F395341
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 190 | 293 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10696594|Ga0105243_106965942 |
| Length | 249 |
| Sequence | VTGSEPQASIAGVPQNPETGSMATTGEGPIAGTAGGSADARAASQGGPPYDTDRTWTLPNLLSMLRLAGAPFVLWLILGPQADGLAVLVLAVGGCTDWLDGYLARAWHQTSRLGQMLDPIADRLYIVAVLTGLALREIVPWWLVVIVIGRDVMIASLVPLLKTRGFSSLPVHFLGKAATFSLLYAFPLVLLGSGEQGWLQLAWVLGWAFAIWGTALYWYAGGLYVAQTVKLVRTMPPINDRQRGGSTSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 2 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 3 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 4 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 5 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 6 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 7 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 40 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 43 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 101 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 102 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 103 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 104 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 105 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 106 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 111 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 112 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 115 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 116 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 117 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 118 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 119 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 120 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 121 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 122 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 123 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 124 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 125 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 126 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 127 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 128 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 132 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 133 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 143 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 144 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 145 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 151 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 152 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 155 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 174 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 175 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 176 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 189 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 190 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.33 |
| Metatranscriptomes | 0.33 |
| Isolates | 2.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.33 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 8.67 |
| Rhizosphere | 88.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10014468 | 3300003911 | Bacteria | 1541 |
| 2 | JGI25405J52794_10059252 | 3300003911 | Bacteria | 826 |
| 3 | Ga0070658_10036586 | 3300005327 | Bacteria | 3957 |
| 4 | Ga0070683_100079089 | 3300005329 | Bacteria | 3077 |
| 5 | Ga0070683_100170668 | 3300005329 | Bacteria | 2065 |
| 6 | Ga0070670_100429402 | 3300005331 | Bacteria | 1169 |
| 7 | Ga0070682_100017908 | 3300005337 | Bacteria | 4133 |
| 8 | Ga0070682_100064099 | 3300005337 | Unclassified | 2332 |
| 9 | Ga0070691_10080502 | 3300005341 | Bacteria | 1594 |
| 10 | Ga0070687_100097496 | 3300005343 | Bacteria | 1639 |
| 11 | Ga0070668_100029453 | 3300005347 | Bacteria | 4170 |
| 12 | Ga0070668_100294774 | 3300005347 | Bacteria | 1359 |
| 13 | Ga0070669_100223598 | 3300005353 | Bacteria | 1489 |
| 14 | Ga0070675_100124797 | 3300005354 | Bacteria | 2190 |
| 15 | Ga0070673_100526543 | 3300005364 | Bacteria | 1072 |
| 16 | Ga0070688_100227099 | 3300005365 | Bacteria | 1319 |
| 17 | Ga0070659_100004944 | 3300005366 | Bacteria | 9534 |
| 18 | Ga0070659_100017974 | 3300005366 | Bacteria | 5329 |
| 19 | Ga0070659_100146033 | 3300005366 | Bacteria | 1927 |
| 20 | Ga0070701_10078308 | 3300005438 | Bacteria | 1783 |
| 21 | Ga0070701_10126865 | 3300005438 | Bacteria | 1445 |
| 22 | Ga0070705_100321110 | 3300005440 | Bacteria | 1118 |
| 23 | Ga0070700_100000406 | 3300005441 | Bacteria | 22003 |
| 24 | Ga0070662_100028258 | 3300005457 | Bacteria | 3901 |
| 25 | Ga0068867_100070226 | 3300005459 | Bacteria | 2618 |
| 26 | Ga0068867_100087869 | 3300005459 | Bacteria | 2354 |
| 27 | Ga0070684_100153143 | 3300005535 | Bacteria | 2090 |
| 28 | Ga0070695_100339370 | 3300005545 | Bacteria | 1122 |
| 29 | Ga0068855_100442349 | 3300005563 | Bacteria | 1419 |
| 30 | Ga0070664_100178256 | 3300005564 | Bacteria | 1888 |
| 31 | Ga0070702_100033494 | 3300005615 | Bacteria | 2826 |
| 32 | Ga0068852_100347614 | 3300005616 | Bacteria | 1447 |
| 33 | Ga0068859_100547361 | 3300005617 | Bacteria | 1252 |
| 34 | Ga0068866_10168015 | 3300005718 | Bacteria | 1285 |
| 35 | Ga0068866_10257073 | 3300005718 | Bacteria | 1071 |
| 36 | Ga0068870_10001067 | 3300005840 | Bacteria | 10886 |
| 37 | Ga0068858_100528592 | 3300005842 | Bacteria | 1141 |
| 38 | Ga0068860_100300915 | 3300005843 | Bacteria | 1571 |
| 39 | Ga0068860_100331885 | 3300005843 | Bacteria | 1494 |
| 40 | Ga0068862_100130063 | 3300005844 | Bacteria | 2226 |
| 41 | Ga0081455_10005218 | 3300005937 | Bacteria | 14293 |
| 42 | Ga0081455_10022172 | 3300005937 | Bacteria | 5942 |
| 43 | Ga0081455_10023863 | 3300005937 | Bacteria | 5681 |
| 44 | Ga0081455_10078107 | 3300005937 | Bacteria | 2721 |
| 45 | Ga0081538_10001931 | 3300005981 | Bacteria | 20762 |
| 46 | Ga0081538_10096216 | 3300005981 | Unclassified | 1509 |
| 47 | Ga0075432_10000028 | 3300006058 | Bacteria | 26814 |
| 48 | Ga0075432_10010600 | 3300006058 | Unclassified | 3130 |
| 49 | Ga0075432_10023546 | 3300006058 | Bacteria | 2109 |
| 50 | Ga0075428_100254142 | 3300006844 | Bacteria | 1893 |
| 51 | Ga0075428_100426656 | 3300006844 | Bacteria | 1421 |
| 52 | Ga0075428_100865121 | 3300006844 | Bacteria | 959 |
| 53 | Ga0075430_100308357 | 3300006846 | Bacteria | 1309 |
| 54 | Ga0075431_100029697 | 3300006847 | Bacteria | 5628 |
| 55 | Ga0075433_10002010 | 3300006852 | Bacteria | 15326 |
| 56 | Ga0075434_100003989 | 3300006871 | Bacteria | 13221 |
| 57 | Ga0075434_101362465 | 3300006871 | Bacteria | 720 |
| 58 | Ga0075429_100049929 | 3300006880 | Unclassified | 3640 |
| 59 | Ga0068865_100008425 | 3300006881 | Bacteria | 6375 |
| 60 | Ga0068865_100022810 | 3300006881 | Bacteria | 4090 |
| 61 | Ga0068865_100066065 | 3300006881 | Bacteria | 2551 |
| 62 | Ga0075436_100003948 | 3300006914 | Bacteria | 10166 |
| 63 | Ga0097620_100547357 | 3300006931 | Bacteria | 1252 |
| 64 | Ga0097620_101092046 | 3300006931 | Bacteria | 877 |
| 65 | Ga0075435_100002516 | 3300007076 | Bacteria | 12200 |
| 66 | Ga0075435_100005184 | 3300007076 | Bacteria | 9065 |
| 67 | Ga0111539_10001773 | 3300009094 | Bacteria | 28685 |
| 68 | Ga0111539_10008586 | 3300009094 | Bacteria | 12973 |
| 69 | Ga0105245_10025877 | 3300009098 | Bacteria | 5161 |
| 70 | Ga0105245_10036510 | 3300009098 | Bacteria | 4366 |
| 71 | Ga0105245_10087349 | 3300009098 | Bacteria | 2862 |
| 72 | Ga0114129_10012017 | 3300009147 | Bacteria | 12315 |
| 73 | Ga0114129_10450543 | 3300009147 | Bacteria | 1688 |
| 74 | Ga0105243_10016977 | 3300009148 | Bacteria | 5504 |
| 75 | Ga0105243_10040347 | 3300009148 | Unclassified | 3645 |
| 76 | Ga0105243_10609959 | 3300009148 | Bacteria | 1052 |
| 77 | Ga0105243_10696594 | 3300009148 | Unclassified | 990 |
| 78 | Ga0105242_10190275 | 3300009176 | Bacteria | 1816 |
| 79 | Ga0105237_10666509 | 3300009545 | Bacteria | 1047 |
| 80 | Ga0105238_10321784 | 3300009551 | Bacteria | 1533 |
| 81 | Ga0105249_10018095 | 3300009553 | Bacteria | 6263 |
| 82 | Ga0105249_10089900 | 3300009553 | Bacteria | 2870 |
| 83 | Ga0105249_11084949 | 3300009553 | Bacteria | 870 |
| 84 | Ga0105239_10022373 | 3300010375 | Bacteria | 6969 |
| 85 | Ga0105239_10059048 | 3300010375 | Bacteria | 4210 |
| 86 | Ga0105239_10067515 | 3300010375 | Unclassified | 3928 |
| 87 | Ga0105246_10625657 | 3300011119 | Bacteria | 933 |
| 88 | Ga0157338_1001423 | 3300012515 | Unclassified | 1705 |
| 89 | Ga0157371_10322154 | 3300013102 | Bacteria | 1122 |
| 90 | Ga0163162_10035189 | 3300013306 | Bacteria | 4987 |
| 91 | Ga0157372_10048131 | 3300013307 | Bacteria | 4739 |
| 92 | Ga0157372_10778059 | 3300013307 | Bacteria | 1112 |
| 93 | Ga0157372_11461991 | 3300013307 | Bacteria | 787 |
| 94 | Ga0157375_11299750 | 3300013308 | Bacteria | 855 |
| 95 | Ga0163163_10633854 | 3300014325 | Bacteria | 1132 |
| 96 | Ga0163163_10686596 | 3300014325 | Bacteria | 1087 |
| 97 | Ga0157380_10041630 | 3300014326 | Unclassified | 3586 |
| 98 | Ga0157380_10650019 | 3300014326 | Bacteria | 1052 |
| 99 | Ga0163161_10089374 | 3300017792 | Bacteria | 2278 |
| 100 | Ga0163161_10468423 | 3300017792 | Bacteria | 1021 |
| 101 | Ga0206356_11240218 | 3300020070 | Bacteria | 1608 |
| 102 | Ga0207642_10148060 | 3300025899 | Bacteria | 1246 |
| 103 | Ga0207642_10158967 | 3300025899 | Bacteria | 1211 |
| 104 | Ga0207688_10003001 | 3300025901 | Bacteria | 9192 |
| 105 | Ga0207647_10139154 | 3300025904 | Bacteria | 1423 |
| 106 | Ga0207643_10001879 | 3300025908 | Bacteria | 11602 |
| 107 | Ga0207705_10047719 | 3300025909 | Bacteria | 3079 |
| 108 | Ga0207705_10365331 | 3300025909 | Bacteria | 1113 |
| 109 | Ga0207705_10473579 | 3300025909 | Bacteria | 972 |
| 110 | Ga0207662_10095366 | 3300025918 | Bacteria | 1836 |
| 111 | Ga0207657_10015319 | 3300025919 | Bacteria | 7432 |
| 112 | Ga0207694_10175808 | 3300025924 | Bacteria | 1735 |
| 113 | Ga0207694_10240101 | 3300025924 | Bacteria | 1481 |
| 114 | Ga0207650_10527693 | 3300025925 | Bacteria | 988 |
| 115 | Ga0207659_10212447 | 3300025926 | Bacteria | 1551 |
| 116 | Ga0207687_10016636 | 3300025927 | Bacteria | 4832 |
| 117 | Ga0207687_10057785 | 3300025927 | Bacteria | 2727 |
| 118 | Ga0207687_10228278 | 3300025927 | Bacteria | 1469 |
| 119 | Ga0207687_10391788 | 3300025927 | Bacteria | 1140 |
| 120 | Ga0207690_10149246 | 3300025932 | Bacteria | 1732 |
| 121 | Ga0207706_10395308 | 3300025933 | Bacteria | 1199 |
| 122 | Ga0207686_10050863 | 3300025934 | Bacteria | 2579 |
| 123 | Ga0207686_10506773 | 3300025934 | Bacteria | 937 |
| 124 | Ga0207709_10251130 | 3300025935 | Bacteria | 1292 |
| 125 | Ga0207709_10334341 | 3300025935 | Bacteria | 1138 |
| 126 | Ga0207709_10865707 | 3300025935 | Bacteria | 733 |
| 127 | Ga0207669_10115783 | 3300025937 | Bacteria | 1808 |
| 128 | Ga0207704_10038926 | 3300025938 | Unclassified | 2763 |
| 129 | Ga0207704_10221985 | 3300025938 | Bacteria | 1399 |
| 130 | Ga0207661_10114309 | 3300025944 | Bacteria | 2288 |
| 131 | Ga0207661_10659360 | 3300025944 | Bacteria | 962 |
| 132 | Ga0207712_10027364 | 3300025961 | Bacteria | 3807 |
| 133 | Ga0207712_10122742 | 3300025961 | Bacteria | 1968 |
| 134 | Ga0207668_10019373 | 3300025972 | Bacteria | 4301 |
| 135 | Ga0207668_10131448 | 3300025972 | Bacteria | 1912 |
| 136 | Ga0207677_10574005 | 3300026023 | Bacteria | 986 |
| 137 | Ga0207639_10895652 | 3300026041 | Bacteria | 829 |
| 138 | Ga0207708_10064908 | 3300026075 | Bacteria | 2790 |
| 139 | Ga0207708_10530054 | 3300026075 | Bacteria | 991 |
| 140 | Ga0207648_10010968 | 3300026089 | Bacteria | 8561 |
| 141 | Ga0207648_10022104 | 3300026089 | Bacteria | 5714 |
| 142 | Ga0207675_100000862 | 3300026118 | Bacteria | 30299 |
| 143 | Ga0207675_100011648 | 3300026118 | Bacteria | 8223 |
| 144 | Ga0207683_10359671 | 3300026121 | Bacteria | 1337 |
| 145 | Ga0207698_10144567 | 3300026142 | Bacteria | 2054 |
| 146 | Ga0207428_10000855 | 3300027907 | Bacteria | 34313 |
| 147 | Ga0207428_10008400 | 3300027907 | Bacteria | 9325 |
| 148 | Ga0207428_10039472 | 3300027907 | Bacteria | 3834 |
| 149 | Ga0268265_10212502 | 3300028380 | Bacteria | 1687 |
| 150 | Ga0268264_10245115 | 3300028381 | Bacteria | 1662 |
| 151 | Ga0307408_100019928 | 3300031548 | Bacteria | 4519 |
| 152 | Ga0307405_10001045 | 3300031731 | Bacteria | 11203 |
| 153 | Ga0307405_10140082 | 3300031731 | Bacteria | 1685 |
| 154 | Ga0307405_10155222 | 3300031731 | Bacteria | 1614 |
| 155 | Ga0307413_10003566 | 3300031824 | Bacteria | 6583 |
| 156 | Ga0307410_10000766 | 3300031852 | Bacteria | 13524 |
| 157 | Ga0307410_10001024 | 3300031852 | Bacteria | 12121 |
| 158 | Ga0307410_10010771 | 3300031852 | Bacteria | 5201 |
| 159 | Ga0307410_10413768 | 3300031852 | Bacteria | 1092 |
| 160 | Ga0307406_10005025 | 3300031901 | Bacteria | 7210 |
| 161 | Ga0307407_10009401 | 3300031903 | Bacteria | 4552 |
| 162 | Ga0307407_10021498 | 3300031903 | Bacteria | 3329 |
| 163 | Ga0307407_10160029 | 3300031903 | Bacteria | 1473 |
| 164 | Ga0307412_10146043 | 3300031911 | Bacteria | 1739 |
| 165 | Ga0307412_10335500 | 3300031911 | Unclassified | 1208 |
| 166 | Ga0307412_10408814 | 3300031911 | Bacteria | 1107 |
| 167 | Ga0307409_100000183 | 3300031995 | Bacteria | 24466 |
| 168 | Ga0307409_100009847 | 3300031995 | Bacteria | 5897 |
| 169 | Ga0307409_100203443 | 3300031995 | Bacteria | 1773 |
| 170 | Ga0307409_100265429 | 3300031995 | Bacteria | 1578 |
| 171 | Ga0307409_100992143 | 3300031995 | Unclassified | 857 |
| 172 | Ga0307416_100000124 | 3300032002 | Bacteria | 46509 |
| 173 | Ga0307416_100014956 | 3300032002 | Bacteria | 5340 |
| 174 | Ga0307416_100583454 | 3300032002 | Bacteria | 1195 |
| 175 | Ga0307414_10006047 | 3300032004 | Bacteria | 6714 |
| 176 | Ga0307414_10117747 | 3300032004 | Bacteria | 2036 |
| 177 | Ga0307411_10009966 | 3300032005 | Bacteria | 5034 |
| 178 | Ga0307411_10105752 | 3300032005 | Unclassified | 2001 |
| 179 | Ga0307411_10259233 | 3300032005 | Unclassified | 1372 |
| 180 | Ga0307411_10278309 | 3300032005 | Bacteria | 1330 |
| 181 | Ga0307415_100002631 | 3300032126 | Bacteria | 8945 |
| 182 | Ga0307415_100003201 | 3300032126 | Bacteria | 8307 |
| 183 | Ga0307415_100593911 | 3300032126 | Bacteria | 984 |
| 184 | Ga0373960_0073416 | 3300035121 | Bacteria | 1063 |
| 185 | Ga0395901_0038740 | 3300038443 | Bacteria | 4931 |
| 186 | Ga0242420_029975 | 3300038996 | Bacteria | 1006 |
| 187 | Ga0439448_0036168 | 3300042005 | Bacteria | 1583 |
| 188 | Ga0439450_003317 | 3300042008 | Bacteria | 2648 |
| 189 | Ga0439450_078360 | 3300042008 | Unclassified | 819 |
| 190 | Ga0439463_002099 | 3300042016 | Bacteria | 5154 |
| 191 | Ga0450888_006017 | 3300042126 | Unclassified | 1308 |
| 192 | Ga0439446_0062068 | 3300042156 | Bacteria | 1131 |
| 193 | Ga0439444_0001661 | 3300042437 | Unclassified | 2930 |
| 194 | Ga0439460_0044108 | 3300042461 | Unclassified | 1319 |
| 195 | Ga0439440_0001936 | 3300042993 | Bacteria | 3846 |
| 196 | Ga0466972_0002214 | 3300044658 | Bacteria | 9547 |
| 197 | Ga0466972_0095074 | 3300044658 | Bacteria | 1412 |
| 198 | Ga0466965_0010900 | 3300044683 | Bacteria | 4252 |
| 199 | Ga0466961_0100025 | 3300044693 | Bacteria | 1827 |
| 200 | Ga0466963_0169548 | 3300044694 | Bacteria | 1521 |
| 201 | Ga0466964_0005846 | 3300044706 | Bacteria | 4577 |
| 202 | Ga0466971_0031191 | 3300044719 | Bacteria | 2386 |
| 203 | Ga0466970_0016232 | 3300044765 | Bacteria | 3837 |
| 204 | Ga0466970_0067952 | 3300044765 | Bacteria | 1914 |
| 205 | Ga0466957_0007885 | 3300044842 | Bacteria | 6038 |
| 206 | Ga0466957_0089800 | 3300044842 | Bacteria | 1924 |
| 207 | Ga0466958_0032414 | 3300045836 | Bacteria | 3108 |
| 208 | Ga0466967_0206429 | 3300045976 | Bacteria | 1862 |
| 209 | Ga0466967_0323207 | 3300045976 | Bacteria | 1488 |
| 210 | Ga0466967_0348275 | 3300045976 | Bacteria | 1433 |
| 211 | Ga0466967_1344613 | 3300045976 | Bacteria | 711 |
| 212 | Ga0495641_0052075 | 3300046461 | Bacteria | 1867 |
| 213 | Ga0495582_0275525 | 3300046473 | Bacteria | 966 |
| 214 | Ga0495644_0090865 | 3300046523 | Bacteria | 1152 |
| 215 | Ga0495598_0136027 | 3300046537 | Bacteria | 847 |
| 216 | Ga0495611_0136773 | 3300046648 | Unclassified | 1144 |
| 217 | Ga0495661_0221230 | 3300046665 | Bacteria | 981 |
| 218 | Ga0495658_0523496 | 3300046683 | Bacteria | 759 |
| 219 | Ga0495660_0067268 | 3300046810 | Bacteria | 1909 |
| 220 | Ga0496101_0211279 | 3300048904 | Bacteria | 1503 |
| 221 | Ga0496102_0019554 | 3300048905 | Bacteria | 5965 |
| 222 | Ga0496104_0121292 | 3300048907 | Bacteria | 2510 |
| 223 | Ga0496105_0202755 | 3300048908 | Bacteria | 1619 |
| 224 | Ga0496105_0533540 | 3300048908 | Bacteria | 918 |
| 225 | Ga0496105_0540071 | 3300048908 | Bacteria | 911 |
| 226 | Ga0496106_0015694 | 3300048909 | Bacteria | 5604 |
| 227 | Ga0496107_0008975 | 3300048910 | Bacteria | 6930 |
| 228 | Ga0496108_0004318 | 3300048911 | Bacteria | 11429 |
| 229 | Ga0496108_0007443 | 3300048911 | Bacteria | 8874 |
| 230 | Ga0496108_0418567 | 3300048911 | Bacteria | 1170 |
| 231 | Ga0496109_0004950 | 3300048912 | Bacteria | 11126 |
| 232 | Ga0496109_0031260 | 3300048912 | Bacteria | 4777 |
| 233 | Ga0496109_0525508 | 3300048912 | Bacteria | 1117 |
| 234 | Ga0496110_0014266 | 3300048913 | Bacteria | 6592 |
| 235 | Ga0496110_0109281 | 3300048913 | Bacteria | 2483 |
| 236 | Ga0496110_0125656 | 3300048913 | Bacteria | 2314 |
| 237 | Ga0496110_0144293 | 3300048913 | Bacteria | 2153 |
| 238 | Ga0496111_0018998 | 3300048914 | Bacteria | 4766 |
| 239 | Ga0496111_0107553 | 3300048914 | Bacteria | 2053 |
| 240 | Ga0496112_0860739 | 3300048915 | Bacteria | 829 |
| 241 | Ga0496113_0063131 | 3300048916 | Bacteria | 2799 |
| 242 | Ga0496113_0307830 | 3300048916 | Bacteria | 1269 |
| 243 | Ga0496114_0012935 | 3300048917 | Bacteria | 6685 |
| 244 | Ga0496114_0362604 | 3300048917 | Bacteria | 1282 |
| 245 | Ga0496114_1031012 | 3300048917 | Bacteria | 706 |
| 246 | Ga0501300_007512 | 3300049523 | Unclassified | 1599 |
| 247 | Ga0501033_0065286 | 3300049570 | Bacteria | 2678 |
| 248 | Ga0501034_0009364 | 3300049571 | Bacteria | 10262 |
| 249 | Ga0501034_0235244 | 3300049571 | Bacteria | 1780 |
| 250 | Ga0501036_0131115 | 3300049572 | Bacteria | 2116 |
| 251 | Ga0501037_0173418 | 3300049573 | Bacteria | 1532 |
| 252 | Ga0501038_0005729 | 3300049574 | Bacteria | 11514 |
| 253 | Ga0501039_0016129 | 3300049575 | Bacteria | 5723 |
| 254 | Ga0501039_0469785 | 3300049575 | Bacteria | 988 |
| 255 | Ga0501040_0185394 | 3300049576 | Bacteria | 1476 |
| 256 | Ga0501042_0011581 | 3300049578 | Bacteria | 5956 |
| 257 | Ga0501043_0500820 | 3300049579 | Bacteria | 907 |
| 258 | Ga0501046_0081249 | 3300049580 | Bacteria | 2503 |
| 259 | Ga0501047_0045219 | 3300049581 | Bacteria | 4256 |
| 260 | Ga0501067_0087592 | 3300049583 | Bacteria | 1728 |
| 261 | Ga0501068_0025816 | 3300049584 | Bacteria | 3458 |
| 262 | Ga0501068_0566833 | 3300049584 | Bacteria | 739 |
| 263 | Ga0501069_0037061 | 3300049585 | Bacteria | 2691 |
| 264 | Ga0501069_0060975 | 3300049585 | Bacteria | 2106 |
| 265 | Ga0501070_0015547 | 3300049586 | Bacteria | 6401 |
| 266 | Ga0501070_0018932 | 3300049586 | Bacteria | 5775 |
| 267 | Ga0501071_0183623 | 3300049587 | Bacteria | 1568 |
| 268 | Ga0501073_0026576 | 3300049589 | Bacteria | 4145 |
| 269 | Ga0501074_0111765 | 3300049590 | Bacteria | 1954 |
| 270 | Ga0501207_015375 | 3300049654 | Unclassified | 1178 |
| 271 | Ga0501243_014997 | 3300049675 | Unclassified | 1243 |
| 272 | Ga0501234_023153 | 3300049707 | Unclassified | 993 |
| 273 | Ga0501044_0023050 | 3300049823 | Bacteria | 6627 |
| 274 | Ga0501212_003342 | 3300049851 | Bacteria | 2006 |
| 275 | nmdc:mga05p37_763842_c1 | 3300050507 | Bacteria | 1063 |
| 276 | nmdc:mga05p37_9426_c1 | 3300050507 | Bacteria | 11560 |
| 277 | nmdc:mga09592_76448_c1 | 3300050508 | Unclassified | 2243 |
| 278 | nmdc:mga0qj67_474454_c1 | 3300050509 | Bacteria | 1007 |
| 279 | nmdc:mga06r32_16954_c2 | 3300050510 | Bacteria | 5171 |
| 280 | nmdc:mga08y16_12187_c1 | 3300050511 | Bacteria | 9038 |
| 281 | nmdc:mga08y16_6996_c1 | 3300050511 | Bacteria | 11831 |
| 282 | nmdc:mga0n895_216120_c1 | 3300050512 | Bacteria | 1947 |
| 283 | nmdc:mga0n895_390_c1 | 3300050512 | Bacteria | 29396 |
| 284 | nmdc:mga0n895_635973_c1 | 3300050512 | Bacteria | 1067 |
| 285 | nmdc:mga0rr50_16676_c1 | 3300050513 | Unclassified | 4885 |
| 286 | nmdc:mga08x19_9875_c1 | 3300050514 | Bacteria | 5722 |
| 287 | nmdc:mga0a205_11637_c1 | 3300050515 | Bacteria | 8111 |
| 288 | nmdc:mga0a205_545_c1 | 3300050515 | Bacteria | 29797 |
| 289 | Ga0495619_0133746 | 3300053085 | Bacteria | 1705 |
| 290 | Ga0500620_054311 | 3300053155 | Bacteria | 1351 |
| 291 | Ga0466962_0092891 | 3300061719 | Bacteria | 1446 |
| 292 | Ga0530510_0019317 | 3300061734 | Bacteria | 4837 |
| 293 | Ga0530510_0112481 | 3300061734 | Bacteria | 1995 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042156 | Ga0439446_0062068 | Ga0439446_0062068_202_804 | 191 |
| 2 | 3300045976 | Ga0466967_1344613 | Ga0466967_1344613_81_683 | 193 |
| 3 | 3300046473 | Ga0495582_0275525 | Ga0495582_0275525_121_726 | 193 |
| 4 | 3300049576 | Ga0501040_0185394 | Ga0501040_0185394_137_739 | 193 |
| 5 | 3300049583 | Ga0501067_0087592 | Ga0501067_0087592_599_1201 | 193 |
| 6 | iso_pu_bacteria | 2643221617 | 2644101703 | 193 |
| 7 | iso_pu_bacteria | 2643221620 | 2644115765 | 193 |
| 8 | iso_pu_bacteria | 2855386786 | 2855387322 | 193 |
| 9 | 3300009551 | Ga0105238_10321784 | Ga0105238_103217842 | 194 |
| 10 | 3300011119 | Ga0105246_10625657 | Ga0105246_106256572 | 194 |
| 11 | 3300013102 | Ga0157371_10322154 | Ga0157371_103221542 | 194 |
| 12 | 3300025924 | Ga0207694_10175808 | Ga0207694_101758082 | 194 |
| 13 | 3300044658 | Ga0466972_0095074 | Ga0466972_0095074_14_619 | 194 |
| 14 | 3300048911 | Ga0496108_0418567 | Ga0496108_0418567_453_1058 | 194 |
| 15 | 3300048912 | Ga0496109_0525508 | Ga0496109_0525508_137_742 | 194 |
| 16 | 3300048913 | Ga0496110_0144293 | Ga0496110_0144293_72_677 | 194 |
| 17 | 3300049575 | Ga0501039_0469785 | Ga0501039_0469785_262_864 | 194 |
| 18 | 3300049587 | Ga0501071_0183623 | Ga0501071_0183623_908_1510 | 194 |
| 19 | 3300005438 | Ga0070701_10126865 | Ga0070701_101268651 | 195 |
| 20 | 3300005440 | Ga0070705_100321110 | Ga0070705_1003211102 | 195 |
| 21 | 3300009098 | Ga0105245_10087349 | Ga0105245_100873492 | 195 |
| 22 | 3300009147 | Ga0114129_10450543 | Ga0114129_104505431 | 195 |
| 23 | 3300010375 | Ga0105239_10022373 | Ga0105239_100223734 | 195 |
| 24 | 3300013308 | Ga0157375_11299750 | Ga0157375_112997501 | 195 |
| 25 | 3300025909 | Ga0207705_10365331 | Ga0207705_103653312 | 195 |
| 26 | 3300025924 | Ga0207694_10240101 | Ga0207694_102401012 | 195 |
| 27 | 3300038996 | Ga0242420_029975 | Ga0242420_029975_147_755 | 195 |
| 28 | 3300044658 | Ga0466972_0002214 | Ga0466972_0002214_2855_3463 | 195 |
| 29 | 3300044683 | Ga0466965_0010900 | Ga0466965_0010900_3420_4028 | 195 |
| 30 | 3300044693 | Ga0466961_0100025 | Ga0466961_0100025_62_670 | 195 |
| 31 | 3300044694 | Ga0466963_0169548 | Ga0466963_0169548_566_1174 | 195 |
| 32 | 3300044706 | Ga0466964_0005846 | Ga0466964_0005846_895_1503 | 195 |
| 33 | 3300044719 | Ga0466971_0031191 | Ga0466971_0031191_805_1413 | 195 |
| 34 | 3300044765 | Ga0466970_0067952 | Ga0466970_0067952_550_1158 | 195 |
| 35 | 3300044842 | Ga0466957_0007885 | Ga0466957_0007885_342_950 | 195 |
| 36 | 3300045836 | Ga0466958_0032414 | Ga0466958_0032414_1127_1735 | 195 |
| 37 | 3300045976 | Ga0466967_0348275 | Ga0466967_0348275_677_1285 | 195 |
| 38 | 3300046683 | Ga0495658_0523496 | Ga0495658_0523496_44_652 | 195 |
| 39 | 3300048904 | Ga0496101_0211279 | Ga0496101_0211279_879_1487 | 195 |
| 40 | 3300048905 | Ga0496102_0019554 | Ga0496102_0019554_1443_2051 | 195 |
| 41 | 3300048907 | Ga0496104_0121292 | Ga0496104_0121292_1767_2375 | 195 |
| 42 | 3300048908 | Ga0496105_0533540 | Ga0496105_0533540_150_758 | 195 |
| 43 | 3300048909 | Ga0496106_0015694 | Ga0496106_0015694_1125_1733 | 195 |
| 44 | 3300048910 | Ga0496107_0008975 | Ga0496107_0008975_1400_2008 | 195 |
| 45 | 3300048911 | Ga0496108_0004318 | Ga0496108_0004318_121_729 | 195 |
| 46 | 3300048913 | Ga0496110_0109281 | Ga0496110_0109281_1340_1948 | 195 |
| 47 | 3300048914 | Ga0496111_0107553 | Ga0496111_0107553_938_1546 | 195 |
| 48 | 3300048915 | Ga0496112_0860739 | Ga0496112_0860739_67_675 | 195 |
| 49 | 3300048916 | Ga0496113_0063131 | Ga0496113_0063131_641_1249 | 195 |
| 50 | 3300048917 | Ga0496114_1031012 | Ga0496114_1031012_38_646 | 195 |
| 51 | 3300049570 | Ga0501033_0065286 | Ga0501033_0065286_103_717 | 195 |
| 52 | 3300049571 | Ga0501034_0009364 | Ga0501034_0009364_4368_4982 | 195 |
| 53 | 3300049572 | Ga0501036_0131115 | Ga0501036_0131115_466_1080 | 195 |
| 54 | 3300049573 | Ga0501037_0173418 | Ga0501037_0173418_465_1079 | 195 |
| 55 | 3300049574 | Ga0501038_0005729 | Ga0501038_0005729_7130_7744 | 195 |
| 56 | 3300049575 | Ga0501039_0016129 | Ga0501039_0016129_1632_2246 | 195 |
| 57 | 3300049578 | Ga0501042_0011581 | Ga0501042_0011581_4222_4836 | 195 |
| 58 | 3300049579 | Ga0501043_0500820 | Ga0501043_0500820_215_829 | 195 |
| 59 | 3300049580 | Ga0501046_0081249 | Ga0501046_0081249_1083_1697 | 195 |
| 60 | 3300049581 | Ga0501047_0045219 | Ga0501047_0045219_35_649 | 195 |
| 61 | 3300049584 | Ga0501068_0025816 | Ga0501068_0025816_860_1468 | 195 |
| 62 | 3300049584 | Ga0501068_0566833 | Ga0501068_0566833_31_639 | 195 |
| 63 | 3300049589 | Ga0501073_0026576 | Ga0501073_0026576_2664_3278 | 195 |
| 64 | 3300049823 | Ga0501044_0023050 | Ga0501044_0023050_3083_3697 | 195 |
| 65 | 3300050507 | nmdc:mga05p37_763842_c1 | nmdc:mga05p37_763842_c1_60_668 | 195 |
| 66 | 3300050512 | nmdc:mga0n895_635973_c1 | nmdc:mga0n895_635973_c1_13_621 | 195 |
| 67 | 3300061719 | Ga0466962_0092891 | Ga0466962_0092891_608_1216 | 195 |
| 68 | 3300061734 | Ga0530510_0019317 | Ga0530510_0019317_3010_3618 | 195 |
| 69 | iso_pu_bacteria | 2811994874 | 2812332926 | 195 |
| 70 | 3300005842 | Ga0068858_100528592 | Ga0068858_1005285921 | 196 |
| 71 | 3300009148 | Ga0105243_10609959 | Ga0105243_106099592 | 196 |
| 72 | 3300013307 | Ga0157372_11461991 | Ga0157372_114619911 | 196 |
| 73 | 3300014325 | Ga0163163_10686596 | Ga0163163_106865962 | 196 |
| 74 | 3300020070 | Ga0206356_11240218 | Ga0206356_112402181 | 196 |
| 75 | 3300025927 | Ga0207687_10391788 | Ga0207687_103917882 | 196 |
| 76 | 3300026075 | Ga0207708_10530054 | Ga0207708_105300541 | 196 |
| 77 | iso_pu_bacteria | 2738541305 | 2738868461 | 196 |
| 78 | 3300005364 | Ga0070673_100526543 | Ga0070673_1005265431 | 197 |
| 79 | 3300006871 | Ga0075434_101362465 | Ga0075434_1013624651 | 197 |
| 80 | 3300006931 | Ga0097620_101092046 | Ga0097620_1010920461 | 197 |
| 81 | 3300025927 | Ga0207687_10228278 | Ga0207687_102282783 | 197 |
| 82 | 3300025944 | Ga0207661_10659360 | Ga0207661_106593601 | 197 |
| 83 | 3300026023 | Ga0207677_10574005 | Ga0207677_105740052 | 197 |
| 84 | 3300031731 | Ga0307405_10140082 | Ga0307405_101400822 | 197 |
| 85 | 3300031852 | Ga0307410_10010771 | Ga0307410_100107711 | 197 |
| 86 | 3300031903 | Ga0307407_10021498 | Ga0307407_100214981 | 197 |
| 87 | 3300031911 | Ga0307412_10146043 | Ga0307412_101460432 | 197 |
| 88 | 3300031995 | Ga0307409_100009847 | Ga0307409_1000098479 | 197 |
| 89 | 3300032002 | Ga0307416_100014956 | Ga0307416_1000149567 | 197 |
| 90 | 3300032004 | Ga0307414_10117747 | Ga0307414_101177473 | 197 |
| 91 | 3300032005 | Ga0307411_10009966 | Ga0307411_100099662 | 197 |
| 92 | 3300032126 | Ga0307415_100593911 | Ga0307415_1005939111 | 197 |
| 93 | 3300038443 | Ga0395901_0038740 | Ga0395901_0038740_1411_2025 | 197 |
| 94 | 3300045976 | Ga0466967_0323207 | Ga0466967_0323207_322_936 | 197 |
| 95 | 3300049585 | Ga0501069_0037061 | Ga0501069_0037061_1318_1932 | 197 |
| 96 | 3300049586 | Ga0501070_0015547 | Ga0501070_0015547_5565_6179 | 197 |
| 97 | 3300049590 | Ga0501074_0111765 | Ga0501074_0111765_432_1046 | 197 |
| 98 | 3300053155 | Ga0500620_054311 | Ga0500620_054311_441_1055 | 197 |
| 99 | 3300005329 | Ga0070683_100079089 | Ga0070683_1000790892 | 199 |
| 100 | 3300005329 | Ga0070683_100170668 | Ga0070683_1001706682 | 199 |
| 101 | 3300005331 | Ga0070670_100429402 | Ga0070670_1004294021 | 199 |
| 102 | 3300005337 | Ga0070682_100017908 | Ga0070682_1000179085 | 199 |
| 103 | 3300005341 | Ga0070691_10080502 | Ga0070691_100805022 | 199 |
| 104 | 3300005343 | Ga0070687_100097496 | Ga0070687_1000974962 | 199 |
| 105 | 3300005353 | Ga0070669_100223598 | Ga0070669_1002235982 | 199 |
| 106 | 3300005354 | Ga0070675_100124797 | Ga0070675_1001247972 | 199 |
| 107 | 3300005365 | Ga0070688_100227099 | Ga0070688_1002270992 | 199 |
| 108 | 3300005366 | Ga0070659_100004944 | Ga0070659_10000494414 | 199 |
| 109 | 3300005438 | Ga0070701_10078308 | Ga0070701_100783082 | 199 |
| 110 | 3300005441 | Ga0070700_100000406 | Ga0070700_1000004064 | 199 |
| 111 | 3300005459 | Ga0068867_100087869 | Ga0068867_1000878694 | 199 |
| 112 | 3300005535 | Ga0070684_100153143 | Ga0070684_1001531432 | 199 |
| 113 | 3300005545 | Ga0070695_100339370 | Ga0070695_1003393702 | 199 |
| 114 | 3300005564 | Ga0070664_100178256 | Ga0070664_1001782563 | 199 |
| 115 | 3300005615 | Ga0070702_100033494 | Ga0070702_1000334944 | 199 |
| 116 | 3300005616 | Ga0068852_100347614 | Ga0068852_1003476142 | 199 |
| 117 | 3300005617 | Ga0068859_100547361 | Ga0068859_1005473611 | 199 |
| 118 | 3300005718 | Ga0068866_10257073 | Ga0068866_102570732 | 199 |
| 119 | 3300005840 | Ga0068870_10001067 | Ga0068870_100010674 | 199 |
| 120 | 3300006058 | Ga0075432_10023546 | Ga0075432_100235462 | 199 |
| 121 | 3300006844 | Ga0075428_100865121 | Ga0075428_1008651212 | 199 |
| 122 | 3300006881 | Ga0068865_100022810 | Ga0068865_1000228105 | 199 |
| 123 | 3300006931 | Ga0097620_100547357 | Ga0097620_1005473571 | 199 |
| 124 | 3300025899 | Ga0207642_10158967 | Ga0207642_101589671 | 199 |
| 125 | 3300025908 | Ga0207643_10001879 | Ga0207643_1000187915 | 199 |
| 126 | 3300025918 | Ga0207662_10095366 | Ga0207662_100953662 | 199 |
| 127 | 3300025925 | Ga0207650_10527693 | Ga0207650_105276932 | 199 |
| 128 | 3300025926 | Ga0207659_10212447 | Ga0207659_102124472 | 199 |
| 129 | 3300025927 | Ga0207687_10057785 | Ga0207687_100577854 | 199 |
| 130 | 3300025934 | Ga0207686_10050863 | Ga0207686_100508632 | 199 |
| 131 | 3300025935 | Ga0207709_10334341 | Ga0207709_103343411 | 199 |
| 132 | 3300025944 | Ga0207661_10114309 | Ga0207661_101143093 | 199 |
| 133 | 3300025961 | Ga0207712_10027364 | Ga0207712_100273641 | 199 |
| 134 | 3300026041 | Ga0207639_10895652 | Ga0207639_108956522 | 199 |
| 135 | 3300026075 | Ga0207708_10064908 | Ga0207708_100649083 | 199 |
| 136 | 3300026089 | Ga0207648_10010968 | Ga0207648_100109683 | 199 |
| 137 | 3300026118 | Ga0207675_100000862 | Ga0207675_10000086227 | 199 |
| 138 | 3300026142 | Ga0207698_10144567 | Ga0207698_101445672 | 199 |
| 139 | 3300027907 | Ga0207428_10039472 | Ga0207428_100394725 | 199 |
| 140 | 3300005347 | Ga0070668_100294774 | Ga0070668_1002947742 | 200 |
| 141 | 3300025935 | Ga0207709_10251130 | Ga0207709_102511302 | 200 |
| 142 | 3300025972 | Ga0207668_10131448 | Ga0207668_101314482 | 200 |
| 143 | 3300028380 | Ga0268265_10212502 | Ga0268265_102125022 | 200 |
| 144 | 3300031911 | Ga0307412_10335500 | Ga0307412_103355002 | 200 |
| 145 | 3300032005 | Ga0307411_10259233 | Ga0307411_102592332 | 200 |
| 146 | 3300042008 | Ga0439450_003317 | Ga0439450_003317_1146_1769 | 200 |
| 147 | 3300042016 | Ga0439463_002099 | Ga0439463_002099_3944_4567 | 200 |
| 148 | 3300042993 | Ga0439440_0001936 | Ga0439440_0001936_2355_2978 | 200 |
| 149 | 3300009553 | Ga0105249_11084949 | Ga0105249_110849491 | 202 |
| 150 | 3300048908 | Ga0496105_0540071 | Ga0496105_0540071_31_708 | 202 |
| 151 | 3300048912 | Ga0496109_0031260 | Ga0496109_0031260_3611_4288 | 202 |
| 152 | 3300048913 | Ga0496110_0014266 | Ga0496110_0014266_797_1474 | 202 |
| 153 | 3300048914 | Ga0496111_0018998 | Ga0496111_0018998_1757_2434 | 202 |
| 154 | 3300049571 | Ga0501034_0235244 | Ga0501034_0235244_925_1554 | 202 |
| 155 | 3300049585 | Ga0501069_0060975 | Ga0501069_0060975_101_730 | 202 |
| 156 | 3300049586 | Ga0501070_0018932 | Ga0501070_0018932_2033_2662 | 202 |
| 157 | 3300061734 | Ga0530510_0112481 | Ga0530510_0112481_1252_1881 | 202 |
| 158 | iso_pu_bacteria | 2643221696 | 2644531922 | 202 |
| 159 | 3300005327 | Ga0070658_10036586 | Ga0070658_100365864 | 203 |
| 160 | 3300005366 | Ga0070659_100017974 | Ga0070659_1000179742 | 203 |
| 161 | 3300005563 | Ga0068855_100442349 | Ga0068855_1004423491 | 203 |
| 162 | 3300025904 | Ga0207647_10139154 | Ga0207647_101391542 | 203 |
| 163 | 3300025909 | Ga0207705_10047719 | Ga0207705_100477193 | 203 |
| 164 | 3300025909 | Ga0207705_10473579 | Ga0207705_104735792 | 203 |
| 165 | 3300025919 | Ga0207657_10015319 | Ga0207657_1001531910 | 203 |
| 166 | 3300025932 | Ga0207690_10149246 | Ga0207690_101492462 | 203 |
| 167 | 3300053085 | Ga0495619_0133746 | Ga0495619_0133746_23_655 | 203 |
| 168 | 3300044765 | Ga0466970_0016232 | Ga0466970_0016232_3145_3789 | 204 |
| 169 | 3300045976 | Ga0466967_0206429 | Ga0466967_0206429_1087_1731 | 204 |
| 170 | 3300046461 | Ga0495641_0052075 | Ga0495641_0052075_205_882 | 204 |
| 171 | iso_pu_bacteria | 2990256926 | 2990259044 | 204 |
| 172 | 3300005337 | Ga0070682_100064099 | Ga0070682_1000640992 | 205 |
| 173 | 3300005457 | Ga0070662_100028258 | Ga0070662_1000282582 | 205 |
| 174 | 3300009098 | Ga0105245_10025877 | Ga0105245_100258773 | 205 |
| 175 | 3300009148 | Ga0105243_10016977 | Ga0105243_100169776 | 205 |
| 176 | 3300010375 | Ga0105239_10059048 | Ga0105239_100590485 | 205 |
| 177 | 3300013307 | Ga0157372_10048131 | Ga0157372_100481312 | 205 |
| 178 | 3300014326 | Ga0157380_10041630 | Ga0157380_100416304 | 205 |
| 179 | 3300044842 | Ga0466957_0089800 | Ga0466957_0089800_710_1354 | 207 |
| 180 | 3300009098 | Ga0105245_10036510 | Ga0105245_100365101 | 208 |
| 181 | 3300017792 | Ga0163161_10468423 | Ga0163161_104684232 | 208 |
| 182 | 3300025935 | Ga0207709_10865707 | Ga0207709_108657072 | 208 |
| 183 | 3300025938 | Ga0207704_10221985 | Ga0207704_102219852 | 208 |
| 184 | 3300048908 | Ga0496105_0202755 | Ga0496105_0202755_529_1176 | 208 |
| 185 | 3300048911 | Ga0496108_0007443 | Ga0496108_0007443_6577_7224 | 208 |
| 186 | 3300048912 | Ga0496109_0004950 | Ga0496109_0004950_8828_9475 | 208 |
| 187 | 3300048913 | Ga0496110_0125656 | Ga0496110_0125656_1247_1894 | 208 |
| 188 | 3300048916 | Ga0496113_0307830 | Ga0496113_0307830_483_1130 | 208 |
| 189 | 3300048917 | Ga0496114_0012935 | Ga0496114_0012935_1164_1811 | 208 |
| 190 | 3300006844 | Ga0075428_100426656 | Ga0075428_1004266562 | 209 |
| 191 | 3300014325 | Ga0163163_10633854 | Ga0163163_106338542 | 214 |
| 192 | 3300014326 | Ga0157380_10650019 | Ga0157380_106500192 | 214 |
| 193 | 3300025937 | Ga0207669_10115783 | Ga0207669_101157833 | 214 |
| 194 | 3300026121 | Ga0207683_10359671 | Ga0207683_103596712 | 214 |
| 195 | 3300046537 | Ga0495598_0136027 | Ga0495598_0136027_62_748 | 214 |
| 196 | 3300046665 | Ga0495661_0221230 | Ga0495661_0221230_248_934 | 214 |
| 197 | 3300049654 | Ga0501207_015375 | Ga0501207_015375_12_680 | 214 |
| 198 | 3300046523 | Ga0495644_0090865 | Ga0495644_0090865_352_1101 | 216 |
| 199 | 3300031731 | Ga0307405_10155222 | Ga0307405_101552222 | 221 |
| 200 | 3300031852 | Ga0307410_10001024 | Ga0307410_1000102415 | 221 |
| 201 | 3300031903 | Ga0307407_10009401 | Ga0307407_100094013 | 221 |
| 202 | 3300031995 | Ga0307409_100203443 | Ga0307409_1002034432 | 221 |
| 203 | 3300032005 | Ga0307411_10278309 | Ga0307411_102783092 | 221 |
| 204 | 3300032126 | Ga0307415_100002631 | Ga0307415_1000026318 | 221 |
| 205 | 3300046648 | Ga0495611_0136773 | Ga0495611_0136773_223_972 | 223 |
| 206 | 3300046810 | Ga0495660_0067268 | Ga0495660_0067268_103_795 | 223 |
| 207 | 3300048917 | Ga0496114_0362604 | Ga0496114_0362604_139_846 | 224 |
| 208 | 3300005981 | Ga0081538_10001931 | Ga0081538_100019319 | 228 |
| 209 | 3300005981 | Ga0081538_10096216 | Ga0081538_100962161 | 228 |
| 210 | 3300031548 | Ga0307408_100019928 | Ga0307408_1000199285 | 228 |
| 211 | 3300031731 | Ga0307405_10001045 | Ga0307405_100010454 | 228 |
| 212 | 3300031824 | Ga0307413_10003566 | Ga0307413_100035665 | 228 |
| 213 | 3300031852 | Ga0307410_10000766 | Ga0307410_1000076614 | 228 |
| 214 | 3300031901 | Ga0307406_10005025 | Ga0307406_100050257 | 228 |
| 215 | 3300031995 | Ga0307409_100000183 | Ga0307409_10000018314 | 228 |
| 216 | 3300032002 | Ga0307416_100000124 | Ga0307416_10000012414 | 228 |
| 217 | 3300032004 | Ga0307414_10006047 | Ga0307414_100060479 | 228 |
| 218 | 3300032126 | Ga0307415_100003201 | Ga0307415_1000032016 | 228 |
| 219 | 3300003911 | JGI25405J52794_10059252 | JGI25405J52794_100592521 | 229 |
| 220 | 3300005937 | Ga0081455_10022172 | Ga0081455_100221722 | 229 |
| 221 | 3300005937 | Ga0081455_10078107 | Ga0081455_100781073 | 229 |
| 222 | 3300006058 | Ga0075432_10000028 | Ga0075432_1000002824 | 231 |
| 223 | 3300006844 | Ga0075428_100254142 | Ga0075428_1002541422 | 231 |
| 224 | 3300006852 | Ga0075433_10002010 | Ga0075433_1000201019 | 231 |
| 225 | 3300006871 | Ga0075434_100003989 | Ga0075434_10000398911 | 231 |
| 226 | 3300006914 | Ga0075436_100003948 | Ga0075436_1000039489 | 231 |
| 227 | 3300007076 | Ga0075435_100002516 | Ga0075435_10000251612 | 231 |
| 228 | 3300009094 | Ga0111539_10001773 | Ga0111539_1000177324 | 231 |
| 229 | 3300027907 | Ga0207428_10000855 | Ga0207428_1000085528 | 231 |
| 230 | 3300031852 | Ga0307410_10413768 | Ga0307410_104137681 | 231 |
| 231 | 3300042005 | Ga0439448_0036168 | Ga0439448_0036168_601_1326 | 231 |
| 232 | 3300050511 | nmdc:mga08y16_6996_c1 | nmdc:mga08y16_6996_c1_5840_6556 | 231 |
| 233 | 3300050512 | nmdc:mga0n895_390_c1 | nmdc:mga0n895_390_c1_9527_10243 | 231 |
| 234 | 3300050514 | nmdc:mga08x19_9875_c1 | nmdc:mga08x19_9875_c1_2410_3126 | 231 |
| 235 | 3300050515 | nmdc:mga0a205_545_c1 | nmdc:mga0a205_545_c1_9806_10522 | 231 |
| 236 | 3300005347 | Ga0070668_100029453 | Ga0070668_1000294532 | 232 |
| 237 | 3300005459 | Ga0068867_100070226 | Ga0068867_1000702262 | 232 |
| 238 | 3300005718 | Ga0068866_10168015 | Ga0068866_101680152 | 232 |
| 239 | 3300005843 | Ga0068860_100300915 | Ga0068860_1003009152 | 232 |
| 240 | 3300006881 | Ga0068865_100008425 | Ga0068865_1000084253 | 232 |
| 241 | 3300012515 | Ga0157338_1001423 | Ga0157338_10014232 | 232 |
| 242 | 3300025899 | Ga0207642_10148060 | Ga0207642_101480602 | 232 |
| 243 | 3300025901 | Ga0207688_10003001 | Ga0207688_100030014 | 232 |
| 244 | 3300025927 | Ga0207687_10016636 | Ga0207687_100166363 | 232 |
| 245 | 3300025934 | Ga0207686_10506773 | Ga0207686_105067731 | 232 |
| 246 | 3300025938 | Ga0207704_10038926 | Ga0207704_100389261 | 232 |
| 247 | 3300025961 | Ga0207712_10122742 | Ga0207712_101227422 | 232 |
| 248 | 3300025972 | Ga0207668_10019373 | Ga0207668_100193734 | 232 |
| 249 | 3300026089 | Ga0207648_10022104 | Ga0207648_100221046 | 232 |
| 250 | 3300026118 | Ga0207675_100011648 | Ga0207675_1000116488 | 232 |
| 251 | 3300028381 | Ga0268264_10245115 | Ga0268264_102451152 | 232 |
| 252 | 3300005366 | Ga0070659_100146033 | Ga0070659_1001460332 | 233 |
| 253 | 3300005843 | Ga0068860_100331885 | Ga0068860_1003318852 | 233 |
| 254 | 3300005844 | Ga0068862_100130063 | Ga0068862_1001300633 | 233 |
| 255 | 3300005937 | Ga0081455_10005218 | Ga0081455_100052188 | 233 |
| 256 | 3300005937 | Ga0081455_10023863 | Ga0081455_100238635 | 233 |
| 257 | 3300006058 | Ga0075432_10010600 | Ga0075432_100106004 | 233 |
| 258 | 3300006846 | Ga0075430_100308357 | Ga0075430_1003083572 | 233 |
| 259 | 3300006847 | Ga0075431_100029697 | Ga0075431_1000296977 | 233 |
| 260 | 3300006880 | Ga0075429_100049929 | Ga0075429_1000499294 | 233 |
| 261 | 3300006881 | Ga0068865_100066065 | Ga0068865_1000660653 | 233 |
| 262 | 3300007076 | Ga0075435_100005184 | Ga0075435_1000051843 | 233 |
| 263 | 3300009094 | Ga0111539_10008586 | Ga0111539_100085868 | 233 |
| 264 | 3300009147 | Ga0114129_10012017 | Ga0114129_100120177 | 233 |
| 265 | 3300009148 | Ga0105243_10040347 | Ga0105243_100403474 | 233 |
| 266 | 3300009176 | Ga0105242_10190275 | Ga0105242_101902753 | 233 |
| 267 | 3300009545 | Ga0105237_10666509 | Ga0105237_106665092 | 233 |
| 268 | 3300009553 | Ga0105249_10018095 | Ga0105249_100180954 | 233 |
| 269 | 3300009553 | Ga0105249_10089900 | Ga0105249_100899001 | 233 |
| 270 | 3300010375 | Ga0105239_10067515 | Ga0105239_100675153 | 233 |
| 271 | 3300013306 | Ga0163162_10035189 | Ga0163162_100351897 | 233 |
| 272 | 3300013307 | Ga0157372_10778059 | Ga0157372_107780591 | 233 |
| 273 | 3300017792 | Ga0163161_10089374 | Ga0163161_100893743 | 233 |
| 274 | 3300027907 | Ga0207428_10008400 | Ga0207428_100084002 | 233 |
| 275 | 3300031903 | Ga0307407_10160029 | Ga0307407_101600292 | 233 |
| 276 | 3300031911 | Ga0307412_10408814 | Ga0307412_104088142 | 233 |
| 277 | 3300031995 | Ga0307409_100265429 | Ga0307409_1002654292 | 233 |
| 278 | 3300031995 | Ga0307409_100992143 | Ga0307409_1009921432 | 233 |
| 279 | 3300032002 | Ga0307416_100583454 | Ga0307416_1005834542 | 233 |
| 280 | 3300032005 | Ga0307411_10105752 | Ga0307411_101057521 | 233 |
| 281 | 3300035121 | Ga0373960_0073416 | Ga0373960_0073416_289_1011 | 233 |
| 282 | 3300042008 | Ga0439450_078360 | Ga0439450_078360_62_784 | 233 |
| 283 | 3300042126 | Ga0450888_006017 | Ga0450888_006017_220_942 | 233 |
| 284 | 3300042437 | Ga0439444_0001661 | Ga0439444_0001661_1033_1755 | 233 |
| 285 | 3300042461 | Ga0439460_0044108 | Ga0439460_0044108_184_906 | 233 |
| 286 | 3300049523 | Ga0501300_007512 | Ga0501300_007512_562_1287 | 233 |
| 287 | 3300049675 | Ga0501243_014997 | Ga0501243_014997_14_739 | 233 |
| 288 | 3300049707 | Ga0501234_023153 | Ga0501234_023153_64_789 | 233 |
| 289 | 3300049851 | Ga0501212_003342 | Ga0501212_003342_1191_1916 | 233 |
| 290 | 3300050507 | nmdc:mga05p37_9426_c1 | nmdc:mga05p37_9426_c1_2463_3185 | 233 |
| 291 | 3300050508 | nmdc:mga09592_76448_c1 | nmdc:mga09592_76448_c1_1118_1840 | 233 |
| 292 | 3300050509 | nmdc:mga0qj67_474454_c1 | nmdc:mga0qj67_474454_c1_189_911 | 233 |
| 293 | 3300050510 | nmdc:mga06r32_16954_c2 | nmdc:mga06r32_16954_c2_196_918 | 233 |
| 294 | 3300050511 | nmdc:mga08y16_12187_c1 | nmdc:mga08y16_12187_c1_6074_6796 | 233 |
| 295 | 3300050512 | nmdc:mga0n895_216120_c1 | nmdc:mga0n895_216120_c1_437_1159 | 233 |
| 296 | 3300050513 | nmdc:mga0rr50_16676_c1 | nmdc:mga0rr50_16676_c1_1617_2339 | 233 |
| 297 | 3300050515 | nmdc:mga0a205_11637_c1 | nmdc:mga0a205_11637_c1_3515_4237 | 233 |
| 298 | 3300009148 | Ga0105243_10696594 | Ga0105243_106965942 | 234 |
| 299 | 3300025933 | Ga0207706_10395308 | Ga0207706_103953081 | 234 |
| 300 | 3300003911 | JGI25405J52794_10014468 | JGI25405J52794_100144682 | 239 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar