903 | Bacteria | 2995 |
| 164 | Ga0207647_10037184 | 3300025904 | Unclassified | 3089 |
| 165 | Ga0207645_10002187 | 3300025907 | Bacteria | 15608 |
| 166 | Ga0207645_10032541 | 3300025907 | Bacteria | 3352 |
| 167 | Ga0207705_10008322 | 3300025909 | Bacteria | 7570 |
| 168 | Ga0207654_10001105 | 3300025911 | Bacteria | 14592 |
| 169 | Ga0207707_10000186 | 3300025912 | Bacteria | 65484 |
| 170 | Ga0207695_10000051 | 3300025913 | Bacteria | 399641 |
| 171 | Ga0207695_10000446 | 3300025913 | Bacteria | 90493 |
| 172 | Ga0207695_10013059 | 3300025913 | Bacteria | 9917 |
| 173 | Ga0207695_10095082 | 3300025913 | Bacteria | 2985 |
| 174 | Ga0207671_10001104 | 3300025914 | Bacteria | 32550 |
| 175 | Ga0207671_10001679 | 3300025914 | Bacteria | 25113 |
| 176 | Ga0207671_10005043 | 3300025914 | Bacteria | 12331 |
| 177 | Ga0207671_10018409 | 3300025914 | Bacteria | 5360 |
| 178 | Ga0207660_10005503 | 3300025917 | Bacteria | 8228 |
| 179 | Ga0207649_10004446 | 3300025920 | Bacteria | 7607 |
| 180 | Ga0207649_10006558 | 3300025920 | Bacteria | 6322 |
| 181 | Ga0207649_10063989 | 3300025920 | Bacteria | 2324 |
| 182 | Ga0207694_10038290 | 3300025924 | Unclassified | 3687 |
| 183 | Ga0207694_10114857 | 3300025924 | Bacteria | 2144 |
| 184 | Ga0207650_10001312 | 3300025925 | Bacteria | 18005 |
| 185 | Ga0207650_10022345 | 3300025925 | Bacteria | 4475 |
| 186 | Ga0207659_10054015 | 3300025926 | Bacteria | 2867 |
| 187 | Ga0207644_10058235 | 3300025931 | Bacteria | 2792 |
| 188 | Ga0207644_10085174 | 3300025931 | Bacteria | 2344 |
| 189 | Ga0207644_10092574 | 3300025931 | Bacteria | 2256 |
| 190 | Ga0207706_10001127 | 3300025933 | Bacteria | 27189 |
| 191 | Ga0207706_10009188 | 3300025933 | Bacteria | 9084 |
| 192 | Ga0207706_10011656 | 3300025933 | Bacteria | 8014 |
| 193 | Ga0207686_10064025 | 3300025934 | Unclassified | 2340 |
| 194 | Ga0207691_10000001 | 3300025940 | Bacteria | 220829 |
| 195 | Ga0207711_10266609 | 3300025941 | Bacteria | 1575 |
| 196 | Ga0207689_10017213 | 3300025942 | Bacteria | 6117 |
| 197 | Ga0207689_10017526 | 3300025942 | Bacteria | 6055 |
| 198 | Ga0207689_10041015 | 3300025942 | Bacteria | 3830 |
| 199 | Ga0207661_10003520 | 3300025944 | Bacteria | 10883 |
| 200 | Ga0207661_10046436 | 3300025944 | Bacteria | 3444 |
| 201 | Ga0207679_10004417 | 3300025945 | Bacteria | 8757 |
| 202 | Ga0207679_10006723 | 3300025945 | Bacteria | 7282 |
| 203 | Ga0207679_10007053 | 3300025945 | Bacteria | 7125 |
| 204 | Ga0207679_10090867 | 3300025945 | Bacteria | 2361 |
| 205 | Ga0207667_10000254 | 3300025949 | Bacteria | 75138 |
| 206 | Ga0207667_10018631 | 3300025949 | Bacteria | 7781 |
| 207 | Ga0207667_10129638 | 3300025949 | Unclassified | 2597 |
| 208 | Ga0207667_10195700 | 3300025949 | Bacteria | 2074 |
| 209 | Ga0207651_10004039 | 3300025960 | Bacteria | 7304 |
| 210 | Ga0207712_10025185 | 3300025961 | Bacteria | 3951 |
| 211 | Ga0207712_10028969 | 3300025961 | Bacteria | 3710 |
| 212 | Ga0207712_10038906 | 3300025961 | Bacteria | 3255 |
| 213 | Ga0207712_10064108 | 3300025961 | Unclassified | 2618 |
| 214 | Ga0207668_10001396 | 3300025972 | Bacteria | 14227 |
| 215 | Ga0207640_10015257 | 3300025981 | Unclassified | 4445 |
| 216 | Ga0207658_10009116 | 3300025986 | Bacteria | 6731 |
| 217 | Ga0207658_10099781 | 3300025986 | Bacteria | 2272 |
| 218 | Ga0207677_10001414 | 3300026023 | Bacteria | 12783 |
| 219 | Ga0207677_10009357 | 3300026023 | Bacteria | 5513 |
| 220 | Ga0207677_10033507 | 3300026023 | Bacteria | 3316 |
| 221 | Ga0207677_10040708 | 3300026023 | Bacteria | 3066 |
| 222 | Ga0207677_10185365 | 3300026023 | Bacteria | 1641 |
| 223 | Ga0207703_10002494 | 3300026035 | Bacteria | 15954 |
| 224 | Ga0207703_10005428 | 3300026035 | Bacteria | 10258 |
| 225 | Ga0207703_10016366 | 3300026035 | Bacteria | 5781 |
| 226 | Ga0207703_10159404 | 3300026035 | Bacteria | 1975 |
| 227 | Ga0207639_10005720 | 3300026041 | Bacteria | 8418 |
| 228 | Ga0207639_10006001 | 3300026041 | Bacteria | 8240 |
| 229 | Ga0207639_10078796 | 3300026041 | Bacteria | 2602 |
| 230 | Ga0207678_10031719 | 3300026067 | Bacteria | 4607 |
| 231 | Ga0207641_10001043 | 3300026088 | Bacteria | 28025 |
| 232 | Ga0207648_10008774 | 3300026089 | Bacteria | 9743 |
| 233 | Ga0207648_10033374 | 3300026089 | Bacteria | 4540 |
| 234 | Ga0207648_10097645 | 3300026089 | Bacteria | 2571 |
| 235 | Ga0207676_10001139 | 3300026095 | Bacteria | 20054 |
| 236 | Ga0207676_10002602 | 3300026095 | Bacteria | 12864 |
| 237 | Ga0207676_10004696 | 3300026095 | Bacteria | 9679 |
| 238 | Ga0207674_10005684 | 3300026116 | Bacteria | 14785 |
| 239 | Ga0207674_10006446 | 3300026116 | Bacteria | 13797 |
| 240 | Ga0207674_10009733 | 3300026116 | Bacteria | 10952 |
| 241 | Ga0207675_100189955 | 3300026118 | Bacteria | 1970 |
| 242 | Ga0207698_10002987 | 3300026142 | Bacteria | 10146 |
| 243 | Ga0207698_10054475 | 3300026142 | Unclassified | 3078 |
| 244 | Ga0207698_10058707 | 3300026142 | Bacteria | 2983 |
| 245 | Ga0207698_10136643 | 3300026142 | Unclassified | 2104 |
| 246 | Ga0207698_10222289 | 3300026142 | Unclassified | 1707 |
| 247 | Ga0207698_10224343 | 3300026142 | Bacteria | 1701 |
| 248 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 249 | Ga0268266_10002439 | 3300028379 | Bacteria | 19963 |
| 250 | Ga0268264_10000621 | 3300028381 | Bacteria | 42149 |
| 251 | Ga0268264_10011427 | 3300028381 | Bacteria | 7332 |
| 252 | Ga0268264_10016019 | 3300028381 | Bacteria | 6142 |
| 253 | Ga0268264_10017445 | 3300028381 | Bacteria | 5878 |
| 254 | Ga0268264_10019524 | 3300028381 | Bacteria | 5537 |
| 255 | Ga0268264_10106926 | 3300028381 | Unclassified | 2443 |
| 256 | Ga0307515_10000107 | 3300028794 | Bacteria | 197046 |
| 257 | Ga0265338_10044779 | 3300028800 | Bacteria | 4079 |
| 258 | Ga0307511_10001696 | 3300030521 | Bacteria | 23198 |
| 259 | Ga0265327_10000152 | 3300031251 | Bacteria | 149065 |
| 260 | Ga0307513_10019495 | 3300031456 | Bacteria | 8075 |
| 261 | Ga0307509_10220433 | 3300031507 | Bacteria | 1711 |
| 262 | Ga0307508_10000903 | 3300031616 | Bacteria | 34590 |
| 263 | Ga0307508_10060151 | 3300031616 | Bacteria | 3360 |
| 264 | Ga0307413_10008199 | 3300031824 | Unclassified | 4914 |
| 265 | Ga0307410_10025216 | 3300031852 | Unclassified | 3727 |
| 266 | Ga0307415_100035246 | 3300032126 | Unclassified | 3267 |
| 267 | Ga0373955_0034708 | 3300035172 | Bacteria | 2667 |
| 268 | Ga0373927_0103673 | 3300035695 | Bacteria | 1851 |
| 269 | Ga0373933_0148373 | 3300035724 | Unclassified | 1484 |
| 270 | Ga0373937_0006351 | 3300036401 | Bacteria | 10194 |
| 271 | Ga0395905_0183961 | 3300037471 | Bacteria | 1962 |
| 272 | Ga0466969_0001016 | 3300044656 | Bacteria | 15175 |
| 273 | Ga0466972_0047269 | 3300044658 | Bacteria | 2081 |
| 274 | Ga0466966_0023693 | 3300044684 | Bacteria | 4017 |
| 275 | Ga0453684_0021610 | 3300044712 | Bacteria | 9601 |
| 276 | Ga0453684_0079960 | 3300044712 | Bacteria | 4084 |
| 277 | Ga0466959_0000077 | 3300045049 | Bacteria | 62293 |
| 278 | Ga0495638_0016480 | 3300046460 | Bacteria | 4949 |
| 279 | Ga0495638_0029377 | 3300046460 | Bacteria | 3545 |
| 280 | Ga0495582_0095214 | 3300046473 | Bacteria | 1663 |
| 281 | Ga0495630_0023561 | 3300046517 | Bacteria | 4551 |
| 282 | Ga0495648_0004442 | 3300046524 | Bacteria | 11982 |
| 283 | Ga0495611_0000011 | 3300046648 | Bacteria | 146643 |
| 284 | Ga0495658_0034504 | 3300046683 | Bacteria | 2777 |
| 285 | Ga0495674_0017934 | 3300047319 | Bacteria | 6590 |
| 286 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 287 | Ga0496110_0047272 | 3300048913 | Bacteria | 3768 |
| 288 | Ga0496111_0274212 | 3300048914 | Bacteria | 1251 |
| 289 | Ga0496114_0126031 | 3300048917 | Bacteria | 2208 |
| 290 | Ga0501067_0016619 | 3300049583 | Bacteria | 4066 |
| 291 | Ga0501070_0025564 | 3300049586 | Bacteria | 4952 |
| 292 | Ga0501225_0004519 | 3300049705 | Bacteria | 4141 |
| 293 | Ga0501272_002689 | 3300049769 | Bacteria | 1769 |
| 294 | Ga0500578_0000120 | 3300053086 | Bacteria | 95463 |
| 295 | Ga0500583_0003410 | 3300053092 | Unclassified | 4993 |
| 296 | Ga0500652_052739 | 3300053131 | Bacteria | 1663 |
| 297 | Ga0500616_0006846 | 3300053153 | Bacteria | 7367 |
| 298 | Ga0500622_0003029 | 3300053156 | Bacteria | 11611 |
| 299 | Ga0501082_0005765 | 3300060353 | Bacteria | 10749 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048914 | Ga0496111_0274212 | Ga0496111_0274212_19_1230 | 396 |
| 2 | 3300009551 | Ga0105238_10076990 | Ga0105238_100769902 | 422 |
| 3 | 3300013307 | Ga0157372_10000983 | Ga0157372_1000098311 | 422 |
| 4 | 3300025914 | Ga0207671_10005043 | Ga0207671_100050433 | 423 |
| 5 | 3300025903 | Ga0207680_10000684 | Ga0207680_100006842 | 426 |
| 6 | 3300013308 | Ga0157375_10127429 | Ga0157375_101274292 | 443 |
| 7 | 3300044712 | Ga0453684_0021610 | Ga0453684_0021610_4039_5415 | 443 |
| 8 | 3300046473 | Ga0495582_0095214 | Ga0495582_0095214_40_1422 | 443 |
| 9 | 3300046683 | Ga0495658_0034504 | Ga0495658_0034504_810_2192 | 443 |
| 10 | 3300047319 | Ga0495674_0017934 | Ga0495674_0017934_5186_6568 | 443 |
| 11 | 3300014969 | Ga0157376_10006626 | Ga0157376_100066263 | 444 |
| 12 | 3300031456 | Ga0307513_10019495 | Ga0307513_100194951 | 444 |
| 13 | 3300031251 | Ga0265327_10000152 | Ga0265327_1000015281 | 445 |
| 14 | 3300035724 | Ga0373933_0148373 | Ga0373933_0148373_23_1405 | 445 |
| 15 | 3300014326 | Ga0157380_10006592 | Ga0157380_100065925 | 446 |
| 16 | 3300013307 | Ga0157372_10089224 | Ga0157372_100892241 | 447 |
| 17 | 3300049583 | Ga0501067_0016619 | Ga0501067_0016619_1859_3241 | 447 |
| 18 | 3300049586 | Ga0501070_0025564 | Ga0501070_0025564_520_1902 | 447 |
| 19 | 3300060353 | Ga0501082_0005765 | Ga0501082_0005765_4085_5467 | 447 |
| 20 | 3300025945 | Ga0207679_10004417 | Ga0207679_100044177 | 448 |
| 21 | 3300013296 | Ga0157374_10000009 | Ga0157374_10000009358 | 449 |
| 22 | 3300025931 | Ga0207644_10092574 | Ga0207644_100925741 | 449 |
| 23 | 3300006358 | Ga0068871_100001146 | Ga0068871_10000114610 | 450 |
| 24 | 3300009174 | Ga0105241_10000176 | Ga0105241_1000017634 | 450 |
| 25 | 3300013296 | Ga0157374_10237583 | Ga0157374_102375831 | 450 |
| 26 | 3300013306 | Ga0163162_10004967 | Ga0163162_100049672 | 450 |
| 27 | 3300053153 | Ga0500616_0006846 | Ga0500616_0006846_3900_5258 | 450 |
| 28 | 3300025961 | Ga0207712_10028969 | Ga0207712_100289691 | 451 |
| 29 | 3300030521 | Ga0307511_10001696 | Ga0307511_1000169617 | 451 |
| 30 | 3300009545 | Ga0105237_10002948 | Ga0105237_100029488 | 452 |
| 31 | 3300010375 | Ga0105239_10000368 | Ga0105239_1000036811 | 452 |
| 32 | 3300046460 | Ga0495638_0016480 | Ga0495638_0016480_1457_2839 | 452 |
| 33 | 3300009093 | Ga0105240_10000635 | Ga0105240_1000063543 | 454 |
| 34 | 3300025913 | Ga0207695_10000446 | Ga0207695_1000044611 | 454 |
| 35 | 3300013297 | Ga0157378_10001526 | Ga0157378_100015264 | 455 |
| 36 | 3300028800 | Ga0265338_10044779 | Ga0265338_100447793 | 455 |
| 37 | 3300005329 | Ga0070683_100000286 | Ga0070683_1000002866 | 456 |
| 38 | 3300005330 | Ga0070690_100016373 | Ga0070690_1000163733 | 456 |
| 39 | 3300005330 | Ga0070690_100047962 | Ga0070690_1000479621 | 456 |
| 40 | 3300005334 | Ga0068869_100003358 | Ga0068869_1000033583 | 456 |
| 41 | 3300005335 | Ga0070666_10008727 | Ga0070666_100087274 | 456 |
| 42 | 3300005338 | Ga0068868_100099400 | Ga0068868_1000994001 | 456 |
| 43 | 3300005340 | Ga0070689_100006824 | Ga0070689_1000068246 | 456 |
| 44 | 3300005344 | Ga0070661_100000587 | Ga0070661_10000058719 | 456 |
| 45 | 3300005344 | Ga0070661_100003896 | Ga0070661_1000038962 | 456 |
| 46 | 3300005364 | Ga0070673_100006161 | Ga0070673_1000061613 | 456 |
| 47 | 3300005367 | Ga0070667_100045835 | Ga0070667_1000458353 | 456 |
| 48 | 3300005367 | Ga0070667_100077102 | Ga0070667_1000771022 | 456 |
| 49 | 3300005456 | Ga0070678_100100687 | Ga0070678_1001006872 | 456 |
| 50 | 3300005457 | Ga0070662_100004186 | Ga0070662_1000041863 | 456 |
| 51 | 3300005466 | Ga0070685_10030182 | Ga0070685_100301823 | 456 |
| 52 | 3300005535 | Ga0070684_100000500 | Ga0070684_1000005004 | 456 |
| 53 | 3300005535 | Ga0070684_100033137 | Ga0070684_1000331374 | 456 |
| 54 | 3300005539 | Ga0068853_100003668 | Ga0068853_1000036683 | 456 |
| 55 | 3300005563 | Ga0068855_100005843 | Ga0068855_10000584311 | 456 |
| 56 | 3300005564 | Ga0070664_100000321 | Ga0070664_10000032121 | 456 |
| 57 | 3300005564 | Ga0070664_100009066 | Ga0070664_1000090666 | 456 |
| 58 | 3300005564 | Ga0070664_100043219 | Ga0070664_1000432194 | 456 |
| 59 | 3300005564 | Ga0070664_100145489 | Ga0070664_1001454892 | 456 |
| 60 | 3300005577 | Ga0068857_100001617 | Ga0068857_10000161713 | 456 |
| 61 | 3300005577 | Ga0068857_100037888 | Ga0068857_1000378882 | 456 |
| 62 | 3300005578 | Ga0068854_100075584 | Ga0068854_1000755842 | 456 |
| 63 | 3300005616 | Ga0068852_100112453 | Ga0068852_1001124531 | 456 |
| 64 | 3300005616 | Ga0068852_100164683 | Ga0068852_1001646832 | 456 |
| 65 | 3300005617 | Ga0068859_100030033 | Ga0068859_1000300333 | 456 |
| 66 | 3300005617 | Ga0068859_100167859 | Ga0068859_1001678592 | 456 |
| 67 | 3300005618 | Ga0068864_100023507 | Ga0068864_1000235074 | 456 |
| 68 | 3300005842 | Ga0068858_100099909 | Ga0068858_1000999092 | 456 |
| 69 | 3300006163 | Ga0070715_10005688 | Ga0070715_100056884 | 456 |
| 70 | 3300006931 | Ga0097620_100030034 | Ga0097620_1000300343 | 456 |
| 71 | 3300006931 | Ga0097620_100167868 | Ga0097620_1001678682 | 456 |
| 72 | 3300009174 | Ga0105241_10014766 | Ga0105241_100147662 | 456 |
| 73 | 3300009545 | Ga0105237_10005809 | Ga0105237_100058092 | 456 |
| 74 | 3300009553 | Ga0105249_10115179 | Ga0105249_101151792 | 456 |
| 75 | 3300010375 | Ga0105239_10014739 | Ga0105239_100147393 | 456 |
| 76 | 3300010375 | Ga0105239_10045454 | Ga0105239_100454542 | 456 |
| 77 | 3300010375 | Ga0105239_10074811 | Ga0105239_100748112 | 456 |
| 78 | 3300013100 | Ga0157373_10027129 | Ga0157373_100271292 | 456 |
| 79 | 3300013296 | Ga0157374_10000719 | Ga0157374_100007197 | 456 |
| 80 | 3300013306 | Ga0163162_10093377 | Ga0163162_100933772 | 456 |
| 81 | 3300013306 | Ga0163162_10129643 | Ga0163162_101296432 | 456 |
| 82 | 3300013308 | Ga0157375_10046420 | Ga0157375_100464202 | 456 |
| 83 | 3300014325 | Ga0163163_10006754 | Ga0163163_100067545 | 456 |
| 84 | 3300014968 | Ga0157379_10113222 | Ga0157379_101132222 | 456 |
| 85 | 3300014969 | Ga0157376_10023944 | Ga0157376_100239441 | 456 |
| 86 | 3300017792 | Ga0163161_10002189 | Ga0163161_100021898 | 456 |
| 87 | 3300017792 | Ga0163161_10079746 | Ga0163161_100797462 | 456 |
| 88 | 3300025903 | Ga0207680_10031735 | Ga0207680_100317351 | 456 |
| 89 | 3300025904 | Ga0207647_10037184 | Ga0207647_100371843 | 456 |
| 90 | 3300025907 | Ga0207645_10032541 | Ga0207645_100325412 | 456 |
| 91 | 3300025913 | Ga0207695_10013059 | Ga0207695_100130592 | 456 |
| 92 | 3300025920 | Ga0207649_10004446 | Ga0207649_100044461 | 456 |
| 93 | 3300025920 | Ga0207649_10006558 | Ga0207649_100065585 | 456 |
| 94 | 3300025920 | Ga0207649_10063989 | Ga0207649_100639892 | 456 |
| 95 | 3300025931 | Ga0207644_10058235 | Ga0207644_100582352 | 456 |
| 96 | 3300025933 | Ga0207706_10001127 | Ga0207706_1000112713 | 456 |
| 97 | 3300025933 | Ga0207706_10011656 | Ga0207706_100116565 | 456 |
| 98 | 3300025942 | Ga0207689_10017213 | Ga0207689_100172132 | 456 |
| 99 | 3300025942 | Ga0207689_10017526 | Ga0207689_100175264 | 456 |
| 100 | 3300025944 | Ga0207661_10003520 | Ga0207661_100035204 | 456 |
| 101 | 3300025945 | Ga0207679_10006723 | Ga0207679_100067234 | 456 |
| 102 | 3300025945 | Ga0207679_10007053 | Ga0207679_100070534 | 456 |
| 103 | 3300025945 | Ga0207679_10090867 | Ga0207679_100908671 | 456 |
| 104 | 3300025949 | Ga0207667_10018631 | Ga0207667_100186314 | 456 |
| 105 | 3300025961 | Ga0207712_10064108 | Ga0207712_100641082 | 456 |
| 106 | 3300025986 | Ga0207658_10099781 | Ga0207658_100997812 | 456 |
| 107 | 3300026023 | Ga0207677_10185365 | Ga0207677_101853651 | 456 |
| 108 | 3300026035 | Ga0207703_10016366 | Ga0207703_100163664 | 456 |
| 109 | 3300026035 | Ga0207703_10159404 | Ga0207703_101594042 | 456 |
| 110 | 3300026041 | Ga0207639_10005720 | Ga0207639_100057205 | 456 |
| 111 | 3300026067 | Ga0207678_10031719 | Ga0207678_100317194 | 456 |
| 112 | 3300026089 | Ga0207648_10033374 | Ga0207648_100333742 | 456 |
| 113 | 3300026089 | Ga0207648_10097645 | Ga0207648_100976452 | 456 |
| 114 | 3300026095 | Ga0207676_10002602 | Ga0207676_100026026 | 456 |
| 115 | 3300026116 | Ga0207674_10005684 | Ga0207674_100056844 | 456 |
| 116 | 3300026116 | Ga0207674_10009733 | Ga0207674_100097333 | 456 |
| 117 | 3300026142 | Ga0207698_10058707 | Ga0207698_100587073 | 456 |
| 118 | 3300026142 | Ga0207698_10222289 | Ga0207698_102222892 | 456 |
| 119 | 3300028381 | Ga0268264_10106926 | Ga0268264_101069262 | 456 |
| 120 | 3300035172 | Ga0373955_0034708 | Ga0373955_0034708_937_2328 | 456 |
| 121 | 3300035695 | Ga0373927_0103673 | Ga0373927_0103673_52_1431 | 456 |
| 122 | 3300036401 | Ga0373937_0006351 | Ga0373937_0006351_3710_5101 | 456 |
| 123 | 3300044656 | Ga0466969_0001016 | Ga0466969_0001016_3227_4606 | 456 |
| 124 | 3300044658 | Ga0466972_0047269 | Ga0466972_0047269_82_1461 | 456 |
| 125 | 3300044684 | Ga0466966_0023693 | Ga0466966_0023693_554_1933 | 456 |
| 126 | 3300045049 | Ga0466959_0000077 | Ga0466959_0000077_58623_60002 | 456 |
| 127 | 3300046517 | Ga0495630_0023561 | Ga0495630_0023561_2701_4092 | 456 |
| 128 | 3300048913 | Ga0496110_0047272 | Ga0496110_0047272_2224_3615 | 456 |
| 129 | 3300048917 | Ga0496114_0126031 | Ga0496114_0126031_675_2066 | 456 |
| 130 | 3300031616 | Ga0307508_10000903 | Ga0307508_1000090311 | 457 |
| 131 | 3300044712 | Ga0453684_0079960 | Ga0453684_0079960_1156_2538 | 457 |
| 132 | 3300046460 | Ga0495638_0029377 | Ga0495638_0029377_1208_2590 | 457 |
| 133 | 3300049705 | Ga0501225_0004519 | Ga0501225_0004519_1196_2578 | 457 |
| 134 | 3300053086 | Ga0500578_0000120 | Ga0500578_0000120_79043_80425 | 457 |
| 135 | 3300053131 | Ga0500652_052739 | Ga0500652_052739_111_1493 | 457 |
| 136 | 3300005354 | Ga0070675_100094034 | Ga0070675_1000940341 | 458 |
| 137 | 3300005355 | Ga0070671_100097102 | Ga0070671_1000971021 | 458 |
| 138 | 3300005577 | Ga0068857_100030332 | Ga0068857_1000303323 | 458 |
| 139 | 3300005616 | Ga0068852_100125210 | Ga0068852_1001252103 | 458 |
| 140 | 3300005843 | Ga0068860_100016463 | Ga0068860_1000164634 | 458 |
| 141 | 3300009101 | Ga0105247_10004971 | Ga0105247_100049715 | 458 |
| 142 | 3300009553 | Ga0105249_10116721 | Ga0105249_101167212 | 458 |
| 143 | 3300013100 | Ga0157373_10004883 | Ga0157373_100048837 | 458 |
| 144 | 3300013102 | Ga0157371_10062662 | Ga0157371_100626621 | 458 |
| 145 | 3300013307 | Ga0157372_10072301 | Ga0157372_100723012 | 458 |
| 146 | 3300014325 | Ga0163163_10005950 | Ga0163163_100059502 | 458 |
| 147 | 3300025900 | Ga0207710_10000574 | Ga0207710_1000057410 | 458 |
| 148 | 3300025925 | Ga0207650_10001312 | Ga0207650_100013128 | 458 |
| 149 | 3300025926 | Ga0207659_10054015 | Ga0207659_100540152 | 458 |
| 150 | 3300025931 | Ga0207644_10085174 | Ga0207644_100851742 | 458 |
| 151 | 3300026118 | Ga0207675_100189955 | Ga0207675_1001899552 | 458 |
| 152 | 3300026142 | Ga0207698_10136643 | Ga0207698_101366432 | 458 |
| 153 | 3300028381 | Ga0268264_10016019 | Ga0268264_100160194 | 458 |
| 154 | 3300031824 | Ga0307413_10008199 | Ga0307413_100081992 | 458 |
| 155 | 3300031852 | Ga0307410_10025216 | Ga0307410_100252162 | 458 |
| 156 | 3300032126 | Ga0307415_100035246 | Ga0307415_1000352462 | 458 |
| 157 | 3300037471 | Ga0395905_0183961 | Ga0395905_0183961_436_1815 | 458 |
| 158 | 3300049769 | Ga0501272_002689 | Ga0501272_002689_220_1599 | 458 |
| 159 | 3300005331 | Ga0070670_100052356 | Ga0070670_1000523562 | 459 |
| 160 | 3300005338 | Ga0068868_100009797 | Ga0068868_1000097976 | 459 |
| 161 | 3300005355 | Ga0070671_100206371 | Ga0070671_1002063711 | 459 |
| 162 | 3300005364 | Ga0070673_100117252 | Ga0070673_1001172522 | 459 |
| 163 | 3300005535 | Ga0070684_100111528 | Ga0070684_1001115281 | 459 |
| 164 | 3300005563 | Ga0068855_100210936 | Ga0068855_1002109361 | 459 |
| 165 | 3300005843 | Ga0068860_100026436 | Ga0068860_1000264363 | 459 |
| 166 | 3300009093 | Ga0105240_10032432 | Ga0105240_100324324 | 459 |
| 167 | 3300013104 | Ga0157370_10080827 | Ga0157370_100808271 | 459 |
| 168 | 3300013297 | Ga0157378_10081529 | Ga0157378_100815291 | 459 |
| 169 | 3300013307 | Ga0157372_10013075 | Ga0157372_100130752 | 459 |
| 170 | 3300025913 | Ga0207695_10000051 | Ga0207695_10000051261 | 459 |
| 171 | 3300025925 | Ga0207650_10022345 | Ga0207650_100223452 | 459 |
| 172 | 3300025944 | Ga0207661_10046436 | Ga0207661_100464361 | 459 |
| 173 | 3300026023 | Ga0207677_10001414 | Ga0207677_100014146 | 459 |
| 174 | 3300028381 | Ga0268264_10019524 | Ga0268264_100195242 | 459 |
| 175 | 3300005328 | Ga0070676_10000330 | Ga0070676_100003308 | 460 |
| 176 | 3300005334 | Ga0068869_100002167 | Ga0068869_1000021678 | 460 |
| 177 | 3300005335 | Ga0070666_10000108 | Ga0070666_1000010813 | 460 |
| 178 | 3300005335 | Ga0070666_10002230 | Ga0070666_100022303 | 460 |
| 179 | 3300005336 | Ga0070680_100005869 | Ga0070680_1000058695 | 460 |
| 180 | 3300005338 | Ga0068868_100004617 | Ga0068868_1000046175 | 460 |
| 181 | 3300005341 | Ga0070691_10003764 | Ga0070691_100037643 | 460 |
| 182 | 3300005347 | Ga0070668_100003226 | Ga0070668_1000032262 | 460 |
| 183 | 3300005347 | Ga0070668_100044716 | Ga0070668_1000447163 | 460 |
| 184 | 3300005364 | Ga0070673_100000514 | Ga0070673_1000005148 | 460 |
| 185 | 3300005367 | Ga0070667_100001246 | Ga0070667_1000012467 | 460 |
| 186 | 3300005367 | Ga0070667_100010294 | Ga0070667_1000102943 | 460 |
| 187 | 3300005457 | Ga0070662_100058360 | Ga0070662_1000583602 | 460 |
| 188 | 3300005459 | Ga0068867_100001763 | Ga0068867_1000017638 | 460 |
| 189 | 3300005530 | Ga0070679_100017094 | Ga0070679_1000170943 | 460 |
| 190 | 3300005543 | Ga0070672_100001332 | Ga0070672_1000013324 | 460 |
| 191 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008411 | 460 |
| 192 | 3300005548 | Ga0070665_100001684 | Ga0070665_1000016849 | 460 |
| 193 | 3300005563 | Ga0068855_100007837 | Ga0068855_1000078374 | 460 |
| 194 | 3300005563 | Ga0068855_100034235 | Ga0068855_1000342353 | 460 |
| 195 | 3300005563 | Ga0068855_100140368 | Ga0068855_1001403682 | 460 |
| 196 | 3300005577 | Ga0068857_100003983 | Ga0068857_1000039839 | 460 |
| 197 | 3300005578 | Ga0068854_100017088 | Ga0068854_1000170884 | 460 |
| 198 | 3300005616 | Ga0068852_100002055 | Ga0068852_1000020552 | 460 |
| 199 | 3300005616 | Ga0068852_100002358 | Ga0068852_1000023582 | 460 |
| 200 | 3300005617 | Ga0068859_100000029 | Ga0068859_10000002925 | 460 |
| 201 | 3300005618 | Ga0068864_100001887 | Ga0068864_1000018877 | 460 |
| 202 | 3300005834 | Ga0068851_10003648 | Ga0068851_100036483 | 460 |
| 203 | 3300005841 | Ga0068863_100004766 | Ga0068863_1000047667 | 460 |
| 204 | 3300005842 | Ga0068858_100001989 | Ga0068858_1000019898 | 460 |
| 205 | 3300005842 | Ga0068858_100075998 | Ga0068858_1000759982 | 460 |
| 206 | 3300005843 | Ga0068860_100000059 | Ga0068860_10000005912 | 460 |
| 207 | 3300005843 | Ga0068860_100000888 | Ga0068860_10000088820 | 460 |
| 208 | 3300005843 | Ga0068860_100003084 | Ga0068860_1000030847 | 460 |
| 209 | 3300005843 | Ga0068860_100015404 | Ga0068860_1000154043 | 460 |
| 210 | 3300006237 | Ga0097621_100002677 | Ga0097621_10000267711 | 460 |
| 211 | 3300006237 | Ga0097621_100007373 | Ga0097621_1000073733 | 460 |
| 212 | 3300006881 | Ga0068865_100183500 | Ga0068865_1001835001 | 460 |
| 213 | 3300006931 | Ga0097620_100000029 | Ga0097620_10000002925 | 460 |
| 214 | 3300009093 | Ga0105240_10001276 | Ga0105240_1000127632 | 460 |
| 215 | 3300009093 | Ga0105240_10015788 | Ga0105240_100157882 | 460 |
| 216 | 3300009093 | Ga0105240_10049565 | Ga0105240_100495654 | 460 |
| 217 | 3300009093 | Ga0105240_10054040 | Ga0105240_100540402 | 460 |
| 218 | 3300009094 | Ga0111539_10163848 | Ga0111539_101638483 | 460 |
| 219 | 3300009098 | Ga0105245_10086554 | Ga0105245_100865543 | 460 |
| 220 | 3300009174 | Ga0105241_10000468 | Ga0105241_1000046811 | 460 |
| 221 | 3300009174 | Ga0105241_10033608 | Ga0105241_100336082 | 460 |
| 222 | 3300009176 | Ga0105242_10083194 | Ga0105242_100831942 | 460 |
| 223 | 3300009177 | Ga0105248_10010536 | Ga0105248_100105364 | 460 |
| 224 | 3300009545 | Ga0105237_10003565 | Ga0105237_100035652 | 460 |
| 225 | 3300009545 | Ga0105237_10013969 | Ga0105237_100139694 | 460 |
| 226 | 3300009553 | Ga0105249_10022097 | Ga0105249_100220972 | 460 |
| 227 | 3300010375 | Ga0105239_10001098 | Ga0105239_1000109822 | 460 |
| 228 | 3300010375 | Ga0105239_10016867 | Ga0105239_100168673 | 460 |
| 229 | 3300010375 | Ga0105239_10031635 | Ga0105239_100316352 | 460 |
| 230 | 3300010375 | Ga0105239_10212132 | Ga0105239_102121322 | 460 |
| 231 | 3300011119 | Ga0105246_10013173 | Ga0105246_100131732 | 460 |
| 232 | 3300013296 | Ga0157374_10002649 | Ga0157374_100026495 | 460 |
| 233 | 3300013297 | Ga0157378_10026410 | Ga0157378_100264102 | 460 |
| 234 | 3300013297 | Ga0157378_10033354 | Ga0157378_100333544 | 460 |
| 235 | 3300013306 | Ga0163162_10000548 | Ga0163162_100005483 | 460 |
| 236 | 3300013306 | Ga0163162_10000921 | Ga0163162_100009214 | 460 |
| 237 | 3300013306 | Ga0163162_10021258 | Ga0163162_100212582 | 460 |
| 238 | 3300013308 | Ga0157375_10002668 | Ga0157375_100026682 | 460 |
| 239 | 3300014325 | Ga0163163_10000725 | Ga0163163_1000072516 | 460 |
| 240 | 3300014325 | Ga0163163_10089335 | Ga0163163_100893352 | 460 |
| 241 | 3300014968 | Ga0157379_10005710 | Ga0157379_100057102 | 460 |
| 242 | 3300014968 | Ga0157379_10177232 | Ga0157379_101772321 | 460 |
| 243 | 3300014969 | Ga0157376_10000695 | Ga0157376_100006957 | 460 |
| 244 | 3300014969 | Ga0157376_10009987 | Ga0157376_100099872 | 460 |
| 245 | 3300025321 | Ga0207656_10008282 | Ga0207656_100082822 | 460 |
| 246 | 3300025903 | Ga0207680_10000016 | Ga0207680_1000001686 | 460 |
| 247 | 3300025907 | Ga0207645_10002187 | Ga0207645_100021879 | 460 |
| 248 | 3300025909 | Ga0207705_10008322 | Ga0207705_100083225 | 460 |
| 249 | 3300025911 | Ga0207654_10001105 | Ga0207654_100011056 | 460 |
| 250 | 3300025912 | Ga0207707_10000186 | Ga0207707_100001863 | 460 |
| 251 | 3300025913 | Ga0207695_10095082 | Ga0207695_100950822 | 460 |
| 252 | 3300025914 | Ga0207671_10001104 | Ga0207671_1000110412 | 460 |
| 253 | 3300025914 | Ga0207671_10001679 | Ga0207671_1000167910 | 460 |
| 254 | 3300025914 | Ga0207671_10018409 | Ga0207671_100184093 | 460 |
| 255 | 3300025917 | Ga0207660_10005503 | Ga0207660_100055033 | 460 |
| 256 | 3300025924 | Ga0207694_10038290 | Ga0207694_100382903 | 460 |
| 257 | 3300025924 | Ga0207694_10114857 | Ga0207694_101148572 | 460 |
| 258 | 3300025933 | Ga0207706_10009188 | Ga0207706_100091882 | 460 |
| 259 | 3300025934 | Ga0207686_10064025 | Ga0207686_100640252 | 460 |
| 260 | 3300025940 | Ga0207691_10000001 | Ga0207691_10000001136 | 460 |
| 261 | 3300025941 | Ga0207711_10266609 | Ga0207711_102666091 | 460 |
| 262 | 3300025942 | Ga0207689_10041015 | Ga0207689_100410152 | 460 |
| 263 | 3300025949 | Ga0207667_10000254 | Ga0207667_1000025437 | 460 |
| 264 | 3300025949 | Ga0207667_10129638 | Ga0207667_101296382 | 460 |
| 265 | 3300025949 | Ga0207667_10195700 | Ga0207667_101957001 | 460 |
| 266 | 3300025960 | Ga0207651_10004039 | Ga0207651_100040394 | 460 |
| 267 | 3300025961 | Ga0207712_10025185 | Ga0207712_100251852 | 460 |
| 268 | 3300025961 | Ga0207712_10038906 | Ga0207712_100389062 | 460 |
| 269 | 3300025972 | Ga0207668_10001396 | Ga0207668_100013965 | 460 |
| 270 | 3300025981 | Ga0207640_10015257 | Ga0207640_100152574 | 460 |
| 271 | 3300025986 | Ga0207658_10009116 | Ga0207658_100091163 | 460 |
| 272 | 3300026023 | Ga0207677_10009357 | Ga0207677_100093572 | 460 |
| 273 | 3300026023 | Ga0207677_10033507 | Ga0207677_100335072 | 460 |
| 274 | 3300026023 | Ga0207677_10040708 | Ga0207677_100407082 | 460 |
| 275 | 3300026035 | Ga0207703_10002494 | Ga0207703_100024944 | 460 |
| 276 | 3300026035 | Ga0207703_10005428 | Ga0207703_100054287 | 460 |
| 277 | 3300026041 | Ga0207639_10006001 | Ga0207639_100060011 | 460 |
| 278 | 3300026041 | Ga0207639_10078796 | Ga0207639_100787963 | 460 |
| 279 | 3300026088 | Ga0207641_10001043 | Ga0207641_1000104317 | 460 |
| 280 | 3300026089 | Ga0207648_10008774 | Ga0207648_100087744 | 460 |
| 281 | 3300026095 | Ga0207676_10001139 | Ga0207676_1000113913 | 460 |
| 282 | 3300026095 | Ga0207676_10004696 | Ga0207676_100046963 | 460 |
| 283 | 3300026116 | Ga0207674_10006446 | Ga0207674_100064469 | 460 |
| 284 | 3300026142 | Ga0207698_10002987 | Ga0207698_100029878 | 460 |
| 285 | 3300026142 | Ga0207698_10054475 | Ga0207698_100544752 | 460 |
| 286 | 3300026142 | Ga0207698_10224343 | Ga0207698_102243432 | 460 |
| 287 | 3300028379 | Ga0268266_10000016 | Ga0268266_10000016409 | 460 |
| 288 | 3300028379 | Ga0268266_10002439 | Ga0268266_100024392 | 460 |
| 289 | 3300028381 | Ga0268264_10000621 | Ga0268264_1000062112 | 460 |
| 290 | 3300028381 | Ga0268264_10011427 | Ga0268264_100114275 | 460 |
| 291 | 3300028381 | Ga0268264_10017445 | Ga0268264_100174452 | 460 |
| 292 | 3300028794 | Ga0307515_10000107 | Ga0307515_10000107106 | 460 |
| 293 | 3300031507 | Ga0307509_10220433 | Ga0307509_102204332 | 460 |
| 294 | 3300031616 | Ga0307508_10060151 | Ga0307508_100601512 | 460 |
| 295 | 3300046524 | Ga0495648_0004442 | Ga0495648_0004442_9226_10608 | 460 |
| 296 | 3300046648 | Ga0495611_0000011 | Ga0495611_0000011_106901_108283 | 460 |
| 297 | 3300047443 | Ga0495687_000004 | Ga0495687_000004_552702_554084 | 460 |
| 298 | 3300053092 | Ga0500583_0003410 | Ga0500583_0003410_1414_2796 | 460 |
| 299 | 3300053156 | Ga0500622_0003029 | Ga0500622_0003029_8656_10038 | 460 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b2n-assembly1.cif.gz_A | latex oxygenase roxa | 0.7378 | 28 | 460 |
| 4b2n-assembly1.cif.gz_A | latex oxygenase roxa | 0.6966 | 28 | 460 |
| 6lod-assembly1.cif.gz_E | cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii | 0.6432 | 275 | 302 |
| 3vrd-assembly1.cif.gz_A | crystal structure of flavocytochrome c from thermochromatium tepidum | 0.4941 | 253 | 302 |
| 1fcd-assembly2.cif.gz_D | the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution | 0.49 | 250 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fcdD02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.7498 | 276 | 302 | 1.10.760.10 |
| 1yiqA02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6633 | 273 | 302 | 1.10.760.10 |
| 1n15B01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6411 | 271 | 302 | 1.10.760.10 |
| 1izlV00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6053 | 274 | 302 | 1.10.760.10 |
| 3lhcA00 | Mainly Beta;Roll;HIV-inactivating Protein, Cyanovirin-n;Cyanovirin-N | 0.4739 | 89 | 119 | 2.30.60.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0C1IIT7-F1-model_v4 | Cytochrome c domain-containing protein | 0.9779 | 28 | 460 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-A0A4R4E3I9-F1-model_v4 | C-type cytochrome | 0.9732 | 29 | 460 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-A0A0E9MUS7-F1-model_v4 | Cytochrome c domain-containing protein | 0.9713 | 26 | 460 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-A0A4Q5WQU5-F1-model_v4 | C-type cytochrome | 0.9706 | 49 | 460 |
GO:0004130
GO:0009055 GO:0020037 GO:0046872 |
| AF-A0A4Q5W6I5-F1-model_v4 | deleted | 0.9693 | 28 | 460 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar