F395341

General Info

Members Datasets Scaffolds Average Seq Length
300 190 293 217

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10696594|Ga0105243_106965942
Length 249
Sequence VTGSEPQASIAGVPQNPETGSMATTGEGPIAGTAGGSADARAASQGGPPYDTDRTWTLPNLLSMLRLAGAPFVLWLILGPQADGLAVLVLAVGGCTDWLDGYLARAWHQTSRLGQMLDPIADRLYIVAVLTGLALREIVPWWLVVIVIGRDVMIASLVPLLKTRGFSSLPVHFLGKAATFSLLYAFPLVLLGSGEQGWLQLAWVLGWAFAIWGTALYWYAGGLYVAQTVKLVRTMPPINDRQRGGSTSG

Samples

Sample ID Description Type Environment
1 2643221617 Nocardioides sp. Root79 Isolate Unclassified
2 2643221620 Nocardioides sp. Root240 Isolate Unclassified
3 2643221696 Nocardioides sp. Root140 Isolate Unclassified
4 2738541305 Nocardioides sp. CF167 Isolate Unclassified
5 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
6 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
7 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
119 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
120 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
121 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
122 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
174 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
175 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
176 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0.33
Isolates 2.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 8.67
Rhizosphere 88.67
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10014468 3300003911 Bacteria 1541
2 JGI25405J52794_10059252 3300003911 Bacteria 826
3 Ga0070658_10036586 3300005327 Bacteria 3957
4 Ga0070683_100079089 3300005329 Bacteria 3077
5 Ga0070683_100170668 3300005329 Bacteria 2065
6 Ga0070670_100429402 3300005331 Bacteria 1169
7 Ga0070682_100017908 3300005337 Bacteria 4133
8 Ga0070682_100064099 3300005337 Unclassified 2332
9 Ga0070691_10080502 3300005341 Bacteria 1594
10 Ga0070687_100097496 3300005343 Bacteria 1639
11 Ga0070668_100029453 3300005347 Bacteria 4170
12 Ga0070668_100294774 3300005347 Bacteria 1359
13 Ga0070669_100223598 3300005353 Bacteria 1489
14 Ga0070675_100124797 3300005354 Bacteria 2190
15 Ga0070673_100526543 3300005364 Bacteria 1072
16 Ga0070688_100227099 3300005365 Bacteria 1319
17 Ga0070659_100004944 3300005366 Bacteria 9534
18 Ga0070659_100017974 3300005366 Bacteria 5329
19 Ga0070659_100146033 3300005366 Bacteria 1927
20 Ga0070701_10078308 3300005438 Bacteria 1783
21 Ga0070701_10126865 3300005438 Bacteria 1445
22 Ga0070705_100321110 3300005440 Bacteria 1118
23 Ga0070700_100000406 3300005441 Bacteria 22003
24 Ga0070662_100028258 3300005457 Bacteria 3901
25 Ga0068867_100070226 3300005459 Bacteria 2618
26 Ga0068867_100087869 3300005459 Bacteria 2354
27 Ga0070684_100153143 3300005535 Bacteria 2090
28 Ga0070695_100339370 3300005545 Bacteria 1122
29 Ga0068855_100442349 3300005563 Bacteria 1419
30 Ga0070664_100178256 3300005564 Bacteria 1888
31 Ga0070702_100033494 3300005615 Bacteria 2826
32 Ga0068852_100347614 3300005616 Bacteria 1447
33 Ga0068859_100547361 3300005617 Bacteria 1252
34 Ga0068866_10168015 3300005718 Bacteria 1285
35 Ga0068866_10257073 3300005718 Bacteria 1071
36 Ga0068870_10001067 3300005840 Bacteria 10886
37 Ga0068858_100528592 3300005842 Bacteria 1141
38 Ga0068860_100300915 3300005843 Bacteria 1571
39 Ga0068860_100331885 3300005843 Bacteria 1494
40 Ga0068862_100130063 3300005844 Bacteria 2226
41 Ga0081455_10005218 3300005937 Bacteria 14293
42 Ga0081455_10022172 3300005937 Bacteria 5942
43 Ga0081455_10023863 3300005937 Bacteria 5681
44 Ga0081455_10078107 3300005937 Bacteria 2721
45 Ga0081538_10001931 3300005981 Bacteria 20762
46 Ga0081538_10096216 3300005981 Unclassified 1509
47 Ga0075432_10000028 3300006058 Bacteria 26814
48 Ga0075432_10010600 3300006058 Unclassified 3130
49 Ga0075432_10023546 3300006058 Bacteria 2109
50 Ga0075428_100254142 3300006844 Bacteria 1893
51 Ga0075428_100426656 3300006844 Bacteria 1421
52 Ga0075428_100865121 3300006844 Bacteria 959
53 Ga0075430_100308357 3300006846 Bacteria 1309
54 Ga0075431_100029697 3300006847 Bacteria 5628
55 Ga0075433_10002010 3300006852 Bacteria 15326
56 Ga0075434_100003989 3300006871 Bacteria 13221
57 Ga0075434_101362465 3300006871 Bacteria 720
58 Ga0075429_100049929 3300006880 Unclassified 3640
59 Ga0068865_100008425 3300006881 Bacteria 6375
60 Ga0068865_100022810 3300006881 Bacteria 4090
61 Ga0068865_100066065 3300006881 Bacteria 2551
62 Ga0075436_100003948 3300006914 Bacteria 10166
63 Ga0097620_100547357 3300006931 Bacteria 1252
64 Ga0097620_101092046 3300006931 Bacteria 877
65 Ga0075435_100002516 3300007076 Bacteria 12200
66 Ga0075435_100005184 3300007076 Bacteria 9065
67 Ga0111539_10001773 3300009094 Bacteria 28685
68 Ga0111539_10008586 3300009094 Bacteria 12973
69 Ga0105245_10025877 3300009098 Bacteria 5161
70 Ga0105245_10036510 3300009098 Bacteria 4366
71 Ga0105245_10087349 3300009098 Bacteria 2862
72 Ga0114129_10012017 3300009147 Bacteria 12315
73 Ga0114129_10450543 3300009147 Bacteria 1688
74 Ga0105243_10016977 3300009148 Bacteria 5504
75 Ga0105243_10040347 3300009148 Unclassified 3645
76 Ga0105243_10609959 3300009148 Bacteria 1052
77 Ga0105243_10696594 3300009148 Unclassified 990
78 Ga0105242_10190275 3300009176 Bacteria 1816
79 Ga0105237_10666509 3300009545 Bacteria 1047
80 Ga0105238_10321784 3300009551 Bacteria 1533
81 Ga0105249_10018095 3300009553 Bacteria 6263
82 Ga0105249_10089900 3300009553 Bacteria 2870
83 Ga0105249_11084949 3300009553 Bacteria 870
84 Ga0105239_10022373 3300010375 Bacteria 6969
85 Ga0105239_10059048 3300010375 Bacteria 4210
86 Ga0105239_10067515 3300010375 Unclassified 3928
87 Ga0105246_10625657 3300011119 Bacteria 933
88 Ga0157338_1001423 3300012515 Unclassified 1705
89 Ga0157371_10322154 3300013102 Bacteria 1122
90 Ga0163162_10035189 3300013306 Bacteria 4987
91 Ga0157372_10048131 3300013307 Bacteria 4739
92 Ga0157372_10778059 3300013307 Bacteria 1112
93 Ga0157372_11461991 3300013307 Bacteria 787
94 Ga0157375_11299750 3300013308 Bacteria 855
95 Ga0163163_10633854 3300014325 Bacteria 1132
96 Ga0163163_10686596 3300014325 Bacteria 1087
97 Ga0157380_10041630 3300014326 Unclassified 3586
98 Ga0157380_10650019 3300014326 Bacteria 1052
99 Ga0163161_10089374 3300017792 Bacteria 2278
100 Ga0163161_10468423 3300017792 Bacteria 1021
101 Ga0206356_11240218 3300020070 Bacteria 1608
102 Ga0207642_10148060 3300025899 Bacteria 1246
103 Ga0207642_10158967 3300025899 Bacteria 1211
104 Ga0207688_10003001 3300025901 Bacteria 9192
105 Ga0207647_10139154 3300025904 Bacteria 1423
106 Ga0207643_10001879 3300025908 Bacteria 11602
107 Ga0207705_10047719 3300025909 Bacteria 3079
108 Ga0207705_10365331 3300025909 Bacteria 1113
109 Ga0207705_10473579 3300025909 Bacteria 972
110 Ga0207662_10095366 3300025918 Bacteria 1836
111 Ga0207657_10015319 3300025919 Bacteria 7432
112 Ga0207694_10175808 3300025924 Bacteria 1735
113 Ga0207694_10240101 3300025924 Bacteria 1481
114 Ga0207650_10527693 3300025925 Bacteria 988
115 Ga0207659_10212447 3300025926 Bacteria 1551
116 Ga0207687_10016636 3300025927 Bacteria 4832
117 Ga0207687_10057785 3300025927 Bacteria 2727
118 Ga0207687_10228278 3300025927 Bacteria 1469
119 Ga0207687_10391788 3300025927 Bacteria 1140
120 Ga0207690_10149246 3300025932 Bacteria 1732
121 Ga0207706_10395308 3300025933 Bacteria 1199
122 Ga0207686_10050863 3300025934 Bacteria 2579
123 Ga0207686_10506773 3300025934 Bacteria 937
124 Ga0207709_10251130 3300025935 Bacteria 1292
125 Ga0207709_10334341 3300025935 Bacteria 1138
126 Ga0207709_10865707 3300025935 Bacteria 733
127 Ga0207669_10115783 3300025937 Bacteria 1808
128 Ga0207704_10038926 3300025938 Unclassified 2763
129 Ga0207704_10221985 3300025938 Bacteria 1399
130 Ga0207661_10114309 3300025944 Bacteria 2288
131 Ga0207661_10659360 3300025944 Bacteria 962
132 Ga0207712_10027364 3300025961 Bacteria 3807
133 Ga0207712_10122742 3300025961 Bacteria 1968
134 Ga0207668_10019373 3300025972 Bacteria 4301
135 Ga0207668_10131448 3300025972 Bacteria 1912
136 Ga0207677_10574005 3300026023 Bacteria 986
137 Ga0207639_10895652 3300026041 Bacteria 829
138 Ga0207708_10064908 3300026075 Bacteria 2790
139 Ga0207708_10530054 3300026075 Bacteria 991
140 Ga0207648_10010968 3300026089 Bacteria 8561
141 Ga0207648_10022104 3300026089 Bacteria 5714
142 Ga0207675_100000862 3300026118 Bacteria 30299
143 Ga0207675_100011648 3300026118 Bacteria 8223
144 Ga0207683_10359671 3300026121 Bacteria 1337
145 Ga0207698_10144567 3300026142 Bacteria 2054
146 Ga0207428_10000855 3300027907 Bacteria 34313
147 Ga0207428_10008400 3300027907 Bacteria 9325
148 Ga0207428_10039472 3300027907 Bacteria 3834
149 Ga0268265_10212502 3300028380 Bacteria 1687
150 Ga0268264_10245115 3300028381 Bacteria 1662
151 Ga0307408_100019928 3300031548 Bacteria 4519
152 Ga0307405_10001045 3300031731 Bacteria 11203
153 Ga0307405_10140082 3300031731 Bacteria 1685
154 Ga0307405_10155222 3300031731 Bacteria 1614
155 Ga0307413_10003566 3300031824 Bacteria 6583
156 Ga0307410_10000766 3300031852 Bacteria 13524
157 Ga0307410_10001024 3300031852 Bacteria 12121
158 Ga0307410_10010771 3300031852 Bacteria 5201
159 Ga0307410_10413768 3300031852 Bacteria 1092
160 Ga0307406_10005025 3300031901 Bacteria 7210
161 Ga0307407_10009401 3300031903 Bacteria 4552
162 Ga0307407_10021498 3300031903 Bacteria 3329
163 Ga0307407_10160029 3300031903 Bacteria 1473
164 Ga0307412_10146043 3300031911 Bacteria 1739
165 Ga0307412_10335500 3300031911 Unclassified 1208
166 Ga0307412_10408814 3300031911 Bacteria 1107
167 Ga0307409_100000183 3300031995 Bacteria 24466
168 Ga0307409_100009847 3300031995 Bacteria 5897
169 Ga0307409_100203443 3300031995 Bacteria 1773
170 Ga0307409_100265429 3300031995 Bacteria 1578
171 Ga0307409_100992143 3300031995 Unclassified 857
172 Ga0307416_100000124 3300032002 Bacteria 46509
173 Ga0307416_100014956 3300032002 Bacteria 5340
174 Ga0307416_100583454 3300032002 Bacteria 1195
175 Ga0307414_10006047 3300032004 Bacteria 6714
176 Ga0307414_10117747 3300032004 Bacteria 2036
177 Ga0307411_10009966 3300032005 Bacteria 5034
178 Ga0307411_10105752 3300032005 Unclassified 2001
179 Ga0307411_10259233 3300032005 Unclassified 1372
180 Ga0307411_10278309 3300032005 Bacteria 1330
181 Ga0307415_100002631 3300032126 Bacteria 8945
182 Ga0307415_100003201 3300032126 Bacteria 8307
183 Ga0307415_100593911 3300032126 Bacteria 984
184 Ga0373960_0073416 3300035121 Bacteria 1063
185 Ga0395901_0038740 3300038443 Bacteria 4931
186 Ga0242420_029975 3300038996 Bacteria 1006
187 Ga0439448_0036168 3300042005 Bacteria 1583
188 Ga0439450_003317 3300042008 Bacteria 2648
189 Ga0439450_078360 3300042008 Unclassified 819
190 Ga0439463_002099 3300042016 Bacteria 5154
191 Ga0450888_006017 3300042126 Unclassified 1308
192 Ga0439446_0062068 3300042156 Bacteria 1131
193 Ga0439444_0001661 3300042437 Unclassified 2930
194 Ga0439460_0044108 3300042461 Unclassified 1319
195 Ga0439440_0001936 3300042993 Bacteria 3846
196 Ga0466972_0002214 3300044658 Bacteria 9547
197 Ga0466972_0095074 3300044658 Bacteria 1412
198 Ga0466965_0010900 3300044683 Bacteria 4252
199 Ga0466961_0100025 3300044693 Bacteria 1827
200 Ga0466963_0169548 3300044694 Bacteria 1521
201 Ga0466964_0005846 3300044706 Bacteria 4577
202 Ga0466971_0031191 3300044719 Bacteria 2386
203 Ga0466970_0016232 3300044765 Bacteria 3837
204 Ga0466970_0067952 3300044765 Bacteria 1914
205 Ga0466957_0007885 3300044842 Bacteria 6038
206 Ga0466957_0089800 3300044842 Bacteria 1924
207 Ga0466958_0032414 3300045836 Bacteria 3108
208 Ga0466967_0206429 3300045976 Bacteria 1862
209 Ga0466967_0323207 3300045976 Bacteria 1488
210 Ga0466967_0348275 3300045976 Bacteria 1433
211 Ga0466967_1344613 3300045976 Bacteria 711
212 Ga0495641_0052075 3300046461 Bacteria 1867
213 Ga0495582_0275525 3300046473 Bacteria 966
214 Ga0495644_0090865 3300046523 Bacteria 1152
215 Ga0495598_0136027 3300046537 Bacteria 847
216 Ga0495611_0136773 3300046648 Unclassified 1144
217 Ga0495661_0221230 3300046665 Bacteria 981
218 Ga0495658_0523496 3300046683 Bacteria 759
219 Ga0495660_0067268 3300046810 Bacteria 1909
220 Ga0496101_0211279 3300048904 Bacteria 1503
221 Ga0496102_0019554 3300048905 Bacteria 5965
222 Ga0496104_0121292 3300048907 Bacteria 2510
223 Ga0496105_0202755 3300048908 Bacteria 1619
224 Ga0496105_0533540 3300048908 Bacteria 918
225 Ga0496105_0540071 3300048908 Bacteria 911
226 Ga0496106_0015694 3300048909 Bacteria 5604
227 Ga0496107_0008975 3300048910 Bacteria 6930
228 Ga0496108_0004318 3300048911 Bacteria 11429
229 Ga0496108_0007443 3300048911 Bacteria 8874
230 Ga0496108_0418567 3300048911 Bacteria 1170
231 Ga0496109_0004950 3300048912 Bacteria 11126
232 Ga0496109_0031260 3300048912 Bacteria 4777
233 Ga0496109_0525508 3300048912 Bacteria 1117
234 Ga0496110_0014266 3300048913 Bacteria 6592
235 Ga0496110_0109281 3300048913 Bacteria 2483
236 Ga0496110_0125656 3300048913 Bacteria 2314
237 Ga0496110_0144293 3300048913 Bacteria 2153
238 Ga0496111_0018998 3300048914 Bacteria 4766
239 Ga0496111_0107553 3300048914 Bacteria 2053
240 Ga0496112_0860739 3300048915 Bacteria 829
241 Ga0496113_0063131 3300048916 Bacteria 2799
242 Ga0496113_0307830 3300048916 Bacteria 1269
243 Ga0496114_0012935 3300048917 Bacteria 6685
244 Ga0496114_0362604 3300048917 Bacteria 1282
245 Ga0496114_1031012 3300048917 Bacteria 706
246 Ga0501300_007512 3300049523 Unclassified 1599
247 Ga0501033_0065286 3300049570 Bacteria 2678
248 Ga0501034_0009364 3300049571 Bacteria 10262
249 Ga0501034_0235244 3300049571 Bacteria 1780
250 Ga0501036_0131115 3300049572 Bacteria 2116
251 Ga0501037_0173418 3300049573 Bacteria 1532
252 Ga0501038_0005729 3300049574 Bacteria 11514
253 Ga0501039_0016129 3300049575 Bacteria 5723
254 Ga0501039_0469785 3300049575 Bacteria 988
255 Ga0501040_0185394 3300049576 Bacteria 1476
256 Ga0501042_0011581 3300049578 Bacteria 5956
257 Ga0501043_0500820 3300049579 Bacteria 907
258 Ga0501046_0081249 3300049580 Bacteria 2503
259 Ga0501047_0045219 3300049581 Bacteria 4256
260 Ga0501067_0087592 3300049583 Bacteria 1728
261 Ga0501068_0025816 3300049584 Bacteria 3458
262 Ga0501068_0566833 3300049584 Bacteria 739
263 Ga0501069_0037061 3300049585 Bacteria 2691
264 Ga0501069_0060975 3300049585 Bacteria 2106
265 Ga0501070_0015547 3300049586 Bacteria 6401
266 Ga0501070_0018932 3300049586 Bacteria 5775
267 Ga0501071_0183623 3300049587 Bacteria 1568
268 Ga0501073_0026576 3300049589 Bacteria 4145
269 Ga0501074_0111765 3300049590 Bacteria 1954
270 Ga0501207_015375 3300049654 Unclassified 1178
271 Ga0501243_014997 3300049675 Unclassified 1243
272 Ga0501234_023153 3300049707 Unclassified 993
273 Ga0501044_0023050 3300049823 Bacteria 6627
274 Ga0501212_003342 3300049851 Bacteria 2006
275 nmdc:mga05p37_763842_c1 3300050507 Bacteria 1063
276 nmdc:mga05p37_9426_c1 3300050507 Bacteria 11560
277 nmdc:mga09592_76448_c1 3300050508 Unclassified 2243
278 nmdc:mga0qj67_474454_c1 3300050509 Bacteria 1007
279 nmdc:mga06r32_16954_c2 3300050510 Bacteria 5171
280 nmdc:mga08y16_12187_c1 3300050511 Bacteria 9038
281 nmdc:mga08y16_6996_c1 3300050511 Bacteria 11831
282 nmdc:mga0n895_216120_c1 3300050512 Bacteria 1947
283 nmdc:mga0n895_390_c1 3300050512 Bacteria 29396
284 nmdc:mga0n895_635973_c1 3300050512 Bacteria 1067
285 nmdc:mga0rr50_16676_c1 3300050513 Unclassified 4885
286 nmdc:mga08x19_9875_c1 3300050514 Bacteria 5722
287 nmdc:mga0a205_11637_c1 3300050515 Bacteria 8111
288 nmdc:mga0a205_545_c1 3300050515 Bacteria 29797
289 Ga0495619_0133746 3300053085 Bacteria 1705
290 Ga0500620_054311 3300053155 Bacteria 1351
291 Ga0466962_0092891 3300061719 Bacteria 1446
292 Ga0530510_0019317 3300061734 Bacteria 4837
293 Ga0530510_0112481 3300061734 Bacteria 1995

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042156 Ga0439446_0062068 Ga0439446_0062068_202_804 191
2 3300045976 Ga0466967_1344613 Ga0466967_1344613_81_683 193
3 3300046473 Ga0495582_0275525 Ga0495582_0275525_121_726 193
4 3300049576 Ga0501040_0185394 Ga0501040_0185394_137_739 193
5 3300049583 Ga0501067_0087592 Ga0501067_0087592_599_1201 193
6 iso_pu_bacteria 2643221617 2644101703 193
7 iso_pu_bacteria 2643221620 2644115765 193
8 iso_pu_bacteria 2855386786 2855387322 193
9 3300009551 Ga0105238_10321784 Ga0105238_103217842 194
10 3300011119 Ga0105246_10625657 Ga0105246_106256572 194
11 3300013102 Ga0157371_10322154 Ga0157371_103221542 194
12 3300025924 Ga0207694_10175808 Ga0207694_101758082 194
13 3300044658 Ga0466972_0095074 Ga0466972_0095074_14_619 194
14 3300048911 Ga0496108_0418567 Ga0496108_0418567_453_1058 194
15 3300048912 Ga0496109_0525508 Ga0496109_0525508_137_742 194
16 3300048913 Ga0496110_0144293 Ga0496110_0144293_72_677 194
17 3300049575 Ga0501039_0469785 Ga0501039_0469785_262_864 194
18 3300049587 Ga0501071_0183623 Ga0501071_0183623_908_1510 194
19 3300005438 Ga0070701_10126865 Ga0070701_101268651 195
20 3300005440 Ga0070705_100321110 Ga0070705_1003211102 195
21 3300009098 Ga0105245_10087349 Ga0105245_100873492 195
22 3300009147 Ga0114129_10450543 Ga0114129_104505431 195
23 3300010375 Ga0105239_10022373 Ga0105239_100223734 195
24 3300013308 Ga0157375_11299750 Ga0157375_112997501 195
25 3300025909 Ga0207705_10365331 Ga0207705_103653312 195
26 3300025924 Ga0207694_10240101 Ga0207694_102401012 195
27 3300038996 Ga0242420_029975 Ga0242420_029975_147_755 195
28 3300044658 Ga0466972_0002214 Ga0466972_0002214_2855_3463 195
29 3300044683 Ga0466965_0010900 Ga0466965_0010900_3420_4028 195
30 3300044693 Ga0466961_0100025 Ga0466961_0100025_62_670 195
31 3300044694 Ga0466963_0169548 Ga0466963_0169548_566_1174 195
32 3300044706 Ga0466964_0005846 Ga0466964_0005846_895_1503 195
33 3300044719 Ga0466971_0031191 Ga0466971_0031191_805_1413 195
34 3300044765 Ga0466970_0067952 Ga0466970_0067952_550_1158 195
35 3300044842 Ga0466957_0007885 Ga0466957_0007885_342_950 195
36 3300045836 Ga0466958_0032414 Ga0466958_0032414_1127_1735 195
37 3300045976 Ga0466967_0348275 Ga0466967_0348275_677_1285 195
38 3300046683 Ga0495658_0523496 Ga0495658_0523496_44_652 195
39 3300048904 Ga0496101_0211279 Ga0496101_0211279_879_1487 195
40 3300048905 Ga0496102_0019554 Ga0496102_0019554_1443_2051 195
41 3300048907 Ga0496104_0121292 Ga0496104_0121292_1767_2375 195
42 3300048908 Ga0496105_0533540 Ga0496105_0533540_150_758 195
43 3300048909 Ga0496106_0015694 Ga0496106_0015694_1125_1733 195
44 3300048910 Ga0496107_0008975 Ga0496107_0008975_1400_2008 195
45 3300048911 Ga0496108_0004318 Ga0496108_0004318_121_729 195
46 3300048913 Ga0496110_0109281 Ga0496110_0109281_1340_1948 195
47 3300048914 Ga0496111_0107553 Ga0496111_0107553_938_1546 195
48 3300048915 Ga0496112_0860739 Ga0496112_0860739_67_675 195
49 3300048916 Ga0496113_0063131 Ga0496113_0063131_641_1249 195
50 3300048917 Ga0496114_1031012 Ga0496114_1031012_38_646 195
51 3300049570 Ga0501033_0065286 Ga0501033_0065286_103_717 195
52 3300049571 Ga0501034_0009364 Ga0501034_0009364_4368_4982 195
53 3300049572 Ga0501036_0131115 Ga0501036_0131115_466_1080 195
54 3300049573 Ga0501037_0173418 Ga0501037_0173418_465_1079 195
55 3300049574 Ga0501038_0005729 Ga0501038_0005729_7130_7744 195
56 3300049575 Ga0501039_0016129 Ga0501039_0016129_1632_2246 195
57 3300049578 Ga0501042_0011581 Ga0501042_0011581_4222_4836 195
58 3300049579 Ga0501043_0500820 Ga0501043_0500820_215_829 195
59 3300049580 Ga0501046_0081249 Ga0501046_0081249_1083_1697 195
60 3300049581 Ga0501047_0045219 Ga0501047_0045219_35_649 195
61 3300049584 Ga0501068_0025816 Ga0501068_0025816_860_1468 195
62 3300049584 Ga0501068_0566833 Ga0501068_0566833_31_639 195
63 3300049589 Ga0501073_0026576 Ga0501073_0026576_2664_3278 195
64 3300049823 Ga0501044_0023050 Ga0501044_0023050_3083_3697 195
65 3300050507 nmdc:mga05p37_763842_c1 nmdc:mga05p37_763842_c1_60_668 195
66 3300050512 nmdc:mga0n895_635973_c1 nmdc:mga0n895_635973_c1_13_621 195
67 3300061719 Ga0466962_0092891 Ga0466962_0092891_608_1216 195
68 3300061734 Ga0530510_0019317 Ga0530510_0019317_3010_3618 195
69 iso_pu_bacteria 2811994874 2812332926 195
70 3300005842 Ga0068858_100528592 Ga0068858_1005285921 196
71 3300009148 Ga0105243_10609959 Ga0105243_106099592 196
72 3300013307 Ga0157372_11461991 Ga0157372_114619911 196
73 3300014325 Ga0163163_10686596 Ga0163163_106865962 196
74 3300020070 Ga0206356_11240218 Ga0206356_112402181 196
75 3300025927 Ga0207687_10391788 Ga0207687_103917882 196
76 3300026075 Ga0207708_10530054 Ga0207708_105300541 196
77 iso_pu_bacteria 2738541305 2738868461 196
78 3300005364 Ga0070673_100526543 Ga0070673_1005265431 197
79 3300006871 Ga0075434_101362465 Ga0075434_1013624651 197
80 3300006931 Ga0097620_101092046 Ga0097620_1010920461 197
81 3300025927 Ga0207687_10228278 Ga0207687_102282783 197
82 3300025944 Ga0207661_10659360 Ga0207661_106593601 197
83 3300026023 Ga0207677_10574005 Ga0207677_105740052 197
84 3300031731 Ga0307405_10140082 Ga0307405_101400822 197
85 3300031852 Ga0307410_10010771 Ga0307410_100107711 197
86 3300031903 Ga0307407_10021498 Ga0307407_100214981 197
87 3300031911 Ga0307412_10146043 Ga0307412_101460432 197
88 3300031995 Ga0307409_100009847 Ga0307409_1000098479 197
89 3300032002 Ga0307416_100014956 Ga0307416_1000149567 197
90 3300032004 Ga0307414_10117747 Ga0307414_101177473 197
91 3300032005 Ga0307411_10009966 Ga0307411_100099662 197
92 3300032126 Ga0307415_100593911 Ga0307415_1005939111 197
93 3300038443 Ga0395901_0038740 Ga0395901_0038740_1411_2025 197
94 3300045976 Ga0466967_0323207 Ga0466967_0323207_322_936 197
95 3300049585 Ga0501069_0037061 Ga0501069_0037061_1318_1932 197
96 3300049586 Ga0501070_0015547 Ga0501070_0015547_5565_6179 197
97 3300049590 Ga0501074_0111765 Ga0501074_0111765_432_1046 197
98 3300053155 Ga0500620_054311 Ga0500620_054311_441_1055 197
99 3300005329 Ga0070683_100079089 Ga0070683_1000790892 199
100 3300005329 Ga0070683_100170668 Ga0070683_1001706682 199
101 3300005331 Ga0070670_100429402 Ga0070670_1004294021 199
102 3300005337 Ga0070682_100017908 Ga0070682_1000179085 199
103 3300005341 Ga0070691_10080502 Ga0070691_100805022 199
104 3300005343 Ga0070687_100097496 Ga0070687_1000974962 199
105 3300005353 Ga0070669_100223598 Ga0070669_1002235982 199
106 3300005354 Ga0070675_100124797 Ga0070675_1001247972 199
107 3300005365 Ga0070688_100227099 Ga0070688_1002270992 199
108 3300005366 Ga0070659_100004944 Ga0070659_10000494414 199
109 3300005438 Ga0070701_10078308 Ga0070701_100783082 199
110 3300005441 Ga0070700_100000406 Ga0070700_1000004064 199
111 3300005459 Ga0068867_100087869 Ga0068867_1000878694 199
112 3300005535 Ga0070684_100153143 Ga0070684_1001531432 199
113 3300005545 Ga0070695_100339370 Ga0070695_1003393702 199
114 3300005564 Ga0070664_100178256 Ga0070664_1001782563 199
115 3300005615 Ga0070702_100033494 Ga0070702_1000334944 199
116 3300005616 Ga0068852_100347614 Ga0068852_1003476142 199
117 3300005617 Ga0068859_100547361 Ga0068859_1005473611 199
118 3300005718 Ga0068866_10257073 Ga0068866_102570732 199
119 3300005840 Ga0068870_10001067 Ga0068870_100010674 199
120 3300006058 Ga0075432_10023546 Ga0075432_100235462 199
121 3300006844 Ga0075428_100865121 Ga0075428_1008651212 199
122 3300006881 Ga0068865_100022810 Ga0068865_1000228105 199
123 3300006931 Ga0097620_100547357 Ga0097620_1005473571 199
124 3300025899 Ga0207642_10158967 Ga0207642_101589671 199
125 3300025908 Ga0207643_10001879 Ga0207643_1000187915 199
126 3300025918 Ga0207662_10095366 Ga0207662_100953662 199
127 3300025925 Ga0207650_10527693 Ga0207650_105276932 199
128 3300025926 Ga0207659_10212447 Ga0207659_102124472 199
129 3300025927 Ga0207687_10057785 Ga0207687_100577854 199
130 3300025934 Ga0207686_10050863 Ga0207686_100508632 199
131 3300025935 Ga0207709_10334341 Ga0207709_103343411 199
132 3300025944 Ga0207661_10114309 Ga0207661_101143093 199
133 3300025961 Ga0207712_10027364 Ga0207712_100273641 199
134 3300026041 Ga0207639_10895652 Ga0207639_108956522 199
135 3300026075 Ga0207708_10064908 Ga0207708_100649083 199
136 3300026089 Ga0207648_10010968 Ga0207648_100109683 199
137 3300026118 Ga0207675_100000862 Ga0207675_10000086227 199
138 3300026142 Ga0207698_10144567 Ga0207698_101445672 199
139 3300027907 Ga0207428_10039472 Ga0207428_100394725 199
140 3300005347 Ga0070668_100294774 Ga0070668_1002947742 200
141 3300025935 Ga0207709_10251130 Ga0207709_102511302 200
142 3300025972 Ga0207668_10131448 Ga0207668_101314482 200
143 3300028380 Ga0268265_10212502 Ga0268265_102125022 200
144 3300031911 Ga0307412_10335500 Ga0307412_103355002 200
145 3300032005 Ga0307411_10259233 Ga0307411_102592332 200
146 3300042008 Ga0439450_003317 Ga0439450_003317_1146_1769 200
147 3300042016 Ga0439463_002099 Ga0439463_002099_3944_4567 200
148 3300042993 Ga0439440_0001936 Ga0439440_0001936_2355_2978 200
149 3300009553 Ga0105249_11084949 Ga0105249_110849491 202
150 3300048908 Ga0496105_0540071 Ga0496105_0540071_31_708 202
151 3300048912 Ga0496109_0031260 Ga0496109_0031260_3611_4288 202
152 3300048913 Ga0496110_0014266 Ga0496110_0014266_797_1474 202
153 3300048914 Ga0496111_0018998 Ga0496111_0018998_1757_2434 202
154 3300049571 Ga0501034_0235244 Ga0501034_0235244_925_1554 202
155 3300049585 Ga0501069_0060975 Ga0501069_0060975_101_730 202
156 3300049586 Ga0501070_0018932 Ga0501070_0018932_2033_2662 202
157 3300061734 Ga0530510_0112481 Ga0530510_0112481_1252_1881 202
158 iso_pu_bacteria 2643221696 2644531922 202
159 3300005327 Ga0070658_10036586 Ga0070658_100365864 203
160 3300005366 Ga0070659_100017974 Ga0070659_1000179742 203
161 3300005563 Ga0068855_100442349 Ga0068855_1004423491 203
162 3300025904 Ga0207647_10139154 Ga0207647_101391542 203
163 3300025909 Ga0207705_10047719 Ga0207705_100477193 203
164 3300025909 Ga0207705_10473579 Ga0207705_104735792 203
165 3300025919 Ga0207657_10015319 Ga0207657_1001531910 203
166 3300025932 Ga0207690_10149246 Ga0207690_101492462 203
167 3300053085 Ga0495619_0133746 Ga0495619_0133746_23_655 203
168 3300044765 Ga0466970_0016232 Ga0466970_0016232_3145_3789 204
169 3300045976 Ga0466967_0206429 Ga0466967_0206429_1087_1731 204
170 3300046461 Ga0495641_0052075 Ga0495641_0052075_205_882 204
171 iso_pu_bacteria 2990256926 2990259044 204
172 3300005337 Ga0070682_100064099 Ga0070682_1000640992 205
173 3300005457 Ga0070662_100028258 Ga0070662_1000282582 205
174 3300009098 Ga0105245_10025877 Ga0105245_100258773 205
175 3300009148 Ga0105243_10016977 Ga0105243_100169776 205
176 3300010375 Ga0105239_10059048 Ga0105239_100590485 205
177 3300013307 Ga0157372_10048131 Ga0157372_100481312 205
178 3300014326 Ga0157380_10041630 Ga0157380_100416304 205
179 3300044842 Ga0466957_0089800 Ga0466957_0089800_710_1354 207
180 3300009098 Ga0105245_10036510 Ga0105245_100365101 208
181 3300017792 Ga0163161_10468423 Ga0163161_104684232 208
182 3300025935 Ga0207709_10865707 Ga0207709_108657072 208
183 3300025938 Ga0207704_10221985 Ga0207704_102219852 208
184 3300048908 Ga0496105_0202755 Ga0496105_0202755_529_1176 208
185 3300048911 Ga0496108_0007443 Ga0496108_0007443_6577_7224 208
186 3300048912 Ga0496109_0004950 Ga0496109_0004950_8828_9475 208
187 3300048913 Ga0496110_0125656 Ga0496110_0125656_1247_1894 208
188 3300048916 Ga0496113_0307830 Ga0496113_0307830_483_1130 208
189 3300048917 Ga0496114_0012935 Ga0496114_0012935_1164_1811 208
190 3300006844 Ga0075428_100426656 Ga0075428_1004266562 209
191 3300014325 Ga0163163_10633854 Ga0163163_106338542 214
192 3300014326 Ga0157380_10650019 Ga0157380_106500192 214
193 3300025937 Ga0207669_10115783 Ga0207669_101157833 214
194 3300026121 Ga0207683_10359671 Ga0207683_103596712 214
195 3300046537 Ga0495598_0136027 Ga0495598_0136027_62_748 214
196 3300046665 Ga0495661_0221230 Ga0495661_0221230_248_934 214
197 3300049654 Ga0501207_015375 Ga0501207_015375_12_680 214
198 3300046523 Ga0495644_0090865 Ga0495644_0090865_352_1101 216
199 3300031731 Ga0307405_10155222 Ga0307405_101552222 221
200 3300031852 Ga0307410_10001024 Ga0307410_1000102415 221
201 3300031903 Ga0307407_10009401 Ga0307407_100094013 221
202 3300031995 Ga0307409_100203443 Ga0307409_1002034432 221
203 3300032005 Ga0307411_10278309 Ga0307411_102783092 221
204 3300032126 Ga0307415_100002631 Ga0307415_1000026318 221
205 3300046648 Ga0495611_0136773 Ga0495611_0136773_223_972 223
206 3300046810 Ga0495660_0067268 Ga0495660_0067268_103_795 223
207 3300048917 Ga0496114_0362604 Ga0496114_0362604_139_846 224
208 3300005981 Ga0081538_10001931 Ga0081538_100019319 228
209 3300005981 Ga0081538_10096216 Ga0081538_100962161 228
210 3300031548 Ga0307408_100019928 Ga0307408_1000199285 228
211 3300031731 Ga0307405_10001045 Ga0307405_100010454 228
212 3300031824 Ga0307413_10003566 Ga0307413_100035665 228
213 3300031852 Ga0307410_10000766 Ga0307410_1000076614 228
214 3300031901 Ga0307406_10005025 Ga0307406_100050257 228
215 3300031995 Ga0307409_100000183 Ga0307409_10000018314 228
216 3300032002 Ga0307416_100000124 Ga0307416_10000012414 228
217 3300032004 Ga0307414_10006047 Ga0307414_100060479 228
218 3300032126 Ga0307415_100003201 Ga0307415_1000032016 228
219 3300003911 JGI25405J52794_10059252 JGI25405J52794_100592521 229
220 3300005937 Ga0081455_10022172 Ga0081455_100221722 229
221 3300005937 Ga0081455_10078107 Ga0081455_100781073 229
222 3300006058 Ga0075432_10000028 Ga0075432_1000002824 231
223 3300006844 Ga0075428_100254142 Ga0075428_1002541422 231
224 3300006852 Ga0075433_10002010 Ga0075433_1000201019 231
225 3300006871 Ga0075434_100003989 Ga0075434_10000398911 231
226 3300006914 Ga0075436_100003948 Ga0075436_1000039489 231
227 3300007076 Ga0075435_100002516 Ga0075435_10000251612 231
228 3300009094 Ga0111539_10001773 Ga0111539_1000177324 231
229 3300027907 Ga0207428_10000855 Ga0207428_1000085528 231
230 3300031852 Ga0307410_10413768 Ga0307410_104137681 231
231 3300042005 Ga0439448_0036168 Ga0439448_0036168_601_1326 231
232 3300050511 nmdc:mga08y16_6996_c1 nmdc:mga08y16_6996_c1_5840_6556 231
233 3300050512 nmdc:mga0n895_390_c1 nmdc:mga0n895_390_c1_9527_10243 231
234 3300050514 nmdc:mga08x19_9875_c1 nmdc:mga08x19_9875_c1_2410_3126 231
235 3300050515 nmdc:mga0a205_545_c1 nmdc:mga0a205_545_c1_9806_10522 231
236 3300005347 Ga0070668_100029453 Ga0070668_1000294532 232
237 3300005459 Ga0068867_100070226 Ga0068867_1000702262 232
238 3300005718 Ga0068866_10168015 Ga0068866_101680152 232
239 3300005843 Ga0068860_100300915 Ga0068860_1003009152 232
240 3300006881 Ga0068865_100008425 Ga0068865_1000084253 232
241 3300012515 Ga0157338_1001423 Ga0157338_10014232 232
242 3300025899 Ga0207642_10148060 Ga0207642_101480602 232
243 3300025901 Ga0207688_10003001 Ga0207688_100030014 232
244 3300025927 Ga0207687_10016636 Ga0207687_100166363 232
245 3300025934 Ga0207686_10506773 Ga0207686_105067731 232
246 3300025938 Ga0207704_10038926 Ga0207704_100389261 232
247 3300025961 Ga0207712_10122742 Ga0207712_101227422 232
248 3300025972 Ga0207668_10019373 Ga0207668_100193734 232
249 3300026089 Ga0207648_10022104 Ga0207648_100221046 232
250 3300026118 Ga0207675_100011648 Ga0207675_1000116488 232
251 3300028381 Ga0268264_10245115 Ga0268264_102451152 232
252 3300005366 Ga0070659_100146033 Ga0070659_1001460332 233
253 3300005843 Ga0068860_100331885 Ga0068860_1003318852 233
254 3300005844 Ga0068862_100130063 Ga0068862_1001300633 233
255 3300005937 Ga0081455_10005218 Ga0081455_100052188 233
256 3300005937 Ga0081455_10023863 Ga0081455_100238635 233
257 3300006058 Ga0075432_10010600 Ga0075432_100106004 233
258 3300006846 Ga0075430_100308357 Ga0075430_1003083572 233
259 3300006847 Ga0075431_100029697 Ga0075431_1000296977 233
260 3300006880 Ga0075429_100049929 Ga0075429_1000499294 233
261 3300006881 Ga0068865_100066065 Ga0068865_1000660653 233
262 3300007076 Ga0075435_100005184 Ga0075435_1000051843 233
263 3300009094 Ga0111539_10008586 Ga0111539_100085868 233
264 3300009147 Ga0114129_10012017 Ga0114129_100120177 233
265 3300009148 Ga0105243_10040347 Ga0105243_100403474 233
266 3300009176 Ga0105242_10190275 Ga0105242_101902753 233
267 3300009545 Ga0105237_10666509 Ga0105237_106665092 233
268 3300009553 Ga0105249_10018095 Ga0105249_100180954 233
269 3300009553 Ga0105249_10089900 Ga0105249_100899001 233
270 3300010375 Ga0105239_10067515 Ga0105239_100675153 233
271 3300013306 Ga0163162_10035189 Ga0163162_100351897 233
272 3300013307 Ga0157372_10778059 Ga0157372_107780591 233
273 3300017792 Ga0163161_10089374 Ga0163161_100893743 233
274 3300027907 Ga0207428_10008400 Ga0207428_100084002 233
275 3300031903 Ga0307407_10160029 Ga0307407_101600292 233
276 3300031911 Ga0307412_10408814 Ga0307412_104088142 233
277 3300031995 Ga0307409_100265429 Ga0307409_1002654292 233
278 3300031995 Ga0307409_100992143 Ga0307409_1009921432 233
279 3300032002 Ga0307416_100583454 Ga0307416_1005834542 233
280 3300032005 Ga0307411_10105752 Ga0307411_101057521 233
281 3300035121 Ga0373960_0073416 Ga0373960_0073416_289_1011 233
282 3300042008 Ga0439450_078360 Ga0439450_078360_62_784 233
283 3300042126 Ga0450888_006017 Ga0450888_006017_220_942 233
284 3300042437 Ga0439444_0001661 Ga0439444_0001661_1033_1755 233
285 3300042461 Ga0439460_0044108 Ga0439460_0044108_184_906 233
286 3300049523 Ga0501300_007512 Ga0501300_007512_562_1287 233
287 3300049675 Ga0501243_014997 Ga0501243_014997_14_739 233
288 3300049707 Ga0501234_023153 Ga0501234_023153_64_789 233
289 3300049851 Ga0501212_003342 Ga0501212_003342_1191_1916 233
290 3300050507 nmdc:mga05p37_9426_c1 nmdc:mga05p37_9426_c1_2463_3185 233
291 3300050508 nmdc:mga09592_76448_c1 nmdc:mga09592_76448_c1_1118_1840 233
292 3300050509 nmdc:mga0qj67_474454_c1 nmdc:mga0qj67_474454_c1_189_911 233
293 3300050510 nmdc:mga06r32_16954_c2 nmdc:mga06r32_16954_c2_196_918 233
294 3300050511 nmdc:mga08y16_12187_c1 nmdc:mga08y16_12187_c1_6074_6796 233
295 3300050512 nmdc:mga0n895_216120_c1 nmdc:mga0n895_216120_c1_437_1159 233
296 3300050513 nmdc:mga0rr50_16676_c1 nmdc:mga0rr50_16676_c1_1617_2339 233
297 3300050515 nmdc:mga0a205_11637_c1 nmdc:mga0a205_11637_c1_3515_4237 233
298 3300009148 Ga0105243_10696594 Ga0105243_106965942 234
299 3300025933 Ga0207706_10395308 Ga0207706_103953081 234
300 3300003911 JGI25405J52794_10014468 JGI25405J52794_100144682 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

56

215

0.92

Feature Viewer

pLDDT pTM Quality
54.66 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map