F394835

General Info

Members Datasets Scaffolds Average Seq Length
299 148 299 460

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10004883|Ga0157373_100048837
Length 508
Sequence LPCGLASLHTRSAYGSGHFLWFFLCASKERTEQYQKVKEEKNIFIKITCMKKTTVILILFAAISSFTFITKFSEDKPVPIPPSKQRTNGDAKEGYSYLVTGDYVKGGLPLNIFLLGTFGQKTYLQRDGLNKNIGFAYTAIKSDNGETLVAPNCLQCHAQVFEDQLIIGLGNSLSDFTKGQKLNTANIDILEKLLKANAPKQYEASAPFINITKTIAPYLFAEVKGVNIADKLAAILVAHRDPKNFKWSDSALMPIPNELIPTDTPPWWLLKKKNAMFYNGFGRGDFGRFLMASNLLTVRDTAESRSVDEHMPDVLAYIYSLQAPEYPKTIDQSLAGKGKTIFERNCSDCHGTYGANSTYPNLLIPESIIKTDSFLYKSNYSNPQFVNWFNKSWFTKGDHPAELVPFNGYIAPPLDGIWITAPYLHNGSVPTLEALLNSKLRPQFWSRDFEHPQYDYDNPGWKYKAEEKPLNTSTYNTNLPGYGNYGHYFGDDLTDEERKAVIEYLKTL

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
142 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
143 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
144 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
145 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 1
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10000330 3300005328 Bacteria 21473
2 Ga0070683_100000286 3300005329 Bacteria 34774
3 Ga0070690_100016373 3300005330 Bacteria 4440
4 Ga0070690_100047962 3300005330 Unclassified 2719
5 Ga0070670_100052356 3300005331 Bacteria 3506
6 Ga0068869_100002167 3300005334 Bacteria 11815
7 Ga0068869_100003358 3300005334 Bacteria 9772
8 Ga0070666_10000108 3300005335 Bacteria 56931
9 Ga0070666_10002230 3300005335 Bacteria 11725
10 Ga0070666_10008727 3300005335 Bacteria 6301
11 Ga0070680_100005869 3300005336 Bacteria 9319
12 Ga0068868_100004617 3300005338 Bacteria 9662
13 Ga0068868_100009797 3300005338 Bacteria 6913
14 Ga0068868_100099400 3300005338 Bacteria 2353
15 Ga0070689_100006824 3300005340 Bacteria 7942
16 Ga0070691_10003764 3300005341 Bacteria 6856
17 Ga0070661_100000587 3300005344 Bacteria 27509
18 Ga0070661_100003896 3300005344 Bacteria 10271
19 Ga0070668_100003226 3300005347 Bacteria 12022
20 Ga0070668_100044716 3300005347 Bacteria 3397
21 Ga0070675_100094034 3300005354 Bacteria 2515
22 Ga0070671_100097102 3300005355 Bacteria 2471
23 Ga0070671_100206371 3300005355 Bacteria 1666
24 Ga0070673_100000514 3300005364 Bacteria 20769
25 Ga0070673_100006161 3300005364 Bacteria 7772
26 Ga0070673_100117252 3300005364 Bacteria 2216
27 Ga0070667_100001246 3300005367 Bacteria 23117
28 Ga0070667_100010294 3300005367 Bacteria 7727
29 Ga0070667_100045835 3300005367 Bacteria 3678
30 Ga0070667_100077102 3300005367 Bacteria 2846
31 Ga0070678_100100687 3300005456 Bacteria 2239
32 Ga0070662_100004186 3300005457 Bacteria 9092
33 Ga0070662_100058360 3300005457 Bacteria 2808
34 Ga0068867_100001763 3300005459 Bacteria 15045
35 Ga0070685_10030182 3300005466 Bacteria 3019
36 Ga0070679_100017094 3300005530 Bacteria 7012
37 Ga0070684_100000500 3300005535 Bacteria 26969
38 Ga0070684_100033137 3300005535 Bacteria 4408
39 Ga0070684_100111528 3300005535 Bacteria 2453
40 Ga0068853_100003668 3300005539 Bacteria 11773
41 Ga0070672_100001332 3300005543 Bacteria 15233
42 Ga0070665_100000008 3300005548 Bacteria 606341
43 Ga0070665_100001684 3300005548 Bacteria 25484
44 Ga0068855_100005843 3300005563 Bacteria 15020
45 Ga0068855_100007837 3300005563 Bacteria 12905
46 Ga0068855_100034235 3300005563 Bacteria 6059
47 Ga0068855_100140368 3300005563 Bacteria 2755
48 Ga0068855_100210936 3300005563 Unclassified 2182
49 Ga0070664_100000321 3300005564 Bacteria 34876
50 Ga0070664_100009066 3300005564 Bacteria 8073
51 Ga0070664_100043219 3300005564 Bacteria 3802
52 Ga0070664_100145489 3300005564 Bacteria 2090
53 Ga0068857_100001617 3300005577 Bacteria 18082
54 Ga0068857_100003983 3300005577 Bacteria 12439
55 Ga0068857_100030332 3300005577 Bacteria 4774
56 Ga0068857_100037888 3300005577 Bacteria 4271
57 Ga0068854_100017088 3300005578 Bacteria 4851
58 Ga0068854_100075584 3300005578 Bacteria 2474
59 Ga0068852_100002055 3300005616 Bacteria 13725
60 Ga0068852_100002358 3300005616 Bacteria 13008
61 Ga0068852_100112453 3300005616 Bacteria 2478
62 Ga0068852_100125210 3300005616 Bacteria 2359
63 Ga0068852_100164683 3300005616 Unclassified 2073
64 Ga0068859_100000029 3300005617 Bacteria 178422
65 Ga0068859_100030033 3300005617 Bacteria 5453
66 Ga0068859_100167859 3300005617 Bacteria 2275
67 Ga0068864_100001887 3300005618 Bacteria 17220
68 Ga0068864_100023507 3300005618 Bacteria 5176
69 Ga0068851_10003648 3300005834 Bacteria 6873
70 Ga0068863_100004766 3300005841 Bacteria 13362
71 Ga0068858_100001989 3300005842 Bacteria 20897
72 Ga0068858_100075998 3300005842 Unclassified 3120
73 Ga0068858_100099909 3300005842 Bacteria 2706
74 Ga0068860_100000059 3300005843 Bacteria 196400
75 Ga0068860_100000888 3300005843 Bacteria 33230
76 Ga0068860_100003084 3300005843 Bacteria 17232
77 Ga0068860_100015404 3300005843 Bacteria 7470
78 Ga0068860_100016463 3300005843 Bacteria 7209
79 Ga0068860_100026436 3300005843 Bacteria 5595
80 Ga0070715_10005688 3300006163 Bacteria 4181
81 Ga0097621_100002677 3300006237 Bacteria 12189
82 Ga0097621_100007373 3300006237 Bacteria 7868
83 Ga0068871_100001146 3300006358 Bacteria 17773
84 Ga0068865_100183500 3300006881 Bacteria 1613
85 Ga0097620_100000029 3300006931 Bacteria 178422
86 Ga0097620_100030034 3300006931 Bacteria 5453
87 Ga0097620_100167868 3300006931 Bacteria 2275
88 Ga0105240_10000635 3300009093 Bacteria 64838
89 Ga0105240_10001276 3300009093 Bacteria 43565
90 Ga0105240_10015788 3300009093 Bacteria 10246
91 Ga0105240_10032432 3300009093 Bacteria 6763
92 Ga0105240_10049565 3300009093 Bacteria 5299
93 Ga0105240_10054040 3300009093 Bacteria 5035
94 Ga0111539_10163848 3300009094 Bacteria 2600
95 Ga0105245_10086554 3300009098 Bacteria 2874
96 Ga0105247_10004971 3300009101 Bacteria 8450
97 Ga0105241_10000176 3300009174 Bacteria 47237
98 Ga0105241_10000468 3300009174 Bacteria 30529
99 Ga0105241_10014766 3300009174 Bacteria 5717
100 Ga0105241_10033608 3300009174 Bacteria 3850
101 Ga0105242_10083194 3300009176 Bacteria 2679
102 Ga0105248_10010536 3300009177 Bacteria 10183
103 Ga0105237_10002948 3300009545 Bacteria 20606
104 Ga0105237_10003565 3300009545 Bacteria 18450
105 Ga0105237_10005809 3300009545 Bacteria 13841
106 Ga0105237_10013969 3300009545 Bacteria 8403
107 Ga0105238_10076990 3300009551 Unclassified 3328
108 Ga0105249_10022097 3300009553 Bacteria 5698
109 Ga0105249_10115179 3300009553 Unclassified 2546
110 Ga0105249_10116721 3300009553 Bacteria 2531
111 Ga0105239_10000368 3300010375 Bacteria 66186
112 Ga0105239_10001098 3300010375 Bacteria 37369
113 Ga0105239_10014739 3300010375 Bacteria 8669
114 Ga0105239_10016867 3300010375 Bacteria 8072
115 Ga0105239_10031635 3300010375 Bacteria 5817
116 Ga0105239_10045454 3300010375 Bacteria 4812
117 Ga0105239_10074811 3300010375 Bacteria 3724
118 Ga0105239_10212132 3300010375 Bacteria 2171
119 Ga0105246_10013173 3300011119 Bacteria 5178
120 Ga0157373_10004883 3300013100 Bacteria 10090
121 Ga0157373_10027129 3300013100 Unclassified 4133
122 Ga0157371_10062662 3300013102 Unclassified 2636
123 Ga0157370_10080827 3300013104 Bacteria 3060
124 Ga0157374_10000009 3300013296 Bacteria 564330
125 Ga0157374_10000719 3300013296 Bacteria 28944
126 Ga0157374_10002649 3300013296 Bacteria 15078
127 Ga0157374_10237583 3300013296 Unclassified 1791
128 Ga0157378_10001526 3300013297 Bacteria 20962
129 Ga0157378_10026410 3300013297 Bacteria 5119
130 Ga0157378_10033354 3300013297 Bacteria 4551
131 Ga0157378_10081529 3300013297 Bacteria 2924
132 Ga0163162_10000548 3300013306 Bacteria 34707
133 Ga0163162_10000921 3300013306 Bacteria 27280
134 Ga0163162_10004967 3300013306 Bacteria 12809
135 Ga0163162_10021258 3300013306 Bacteria 6387
136 Ga0163162_10093377 3300013306 Bacteria 3094
137 Ga0163162_10129643 3300013306 Bacteria 2630
138 Ga0157372_10000983 3300013307 Bacteria 31129
139 Ga0157372_10013075 3300013307 Bacteria 8856
140 Ga0157372_10072301 3300013307 Bacteria 3887
141 Ga0157372_10089224 3300013307 Unclassified 3503
142 Ga0157375_10002668 3300013308 Bacteria 15450
143 Ga0157375_10046420 3300013308 Bacteria 4235
144 Ga0157375_10127429 3300013308 Bacteria 2662
145 Ga0163163_10000725 3300014325 Bacteria 28014
146 Ga0163163_10005950 3300014325 Bacteria 10612
147 Ga0163163_10006754 3300014325 Bacteria 10058
148 Ga0163163_10089335 3300014325 Unclassified 3093
149 Ga0157380_10006592 3300014326 Bacteria 8191
150 Ga0157379_10005710 3300014968 Bacteria 10701
151 Ga0157379_10113222 3300014968 Bacteria 2438
152 Ga0157379_10177232 3300014968 Bacteria 1925
153 Ga0157376_10000695 3300014969 Bacteria 21776
154 Ga0157376_10006626 3300014969 Bacteria 8198
155 Ga0157376_10009987 3300014969 Bacteria 6925
156 Ga0157376_10023944 3300014969 Bacteria 4788
157 Ga0163161_10002189 3300017792 Bacteria 14093
158 Ga0163161_10079746 3300017792 Bacteria 2408
159 Ga0207656_10008282 3300025321 Bacteria 3819
160 Ga0207710_10000574 3300025900 Bacteria 21862
161 Ga0207680_10000016 3300025903 Bacteria 134657
162 Ga0207680_10000684 3300025903 Bacteria 16006
163 Ga0207680_10031735 3300025903 Bacteria 2995
164 Ga0207647_10037184 3300025904 Unclassified 3089
165 Ga0207645_10002187 3300025907 Bacteria 15608
166 Ga0207645_10032541 3300025907 Bacteria 3352
167 Ga0207705_10008322 3300025909 Bacteria 7570
168 Ga0207654_10001105 3300025911 Bacteria 14592
169 Ga0207707_10000186 3300025912 Bacteria 65484
170 Ga0207695_10000051 3300025913 Bacteria 399641
171 Ga0207695_10000446 3300025913 Bacteria 90493
172 Ga0207695_10013059 3300025913 Bacteria 9917
173 Ga0207695_10095082 3300025913 Bacteria 2985
174 Ga0207671_10001104 3300025914 Bacteria 32550
175 Ga0207671_10001679 3300025914 Bacteria 25113
176 Ga0207671_10005043 3300025914 Bacteria 12331
177 Ga0207671_10018409 3300025914 Bacteria 5360
178 Ga0207660_10005503 3300025917 Bacteria 8228
179 Ga0207649_10004446 3300025920 Bacteria 7607
180 Ga0207649_10006558 3300025920 Bacteria 6322
181 Ga0207649_10063989 3300025920 Bacteria 2324
182 Ga0207694_10038290 3300025924 Unclassified 3687
183 Ga0207694_10114857 3300025924 Bacteria 2144
184 Ga0207650_10001312 3300025925 Bacteria 18005
185 Ga0207650_10022345 3300025925 Bacteria 4475
186 Ga0207659_10054015 3300025926 Bacteria 2867
187 Ga0207644_10058235 3300025931 Bacteria 2792
188 Ga0207644_10085174 3300025931 Bacteria 2344
189 Ga0207644_10092574 3300025931 Bacteria 2256
190 Ga0207706_10001127 3300025933 Bacteria 27189
191 Ga0207706_10009188 3300025933 Bacteria 9084
192 Ga0207706_10011656 3300025933 Bacteria 8014
193 Ga0207686_10064025 3300025934 Unclassified 2340
194 Ga0207691_10000001 3300025940 Bacteria 220829
195 Ga0207711_10266609 3300025941 Bacteria 1575
196 Ga0207689_10017213 3300025942 Bacteria 6117
197 Ga0207689_10017526 3300025942 Bacteria 6055
198 Ga0207689_10041015 3300025942 Bacteria 3830
199 Ga0207661_10003520 3300025944 Bacteria 10883
200 Ga0207661_10046436 3300025944 Bacteria 3444
201 Ga0207679_10004417 3300025945 Bacteria 8757
202 Ga0207679_10006723 3300025945 Bacteria 7282
203 Ga0207679_10007053 3300025945 Bacteria 7125
204 Ga0207679_10090867 3300025945 Bacteria 2361
205 Ga0207667_10000254 3300025949 Bacteria 75138
206 Ga0207667_10018631 3300025949 Bacteria 7781
207 Ga0207667_10129638 3300025949 Unclassified 2597
208 Ga0207667_10195700 3300025949 Bacteria 2074
209 Ga0207651_10004039 3300025960 Bacteria 7304
210 Ga0207712_10025185 3300025961 Bacteria 3951
211 Ga0207712_10028969 3300025961 Bacteria 3710
212 Ga0207712_10038906 3300025961 Bacteria 3255
213 Ga0207712_10064108 3300025961 Unclassified 2618
214 Ga0207668_10001396 3300025972 Bacteria 14227
215 Ga0207640_10015257 3300025981 Unclassified 4445
216 Ga0207658_10009116 3300025986 Bacteria 6731
217 Ga0207658_10099781 3300025986 Bacteria 2272
218 Ga0207677_10001414 3300026023 Bacteria 12783
219 Ga0207677_10009357 3300026023 Bacteria 5513
220 Ga0207677_10033507 3300026023 Bacteria 3316
221 Ga0207677_10040708 3300026023 Bacteria 3066
222 Ga0207677_10185365 3300026023 Bacteria 1641
223 Ga0207703_10002494 3300026035 Bacteria 15954
224 Ga0207703_10005428 3300026035 Bacteria 10258
225 Ga0207703_10016366 3300026035 Bacteria 5781
226 Ga0207703_10159404 3300026035 Bacteria 1975
227 Ga0207639_10005720 3300026041 Bacteria 8418
228 Ga0207639_10006001 3300026041 Bacteria 8240
229 Ga0207639_10078796 3300026041 Bacteria 2602
230 Ga0207678_10031719 3300026067 Bacteria 4607
231 Ga0207641_10001043 3300026088 Bacteria 28025
232 Ga0207648_10008774 3300026089 Bacteria 9743
233 Ga0207648_10033374 3300026089 Bacteria 4540
234 Ga0207648_10097645 3300026089 Bacteria 2571
235 Ga0207676_10001139 3300026095 Bacteria 20054
236 Ga0207676_10002602 3300026095 Bacteria 12864
237 Ga0207676_10004696 3300026095 Bacteria 9679
238 Ga0207674_10005684 3300026116 Bacteria 14785
239 Ga0207674_10006446 3300026116 Bacteria 13797
240 Ga0207674_10009733 3300026116 Bacteria 10952
241 Ga0207675_100189955 3300026118 Bacteria 1970
242 Ga0207698_10002987 3300026142 Bacteria 10146
243 Ga0207698_10054475 3300026142 Unclassified 3078
244 Ga0207698_10058707 3300026142 Bacteria 2983
245 Ga0207698_10136643 3300026142 Unclassified 2104
246 Ga0207698_10222289 3300026142 Unclassified 1707
247 Ga0207698_10224343 3300026142 Bacteria 1701
248 Ga0268266_10000016 3300028379 Bacteria 629101
249 Ga0268266_10002439 3300028379 Bacteria 19963
250 Ga0268264_10000621 3300028381 Bacteria 42149
251 Ga0268264_10011427 3300028381 Bacteria 7332
252 Ga0268264_10016019 3300028381 Bacteria 6142
253 Ga0268264_10017445 3300028381 Bacteria 5878
254 Ga0268264_10019524 3300028381 Bacteria 5537
255 Ga0268264_10106926 3300028381 Unclassified 2443
256 Ga0307515_10000107 3300028794 Bacteria 197046
257 Ga0265338_10044779 3300028800 Bacteria 4079
258 Ga0307511_10001696 3300030521 Bacteria 23198
259 Ga0265327_10000152 3300031251 Bacteria 149065
260 Ga0307513_10019495 3300031456 Bacteria 8075
261 Ga0307509_10220433 3300031507 Bacteria 1711
262 Ga0307508_10000903 3300031616 Bacteria 34590
263 Ga0307508_10060151 3300031616 Bacteria 3360
264 Ga0307413_10008199 3300031824 Unclassified 4914
265 Ga0307410_10025216 3300031852 Unclassified 3727
266 Ga0307415_100035246 3300032126 Unclassified 3267
267 Ga0373955_0034708 3300035172 Bacteria 2667
268 Ga0373927_0103673 3300035695 Bacteria 1851
269 Ga0373933_0148373 3300035724 Unclassified 1484
270 Ga0373937_0006351 3300036401 Bacteria 10194
271 Ga0395905_0183961 3300037471 Bacteria 1962
272 Ga0466969_0001016 3300044656 Bacteria 15175
273 Ga0466972_0047269 3300044658 Bacteria 2081
274 Ga0466966_0023693 3300044684 Bacteria 4017
275 Ga0453684_0021610 3300044712 Bacteria 9601
276 Ga0453684_0079960 3300044712 Bacteria 4084
277 Ga0466959_0000077 3300045049 Bacteria 62293
278 Ga0495638_0016480 3300046460 Bacteria 4949
279 Ga0495638_0029377 3300046460 Bacteria 3545
280 Ga0495582_0095214 3300046473 Bacteria 1663
281 Ga0495630_0023561 3300046517 Bacteria 4551
282 Ga0495648_0004442 3300046524 Bacteria 11982
283 Ga0495611_0000011 3300046648 Bacteria 146643
284 Ga0495658_0034504 3300046683 Bacteria 2777
285 Ga0495674_0017934 3300047319 Bacteria 6590
286 Ga0495687_000004 3300047443 Bacteria 779298
287 Ga0496110_0047272 3300048913 Bacteria 3768
288 Ga0496111_0274212 3300048914 Bacteria 1251
289 Ga0496114_0126031 3300048917 Bacteria 2208
290 Ga0501067_0016619 3300049583 Bacteria 4066
291 Ga0501070_0025564 3300049586 Bacteria 4952
292 Ga0501225_0004519 3300049705 Bacteria 4141
293 Ga0501272_002689 3300049769 Bacteria 1769
294 Ga0500578_0000120 3300053086 Bacteria 95463
295 Ga0500583_0003410 3300053092 Unclassified 4993
296 Ga0500652_052739 3300053131 Bacteria 1663
297 Ga0500616_0006846 3300053153 Bacteria 7367
298 Ga0500622_0003029 3300053156 Bacteria 11611
299 Ga0501082_0005765 3300060353 Bacteria 10749

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0274212 Ga0496111_0274212_19_1230 396
2 3300009551 Ga0105238_10076990 Ga0105238_100769902 422
3 3300013307 Ga0157372_10000983 Ga0157372_1000098311 422
4 3300025914 Ga0207671_10005043 Ga0207671_100050433 423
5 3300025903 Ga0207680_10000684 Ga0207680_100006842 426
6 3300013308 Ga0157375_10127429 Ga0157375_101274292 443
7 3300044712 Ga0453684_0021610 Ga0453684_0021610_4039_5415 443
8 3300046473 Ga0495582_0095214 Ga0495582_0095214_40_1422 443
9 3300046683 Ga0495658_0034504 Ga0495658_0034504_810_2192 443
10 3300047319 Ga0495674_0017934 Ga0495674_0017934_5186_6568 443
11 3300014969 Ga0157376_10006626 Ga0157376_100066263 444
12 3300031456 Ga0307513_10019495 Ga0307513_100194951 444
13 3300031251 Ga0265327_10000152 Ga0265327_1000015281 445
14 3300035724 Ga0373933_0148373 Ga0373933_0148373_23_1405 445
15 3300014326 Ga0157380_10006592 Ga0157380_100065925 446
16 3300013307 Ga0157372_10089224 Ga0157372_100892241 447
17 3300049583 Ga0501067_0016619 Ga0501067_0016619_1859_3241 447
18 3300049586 Ga0501070_0025564 Ga0501070_0025564_520_1902 447
19 3300060353 Ga0501082_0005765 Ga0501082_0005765_4085_5467 447
20 3300025945 Ga0207679_10004417 Ga0207679_100044177 448
21 3300013296 Ga0157374_10000009 Ga0157374_10000009358 449
22 3300025931 Ga0207644_10092574 Ga0207644_100925741 449
23 3300006358 Ga0068871_100001146 Ga0068871_10000114610 450
24 3300009174 Ga0105241_10000176 Ga0105241_1000017634 450
25 3300013296 Ga0157374_10237583 Ga0157374_102375831 450
26 3300013306 Ga0163162_10004967 Ga0163162_100049672 450
27 3300053153 Ga0500616_0006846 Ga0500616_0006846_3900_5258 450
28 3300025961 Ga0207712_10028969 Ga0207712_100289691 451
29 3300030521 Ga0307511_10001696 Ga0307511_1000169617 451
30 3300009545 Ga0105237_10002948 Ga0105237_100029488 452
31 3300010375 Ga0105239_10000368 Ga0105239_1000036811 452
32 3300046460 Ga0495638_0016480 Ga0495638_0016480_1457_2839 452
33 3300009093 Ga0105240_10000635 Ga0105240_1000063543 454
34 3300025913 Ga0207695_10000446 Ga0207695_1000044611 454
35 3300013297 Ga0157378_10001526 Ga0157378_100015264 455
36 3300028800 Ga0265338_10044779 Ga0265338_100447793 455
37 3300005329 Ga0070683_100000286 Ga0070683_1000002866 456
38 3300005330 Ga0070690_100016373 Ga0070690_1000163733 456
39 3300005330 Ga0070690_100047962 Ga0070690_1000479621 456
40 3300005334 Ga0068869_100003358 Ga0068869_1000033583 456
41 3300005335 Ga0070666_10008727 Ga0070666_100087274 456
42 3300005338 Ga0068868_100099400 Ga0068868_1000994001 456
43 3300005340 Ga0070689_100006824 Ga0070689_1000068246 456
44 3300005344 Ga0070661_100000587 Ga0070661_10000058719 456
45 3300005344 Ga0070661_100003896 Ga0070661_1000038962 456
46 3300005364 Ga0070673_100006161 Ga0070673_1000061613 456
47 3300005367 Ga0070667_100045835 Ga0070667_1000458353 456
48 3300005367 Ga0070667_100077102 Ga0070667_1000771022 456
49 3300005456 Ga0070678_100100687 Ga0070678_1001006872 456
50 3300005457 Ga0070662_100004186 Ga0070662_1000041863 456
51 3300005466 Ga0070685_10030182 Ga0070685_100301823 456
52 3300005535 Ga0070684_100000500 Ga0070684_1000005004 456
53 3300005535 Ga0070684_100033137 Ga0070684_1000331374 456
54 3300005539 Ga0068853_100003668 Ga0068853_1000036683 456
55 3300005563 Ga0068855_100005843 Ga0068855_10000584311 456
56 3300005564 Ga0070664_100000321 Ga0070664_10000032121 456
57 3300005564 Ga0070664_100009066 Ga0070664_1000090666 456
58 3300005564 Ga0070664_100043219 Ga0070664_1000432194 456
59 3300005564 Ga0070664_100145489 Ga0070664_1001454892 456
60 3300005577 Ga0068857_100001617 Ga0068857_10000161713 456
61 3300005577 Ga0068857_100037888 Ga0068857_1000378882 456
62 3300005578 Ga0068854_100075584 Ga0068854_1000755842 456
63 3300005616 Ga0068852_100112453 Ga0068852_1001124531 456
64 3300005616 Ga0068852_100164683 Ga0068852_1001646832 456
65 3300005617 Ga0068859_100030033 Ga0068859_1000300333 456
66 3300005617 Ga0068859_100167859 Ga0068859_1001678592 456
67 3300005618 Ga0068864_100023507 Ga0068864_1000235074 456
68 3300005842 Ga0068858_100099909 Ga0068858_1000999092 456
69 3300006163 Ga0070715_10005688 Ga0070715_100056884 456
70 3300006931 Ga0097620_100030034 Ga0097620_1000300343 456
71 3300006931 Ga0097620_100167868 Ga0097620_1001678682 456
72 3300009174 Ga0105241_10014766 Ga0105241_100147662 456
73 3300009545 Ga0105237_10005809 Ga0105237_100058092 456
74 3300009553 Ga0105249_10115179 Ga0105249_101151792 456
75 3300010375 Ga0105239_10014739 Ga0105239_100147393 456
76 3300010375 Ga0105239_10045454 Ga0105239_100454542 456
77 3300010375 Ga0105239_10074811 Ga0105239_100748112 456
78 3300013100 Ga0157373_10027129 Ga0157373_100271292 456
79 3300013296 Ga0157374_10000719 Ga0157374_100007197 456
80 3300013306 Ga0163162_10093377 Ga0163162_100933772 456
81 3300013306 Ga0163162_10129643 Ga0163162_101296432 456
82 3300013308 Ga0157375_10046420 Ga0157375_100464202 456
83 3300014325 Ga0163163_10006754 Ga0163163_100067545 456
84 3300014968 Ga0157379_10113222 Ga0157379_101132222 456
85 3300014969 Ga0157376_10023944 Ga0157376_100239441 456
86 3300017792 Ga0163161_10002189 Ga0163161_100021898 456
87 3300017792 Ga0163161_10079746 Ga0163161_100797462 456
88 3300025903 Ga0207680_10031735 Ga0207680_100317351 456
89 3300025904 Ga0207647_10037184 Ga0207647_100371843 456
90 3300025907 Ga0207645_10032541 Ga0207645_100325412 456
91 3300025913 Ga0207695_10013059 Ga0207695_100130592 456
92 3300025920 Ga0207649_10004446 Ga0207649_100044461 456
93 3300025920 Ga0207649_10006558 Ga0207649_100065585 456
94 3300025920 Ga0207649_10063989 Ga0207649_100639892 456
95 3300025931 Ga0207644_10058235 Ga0207644_100582352 456
96 3300025933 Ga0207706_10001127 Ga0207706_1000112713 456
97 3300025933 Ga0207706_10011656 Ga0207706_100116565 456
98 3300025942 Ga0207689_10017213 Ga0207689_100172132 456
99 3300025942 Ga0207689_10017526 Ga0207689_100175264 456
100 3300025944 Ga0207661_10003520 Ga0207661_100035204 456
101 3300025945 Ga0207679_10006723 Ga0207679_100067234 456
102 3300025945 Ga0207679_10007053 Ga0207679_100070534 456
103 3300025945 Ga0207679_10090867 Ga0207679_100908671 456
104 3300025949 Ga0207667_10018631 Ga0207667_100186314 456
105 3300025961 Ga0207712_10064108 Ga0207712_100641082 456
106 3300025986 Ga0207658_10099781 Ga0207658_100997812 456
107 3300026023 Ga0207677_10185365 Ga0207677_101853651 456
108 3300026035 Ga0207703_10016366 Ga0207703_100163664 456
109 3300026035 Ga0207703_10159404 Ga0207703_101594042 456
110 3300026041 Ga0207639_10005720 Ga0207639_100057205 456
111 3300026067 Ga0207678_10031719 Ga0207678_100317194 456
112 3300026089 Ga0207648_10033374 Ga0207648_100333742 456
113 3300026089 Ga0207648_10097645 Ga0207648_100976452 456
114 3300026095 Ga0207676_10002602 Ga0207676_100026026 456
115 3300026116 Ga0207674_10005684 Ga0207674_100056844 456
116 3300026116 Ga0207674_10009733 Ga0207674_100097333 456
117 3300026142 Ga0207698_10058707 Ga0207698_100587073 456
118 3300026142 Ga0207698_10222289 Ga0207698_102222892 456
119 3300028381 Ga0268264_10106926 Ga0268264_101069262 456
120 3300035172 Ga0373955_0034708 Ga0373955_0034708_937_2328 456
121 3300035695 Ga0373927_0103673 Ga0373927_0103673_52_1431 456
122 3300036401 Ga0373937_0006351 Ga0373937_0006351_3710_5101 456
123 3300044656 Ga0466969_0001016 Ga0466969_0001016_3227_4606 456
124 3300044658 Ga0466972_0047269 Ga0466972_0047269_82_1461 456
125 3300044684 Ga0466966_0023693 Ga0466966_0023693_554_1933 456
126 3300045049 Ga0466959_0000077 Ga0466959_0000077_58623_60002 456
127 3300046517 Ga0495630_0023561 Ga0495630_0023561_2701_4092 456
128 3300048913 Ga0496110_0047272 Ga0496110_0047272_2224_3615 456
129 3300048917 Ga0496114_0126031 Ga0496114_0126031_675_2066 456
130 3300031616 Ga0307508_10000903 Ga0307508_1000090311 457
131 3300044712 Ga0453684_0079960 Ga0453684_0079960_1156_2538 457
132 3300046460 Ga0495638_0029377 Ga0495638_0029377_1208_2590 457
133 3300049705 Ga0501225_0004519 Ga0501225_0004519_1196_2578 457
134 3300053086 Ga0500578_0000120 Ga0500578_0000120_79043_80425 457
135 3300053131 Ga0500652_052739 Ga0500652_052739_111_1493 457
136 3300005354 Ga0070675_100094034 Ga0070675_1000940341 458
137 3300005355 Ga0070671_100097102 Ga0070671_1000971021 458
138 3300005577 Ga0068857_100030332 Ga0068857_1000303323 458
139 3300005616 Ga0068852_100125210 Ga0068852_1001252103 458
140 3300005843 Ga0068860_100016463 Ga0068860_1000164634 458
141 3300009101 Ga0105247_10004971 Ga0105247_100049715 458
142 3300009553 Ga0105249_10116721 Ga0105249_101167212 458
143 3300013100 Ga0157373_10004883 Ga0157373_100048837 458
144 3300013102 Ga0157371_10062662 Ga0157371_100626621 458
145 3300013307 Ga0157372_10072301 Ga0157372_100723012 458
146 3300014325 Ga0163163_10005950 Ga0163163_100059502 458
147 3300025900 Ga0207710_10000574 Ga0207710_1000057410 458
148 3300025925 Ga0207650_10001312 Ga0207650_100013128 458
149 3300025926 Ga0207659_10054015 Ga0207659_100540152 458
150 3300025931 Ga0207644_10085174 Ga0207644_100851742 458
151 3300026118 Ga0207675_100189955 Ga0207675_1001899552 458
152 3300026142 Ga0207698_10136643 Ga0207698_101366432 458
153 3300028381 Ga0268264_10016019 Ga0268264_100160194 458
154 3300031824 Ga0307413_10008199 Ga0307413_100081992 458
155 3300031852 Ga0307410_10025216 Ga0307410_100252162 458
156 3300032126 Ga0307415_100035246 Ga0307415_1000352462 458
157 3300037471 Ga0395905_0183961 Ga0395905_0183961_436_1815 458
158 3300049769 Ga0501272_002689 Ga0501272_002689_220_1599 458
159 3300005331 Ga0070670_100052356 Ga0070670_1000523562 459
160 3300005338 Ga0068868_100009797 Ga0068868_1000097976 459
161 3300005355 Ga0070671_100206371 Ga0070671_1002063711 459
162 3300005364 Ga0070673_100117252 Ga0070673_1001172522 459
163 3300005535 Ga0070684_100111528 Ga0070684_1001115281 459
164 3300005563 Ga0068855_100210936 Ga0068855_1002109361 459
165 3300005843 Ga0068860_100026436 Ga0068860_1000264363 459
166 3300009093 Ga0105240_10032432 Ga0105240_100324324 459
167 3300013104 Ga0157370_10080827 Ga0157370_100808271 459
168 3300013297 Ga0157378_10081529 Ga0157378_100815291 459
169 3300013307 Ga0157372_10013075 Ga0157372_100130752 459
170 3300025913 Ga0207695_10000051 Ga0207695_10000051261 459
171 3300025925 Ga0207650_10022345 Ga0207650_100223452 459
172 3300025944 Ga0207661_10046436 Ga0207661_100464361 459
173 3300026023 Ga0207677_10001414 Ga0207677_100014146 459
174 3300028381 Ga0268264_10019524 Ga0268264_100195242 459
175 3300005328 Ga0070676_10000330 Ga0070676_100003308 460
176 3300005334 Ga0068869_100002167 Ga0068869_1000021678 460
177 3300005335 Ga0070666_10000108 Ga0070666_1000010813 460
178 3300005335 Ga0070666_10002230 Ga0070666_100022303 460
179 3300005336 Ga0070680_100005869 Ga0070680_1000058695 460
180 3300005338 Ga0068868_100004617 Ga0068868_1000046175 460
181 3300005341 Ga0070691_10003764 Ga0070691_100037643 460
182 3300005347 Ga0070668_100003226 Ga0070668_1000032262 460
183 3300005347 Ga0070668_100044716 Ga0070668_1000447163 460
184 3300005364 Ga0070673_100000514 Ga0070673_1000005148 460
185 3300005367 Ga0070667_100001246 Ga0070667_1000012467 460
186 3300005367 Ga0070667_100010294 Ga0070667_1000102943 460
187 3300005457 Ga0070662_100058360 Ga0070662_1000583602 460
188 3300005459 Ga0068867_100001763 Ga0068867_1000017638 460
189 3300005530 Ga0070679_100017094 Ga0070679_1000170943 460
190 3300005543 Ga0070672_100001332 Ga0070672_1000013324 460
191 3300005548 Ga0070665_100000008 Ga0070665_100000008411 460
192 3300005548 Ga0070665_100001684 Ga0070665_1000016849 460
193 3300005563 Ga0068855_100007837 Ga0068855_1000078374 460
194 3300005563 Ga0068855_100034235 Ga0068855_1000342353 460
195 3300005563 Ga0068855_100140368 Ga0068855_1001403682 460
196 3300005577 Ga0068857_100003983 Ga0068857_1000039839 460
197 3300005578 Ga0068854_100017088 Ga0068854_1000170884 460
198 3300005616 Ga0068852_100002055 Ga0068852_1000020552 460
199 3300005616 Ga0068852_100002358 Ga0068852_1000023582 460
200 3300005617 Ga0068859_100000029 Ga0068859_10000002925 460
201 3300005618 Ga0068864_100001887 Ga0068864_1000018877 460
202 3300005834 Ga0068851_10003648 Ga0068851_100036483 460
203 3300005841 Ga0068863_100004766 Ga0068863_1000047667 460
204 3300005842 Ga0068858_100001989 Ga0068858_1000019898 460
205 3300005842 Ga0068858_100075998 Ga0068858_1000759982 460
206 3300005843 Ga0068860_100000059 Ga0068860_10000005912 460
207 3300005843 Ga0068860_100000888 Ga0068860_10000088820 460
208 3300005843 Ga0068860_100003084 Ga0068860_1000030847 460
209 3300005843 Ga0068860_100015404 Ga0068860_1000154043 460
210 3300006237 Ga0097621_100002677 Ga0097621_10000267711 460
211 3300006237 Ga0097621_100007373 Ga0097621_1000073733 460
212 3300006881 Ga0068865_100183500 Ga0068865_1001835001 460
213 3300006931 Ga0097620_100000029 Ga0097620_10000002925 460
214 3300009093 Ga0105240_10001276 Ga0105240_1000127632 460
215 3300009093 Ga0105240_10015788 Ga0105240_100157882 460
216 3300009093 Ga0105240_10049565 Ga0105240_100495654 460
217 3300009093 Ga0105240_10054040 Ga0105240_100540402 460
218 3300009094 Ga0111539_10163848 Ga0111539_101638483 460
219 3300009098 Ga0105245_10086554 Ga0105245_100865543 460
220 3300009174 Ga0105241_10000468 Ga0105241_1000046811 460
221 3300009174 Ga0105241_10033608 Ga0105241_100336082 460
222 3300009176 Ga0105242_10083194 Ga0105242_100831942 460
223 3300009177 Ga0105248_10010536 Ga0105248_100105364 460
224 3300009545 Ga0105237_10003565 Ga0105237_100035652 460
225 3300009545 Ga0105237_10013969 Ga0105237_100139694 460
226 3300009553 Ga0105249_10022097 Ga0105249_100220972 460
227 3300010375 Ga0105239_10001098 Ga0105239_1000109822 460
228 3300010375 Ga0105239_10016867 Ga0105239_100168673 460
229 3300010375 Ga0105239_10031635 Ga0105239_100316352 460
230 3300010375 Ga0105239_10212132 Ga0105239_102121322 460
231 3300011119 Ga0105246_10013173 Ga0105246_100131732 460
232 3300013296 Ga0157374_10002649 Ga0157374_100026495 460
233 3300013297 Ga0157378_10026410 Ga0157378_100264102 460
234 3300013297 Ga0157378_10033354 Ga0157378_100333544 460
235 3300013306 Ga0163162_10000548 Ga0163162_100005483 460
236 3300013306 Ga0163162_10000921 Ga0163162_100009214 460
237 3300013306 Ga0163162_10021258 Ga0163162_100212582 460
238 3300013308 Ga0157375_10002668 Ga0157375_100026682 460
239 3300014325 Ga0163163_10000725 Ga0163163_1000072516 460
240 3300014325 Ga0163163_10089335 Ga0163163_100893352 460
241 3300014968 Ga0157379_10005710 Ga0157379_100057102 460
242 3300014968 Ga0157379_10177232 Ga0157379_101772321 460
243 3300014969 Ga0157376_10000695 Ga0157376_100006957 460
244 3300014969 Ga0157376_10009987 Ga0157376_100099872 460
245 3300025321 Ga0207656_10008282 Ga0207656_100082822 460
246 3300025903 Ga0207680_10000016 Ga0207680_1000001686 460
247 3300025907 Ga0207645_10002187 Ga0207645_100021879 460
248 3300025909 Ga0207705_10008322 Ga0207705_100083225 460
249 3300025911 Ga0207654_10001105 Ga0207654_100011056 460
250 3300025912 Ga0207707_10000186 Ga0207707_100001863 460
251 3300025913 Ga0207695_10095082 Ga0207695_100950822 460
252 3300025914 Ga0207671_10001104 Ga0207671_1000110412 460
253 3300025914 Ga0207671_10001679 Ga0207671_1000167910 460
254 3300025914 Ga0207671_10018409 Ga0207671_100184093 460
255 3300025917 Ga0207660_10005503 Ga0207660_100055033 460
256 3300025924 Ga0207694_10038290 Ga0207694_100382903 460
257 3300025924 Ga0207694_10114857 Ga0207694_101148572 460
258 3300025933 Ga0207706_10009188 Ga0207706_100091882 460
259 3300025934 Ga0207686_10064025 Ga0207686_100640252 460
260 3300025940 Ga0207691_10000001 Ga0207691_10000001136 460
261 3300025941 Ga0207711_10266609 Ga0207711_102666091 460
262 3300025942 Ga0207689_10041015 Ga0207689_100410152 460
263 3300025949 Ga0207667_10000254 Ga0207667_1000025437 460
264 3300025949 Ga0207667_10129638 Ga0207667_101296382 460
265 3300025949 Ga0207667_10195700 Ga0207667_101957001 460
266 3300025960 Ga0207651_10004039 Ga0207651_100040394 460
267 3300025961 Ga0207712_10025185 Ga0207712_100251852 460
268 3300025961 Ga0207712_10038906 Ga0207712_100389062 460
269 3300025972 Ga0207668_10001396 Ga0207668_100013965 460
270 3300025981 Ga0207640_10015257 Ga0207640_100152574 460
271 3300025986 Ga0207658_10009116 Ga0207658_100091163 460
272 3300026023 Ga0207677_10009357 Ga0207677_100093572 460
273 3300026023 Ga0207677_10033507 Ga0207677_100335072 460
274 3300026023 Ga0207677_10040708 Ga0207677_100407082 460
275 3300026035 Ga0207703_10002494 Ga0207703_100024944 460
276 3300026035 Ga0207703_10005428 Ga0207703_100054287 460
277 3300026041 Ga0207639_10006001 Ga0207639_100060011 460
278 3300026041 Ga0207639_10078796 Ga0207639_100787963 460
279 3300026088 Ga0207641_10001043 Ga0207641_1000104317 460
280 3300026089 Ga0207648_10008774 Ga0207648_100087744 460
281 3300026095 Ga0207676_10001139 Ga0207676_1000113913 460
282 3300026095 Ga0207676_10004696 Ga0207676_100046963 460
283 3300026116 Ga0207674_10006446 Ga0207674_100064469 460
284 3300026142 Ga0207698_10002987 Ga0207698_100029878 460
285 3300026142 Ga0207698_10054475 Ga0207698_100544752 460
286 3300026142 Ga0207698_10224343 Ga0207698_102243432 460
287 3300028379 Ga0268266_10000016 Ga0268266_10000016409 460
288 3300028379 Ga0268266_10002439 Ga0268266_100024392 460
289 3300028381 Ga0268264_10000621 Ga0268264_1000062112 460
290 3300028381 Ga0268264_10011427 Ga0268264_100114275 460
291 3300028381 Ga0268264_10017445 Ga0268264_100174452 460
292 3300028794 Ga0307515_10000107 Ga0307515_10000107106 460
293 3300031507 Ga0307509_10220433 Ga0307509_102204332 460
294 3300031616 Ga0307508_10060151 Ga0307508_100601512 460
295 3300046524 Ga0495648_0004442 Ga0495648_0004442_9226_10608 460
296 3300046648 Ga0495611_0000011 Ga0495611_0000011_106901_108283 460
297 3300047443 Ga0495687_000004 Ga0495687_000004_552702_554084 460
298 3300053092 Ga0500583_0003410 Ga0500583_0003410_1414_2796 460
299 3300053156 Ga0500622_0003029 Ga0500622_0003029_8656_10038 460

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21419

RoxA-like_Cyt-c

RoxA-like, cytochrome c-like

408

446

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2n-assembly1.cif.gz_A latex oxygenase roxa 0.7378 28 460
4b2n-assembly1.cif.gz_A latex oxygenase roxa 0.6966 28 460
6lod-assembly1.cif.gz_E cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.6432 275 302
3vrd-assembly1.cif.gz_A crystal structure of flavocytochrome c from thermochromatium tepidum 0.4941 253 302
1fcd-assembly2.cif.gz_D the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution 0.49 250 302
ID Description Score Start End Superfamily
1fcdD02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7498 276 302 1.10.760.10
1yiqA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6633 273 302 1.10.760.10
1n15B01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6411 271 302 1.10.760.10
1izlV00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6053 274 302 1.10.760.10
3lhcA00 Mainly Beta;Roll;HIV-inactivating Protein, Cyanovirin-n;Cyanovirin-N 0.4739 89 119 2.30.60.10
ID Description Score Start End GO Terms
AF-A0A0C1IIT7-F1-model_v4 Cytochrome c domain-containing protein 0.9779 28 460 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A4R4E3I9-F1-model_v4 C-type cytochrome 0.9732 29 460 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A0E9MUS7-F1-model_v4 Cytochrome c domain-containing protein 0.9713 26 460 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A4Q5WQU5-F1-model_v4 C-type cytochrome 0.9706 49 460 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A4Q5W6I5-F1-model_v4 deleted 0.9693 28 460

Feature Viewer

pLDDT pTM Quality
82.97 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map