F395396

General Info

Members Datasets Scaffolds Average Seq Length
300 166 300 120

Family's Representative Sequence

Representative Sequence 3300025905|Ga0207685_10418241|Ga0207685_104182412
Length 135
Sequence MNVLVATVAGSFAVDLDTDEVGPWEAPVPAAATPPLNLPRVISSAVSGSTVVAVVDAKPPLLVSHDTGSTWRESGRGLPPGRAVAVAADDPDLLVYAARNRLYLSRNGGVFWSALADLTPGDCRNVTAIGRGPVA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
35 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
68 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
69 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
70 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10098008 3300005327 Bacteria 2421
2 Ga0070680_100513520 3300005336 Bacteria 1026
3 Ga0070680_101827201 3300005336 Bacteria 527
4 Ga0070682_100789856 3300005337 Unclassified 770
5 Ga0070660_100017027 3300005339 Bacteria 5291
6 Ga0070660_100916780 3300005339 Archaea 739
7 Ga0070691_10087521 3300005341 Bacteria 1532
8 Ga0070659_101327290 3300005366 Bacteria 638
9 Ga0070714_100383749 3300005435 Bacteria 1325
10 Ga0070713_100130555 3300005436 Bacteria 2215
11 Ga0070713_100376330 3300005436 Bacteria 1322
12 Ga0070710_10406361 3300005437 Bacteria 914
13 Ga0070711_100048113 3300005439 Unclassified 2914
14 Ga0070711_101174658 3300005439 Bacteria 663
15 Ga0070681_10581330 3300005458 Bacteria 1034
16 Ga0070706_101392572 3300005467 Bacteria 642
17 Ga0070706_101833445 3300005467 Unclassified 551
18 Ga0070699_100692463 3300005518 Bacteria 931
19 Ga0070684_100305551 3300005535 Bacteria 1460
20 Ga0070693_100623366 3300005547 Bacteria 781
21 Ga0068855_100103762 3300005563 Bacteria 3270
22 Ga0068855_100212761 3300005563 Bacteria 2171
23 Ga0068856_100112622 3300005614 Bacteria 2719
24 Ga0068856_100162360 3300005614 Bacteria 2245
25 Ga0081539_10000913 3300005985 Bacteria 55913
26 Ga0070717_10021490 3300006028 Bacteria 5086
27 Ga0070717_10111333 3300006028 Bacteria 2336
28 Ga0070716_100953890 3300006173 Bacteria 675
29 Ga0070712_100070957 3300006175 Unclassified 2491
30 Ga0075431_100452817 3300006847 Bacteria 1279
31 Ga0075433_10239160 3300006852 Bacteria 1612
32 Ga0075434_100236644 3300006871 Bacteria 1846
33 Ga0075434_100339847 3300006871 Bacteria 1522
34 Ga0075436_100607229 3300006914 Bacteria 806
35 Ga0075435_100021707 3300007076 Bacteria 4943
36 Ga0075435_100460323 3300007076 Bacteria 1097
37 Ga0105240_10393590 3300009093 Bacteria 1562
38 Ga0114129_10044970 3300009147 Bacteria 6209
39 Ga0157370_10086227 3300013104 Bacteria 2950
40 Ga0157369_11258414 3300013105 Bacteria 755
41 Ga0157378_10748439 3300013297 Unclassified 1000
42 Ga0182007_10029232 3300015262 Bacteria 1888
43 Ga0206353_10228123 3300020082 Bacteria 2996
44 Ga0206353_11417796 3300020082 Bacteria 2377
45 Ga0213874_10181724 3300021377 Bacteria 749
46 Ga0213871_10045020 3300021441 Bacteria 1194
47 Ga0207692_10056423 3300025898 Bacteria 2015
48 Ga0207685_10418241 3300025905 Bacteria 691
49 Ga0207699_10046430 3300025906 Bacteria 2540
50 Ga0207705_10086328 3300025909 Bacteria 2293
51 Ga0207684_10710765 3300025910 Bacteria 853
52 Ga0207693_10069757 3300025915 Bacteria 2750
53 Ga0207693_10209050 3300025915 Bacteria 1534
54 Ga0207663_10037040 3300025916 Unclassified 2938
55 Ga0207663_10179622 3300025916 Bacteria 1510
56 Ga0207660_10421464 3300025917 Bacteria 1077
57 Ga0207657_10059467 3300025919 Bacteria 3283
58 Ga0207652_11008757 3300025921 Archaea 731
59 Ga0207646_10786958 3300025922 Bacteria 848
60 Ga0207700_10337735 3300025928 Bacteria 1309
61 Ga0207700_10580911 3300025928 Bacteria 996
62 Ga0207700_10786752 3300025928 Unclassified 851
63 Ga0207644_10470024 3300025931 Bacteria 1035
64 Ga0207690_11345239 3300025932 Bacteria 597
65 Ga0207690_11616395 3300025932 Bacteria 542
66 Ga0207665_10514552 3300025939 Bacteria 926
67 Ga0207665_10703332 3300025939 Bacteria 795
68 Ga0207667_10116994 3300025949 Bacteria 2747
69 Ga0207702_10384894 3300026078 Bacteria 1350
70 Ga0207702_10760059 3300026078 Bacteria 957
71 Ga0265319_1041637 3300028563 Bacteria 1548
72 Ga0265318_10004174 3300028577 Bacteria 7061
73 Ga0265318_10039632 3300028577 Bacteria 1797
74 Ga0265318_10139576 3300028577 Bacteria 890
75 Ga0265336_10034893 3300028666 Bacteria 1553
76 Ga0265338_10013411 3300028800 Bacteria 9258
77 Ga0265338_10077509 3300028800 Bacteria 2809
78 Ga0265338_10390052 3300028800 Bacteria 994
79 Ga0265338_10587688 3300028800 Bacteria 776
80 Ga0265320_10007007 3300031240 Bacteria 7025
81 Ga0265320_10246093 3300031240 Bacteria 794
82 Ga0265325_10126622 3300031241 Bacteria 1227
83 Ga0265329_10029768 3300031242 Bacteria 1782
84 Ga0265339_10067784 3300031249 Bacteria 1908
85 Ga0265331_10102313 3300031250 Bacteria 1317
86 Ga0265327_10085693 3300031251 Bacteria 1546
87 Ga0265327_10192475 3300031251 Bacteria 928
88 Ga0265316_10104872 3300031344 Bacteria 2145
89 Ga0265313_10034753 3300031595 Bacteria 2545
90 Ga0265313_10197983 3300031595 Bacteria 837
91 Ga0265314_10010317 3300031711 Bacteria 7802
92 Ga0265342_10041592 3300031712 Bacteria 2782
93 Ga0373945_0409906 3300035116 Bacteria 595
94 Ga0373953_0049284 3300035117 Bacteria 1699
95 Ga0373956_0042028 3300035119 Unclassified 2031
96 Ga0373957_0215895 3300035120 Bacteria 802
97 Ga0373943_0023147 3300035170 Bacteria 2886
98 Ga0373955_0617466 3300035172 Bacteria 664
99 Ga0373924_0052577 3300035410 Bacteria 1691
100 Ga0373927_0854689 3300035695 Unclassified 601
101 Ga0373933_0219860 3300035724 Unclassified 1218
102 Ga0373947_0023812 3300035725 Bacteria 3564
103 Ga0373937_0939511 3300036401 Bacteria 813
104 Ga0373937_1209968 3300036401 Unclassified 704
105 Ga0395899_0009173 3300037312 Bacteria 7597
106 Ga0395900_0039568 3300037418 Bacteria 4858
107 Ga0395900_0234987 3300037418 Unclassified 1841
108 Ga0395898_0011197 3300037466 Bacteria 9336
109 Ga0395898_0071256 3300037466 Bacteria 3358
110 Ga0395898_1028882 3300037466 Bacteria 759
111 Ga0395898_1306220 3300037466 Bacteria 655
112 Ga0436364_0756136 3300037853 Bacteria 1590
113 Ga0395901_0011295 3300038443 Bacteria 9047
114 Ga0395901_0043210 3300038443 Bacteria 4675
115 Ga0395901_0646705 3300038443 Bacteria 1061
116 Ga0436365_0219629 3300039437 Bacteria 3328
117 Ga0436360_0542900 3300039438 Bacteria 3615
118 Ga0436362_0813424 3300039453 Bacteria 6613
119 Ga0439448_0070518 3300042005 Bacteria 1164
120 Ga0466963_0048280 3300044694 Bacteria 2812
121 Ga0466963_0051734 3300044694 Bacteria 2724
122 Ga0466963_0128189 3300044694 Unclassified 1751
123 Ga0466963_0788214 3300044694 Bacteria 670
124 Ga0466957_0448300 3300044842 Unclassified 889
125 Ga0466967_0019651 3300045976 Bacteria 5438
126 Ga0466967_0023679 3300045976 Bacteria 5036
127 Ga0466967_0050838 3300045976 Bacteria 3630
128 Ga0466967_0078516 3300045976 Bacteria 2974
129 Ga0466967_0097900 3300045976 Bacteria 2678
130 Ga0466967_1788356 3300045976 Bacteria 612
131 Ga0495592_0042603 3300046454 Bacteria 3399
132 Ga0495592_0091772 3300046454 Bacteria 2177
133 Ga0495592_0163019 3300046454 Unclassified 1532
134 Ga0495629_0099311 3300046459 Bacteria 2031
135 Ga0495641_0106897 3300046461 Bacteria 1248
136 Ga0495641_0223519 3300046461 Unclassified 845
137 Ga0495651_0003210 3300046462 Bacteria 12560
138 Ga0495651_0037950 3300046462 Bacteria 3751
139 Ga0495651_0210428 3300046462 Bacteria 1354
140 Ga0495653_0054222 3300046463 Bacteria 3064
141 Ga0495653_0084618 3300046463 Bacteria 2335
142 Ga0495653_0267097 3300046463 Bacteria 1128
143 Ga0495653_0868262 3300046463 Unclassified 539
144 Ga0495580_0667172 3300046472 Bacteria 683
145 Ga0495582_0353116 3300046473 Bacteria 847
146 Ga0495639_0051215 3300046475 Bacteria 1877
147 Ga0495639_0502466 3300046475 Bacteria 619
148 Ga0495664_0065766 3300046477 Bacteria 2162
149 Ga0495664_0098252 3300046477 Bacteria 1763
150 Ga0495664_0582182 3300046477 Bacteria 666
151 Ga0495608_0035421 3300046511 Bacteria 3366
152 Ga0495608_0051184 3300046511 Bacteria 2738
153 Ga0495608_0053821 3300046511 Bacteria 2661
154 Ga0495608_0272108 3300046511 Bacteria 1053
155 Ga0495608_0365257 3300046511 Unclassified 887
156 Ga0495618_0123287 3300046514 Bacteria 1659
157 Ga0495618_0141751 3300046514 Bacteria 1537
158 Ga0495628_0010049 3300046516 Bacteria 8054
159 Ga0495628_0118583 3300046516 Unclassified 2031
160 Ga0495628_0281014 3300046516 Unclassified 1236
161 Ga0495630_0009936 3300046517 Bacteria 6851
162 Ga0495630_0037419 3300046517 Bacteria 3628
163 Ga0495630_0234912 3300046517 Bacteria 1401
164 Ga0495630_0238284 3300046517 Bacteria 1390
165 Ga0495630_0550176 3300046517 Bacteria 885
166 Ga0495652_0031683 3300046529 Bacteria 4628
167 Ga0495652_0076512 3300046529 Bacteria 2776
168 Ga0495652_0169436 3300046529 Bacteria 1687
169 Ga0495652_0536880 3300046529 Unclassified 806
170 Ga0495665_0203540 3300046531 Bacteria 1026
171 Ga0495665_0324545 3300046531 Bacteria 786
172 Ga0495640_0059002 3300046533 Bacteria 2615
173 Ga0495640_0212170 3300046533 Bacteria 1223
174 Ga0495640_0326511 3300046533 Bacteria 950
175 Ga0495586_0131377 3300046535 Bacteria 1402
176 Ga0495587_0102427 3300046536 Unclassified 1648
177 Ga0495587_0122150 3300046536 Bacteria 1491
178 Ga0495587_0393767 3300046536 Unclassified 770
179 Ga0495587_0499368 3300046536 Bacteria 673
180 Ga0495645_0069852 3300046543 Bacteria 2535
181 Ga0495645_0117295 3300046543 Bacteria 1878
182 Ga0495645_0862334 3300046543 Unclassified 540
183 Ga0495667_0011363 3300046559 Bacteria 6027
184 Ga0495667_0031186 3300046559 Bacteria 3579
185 Ga0495667_0044468 3300046559 Bacteria 2942
186 Ga0495667_0082956 3300046559 Bacteria 2082
187 Ga0495667_0177738 3300046559 Bacteria 1367
188 Ga0495634_0025870 3300046642 Bacteria 4099
189 Ga0495634_0285123 3300046642 Bacteria 1002
190 Ga0495635_0023113 3300046663 Bacteria 4333
191 Ga0495635_0138794 3300046663 Bacteria 1656
192 Ga0495635_0496484 3300046663 Bacteria 804
193 Ga0495661_0066428 3300046665 Bacteria 2123
194 Ga0495657_0045353 3300046675 Bacteria 2983
195 Ga0495657_0088518 3300046675 Bacteria 1990
196 Ga0495657_0120973 3300046675 Bacteria 1649
197 Ga0495657_0200397 3300046675 Bacteria 1217
198 Ga0495599_0025522 3300046678 Bacteria 3700
199 Ga0495599_0067544 3300046678 Bacteria 2233
200 Ga0495599_0083982 3300046678 Bacteria 1989
201 Ga0495599_0093959 3300046678 Bacteria 1871
202 Ga0495623_0082434 3300046679 Bacteria 1987
203 Ga0495646_0018651 3300046680 Bacteria 4394
204 Ga0495646_0124943 3300046680 Bacteria 1453
205 Ga0495646_0522312 3300046680 Unclassified 608
206 Ga0495624_0903981 3300046690 Bacteria 520
207 Ga0495600_0005717 3300046809 Bacteria 7514
208 Ga0495600_0141645 3300046809 Bacteria 1560
209 Ga0495600_0146721 3300046809 Bacteria 1529
210 Ga0495581_0035720 3300047315 Bacteria 2875
211 Ga0495604_0158497 3300047317 Bacteria 1601
212 Ga0495604_0193680 3300047317 Unclassified 1415
213 Ga0495604_0226201 3300047317 Bacteria 1285
214 Ga0495604_0410298 3300047317 Unclassified 891
215 Ga0495674_0003880 3300047319 Bacteria 14521
216 Ga0495674_0037520 3300047319 Bacteria 4355
217 Ga0495674_0049411 3300047319 Bacteria 3717
218 Ga0495676_0078576 3300047321 Bacteria 2512
219 Ga0495680_0001771 3300047322 Bacteria 22882
220 Ga0495680_0020971 3300047322 Bacteria 5478
221 Ga0495680_0103281 3300047322 Bacteria 2122
222 Ga0495675_0027141 3300047444 Bacteria 3649
223 Ga0495675_0375328 3300047444 Bacteria 833
224 Ga0495684_0048325 3300047471 Bacteria 3254
225 Ga0495684_0142381 3300047471 Bacteria 1797
226 Ga0495684_0298215 3300047471 Unclassified 1158
227 Ga0495684_0786397 3300047471 Unclassified 623
228 Ga0495593_0582760 3300047673 Unclassified 561
229 Ga0495602_0082237 3300048088 Bacteria 2703
230 Ga0495602_0223286 3300048088 Unclassified 1420
231 Ga0495614_0076810 3300048089 Bacteria 1444
232 Ga0496100_0130208 3300048903 Bacteria 1771
233 Ga0496100_0236023 3300048903 Bacteria 1347
234 Ga0496101_0003466 3300048904 Bacteria 9844
235 Ga0496102_0178492 3300048905 Bacteria 2000
236 Ga0496102_0382997 3300048905 Bacteria 1323
237 Ga0496102_1383979 3300048905 Bacteria 623
238 Ga0496103_0202579 3300048906 Bacteria 1276
239 Ga0496104_0081212 3300048907 Unclassified 3091
240 Ga0496104_0800022 3300048907 Bacteria 849
241 Ga0496106_0120484 3300048909 Bacteria 2050
242 Ga0496107_0082941 3300048910 Bacteria 2337
243 Ga0496109_0431053 3300048912 Archaea 1245
244 Ga0496110_0038638 3300048913 Bacteria 4154
245 Ga0496111_0043204 3300048914 Bacteria 3239
246 Ga0496112_0265195 3300048915 Bacteria 1666
247 Ga0496112_0401452 3300048915 Bacteria 1310
248 Ga0496112_0541348 3300048915 Bacteria 1098
249 Ga0496112_0555373 3300048915 Archaea 1082
250 Ga0496113_0598157 3300048916 Bacteria 883
251 Ga0496113_0712913 3300048916 Archaea 800
252 Ga0496114_0118055 3300048917 Bacteria 2279
253 Ga0496115_0098785 3300048918 Bacteria 2391
254 Ga0496115_0190585 3300048918 Bacteria 1694
255 Ga0496115_0363729 3300048918 Bacteria 1178
256 Ga0501032_0382435 3300049569 Unclassified 905
257 Ga0501034_0083040 3300049571 Bacteria 3206
258 Ga0501036_1691697 3300049572 Bacteria 510
259 Ga0501043_0525280 3300049579 Unclassified 882
260 Ga0501047_0010692 3300049581 Bacteria 8672
261 Ga0501047_0061053 3300049581 Bacteria 3637
262 Ga0501047_0139407 3300049581 Bacteria 2304
263 Ga0501047_0654672 3300049581 Bacteria 870
264 Ga0501069_0070573 3300049585 Bacteria 1957
265 Ga0501070_0000104 3300049586 Bacteria 74572
266 Ga0501070_0035036 3300049586 Bacteria 4195
267 Ga0501070_0303302 3300049586 Bacteria 1301
268 Ga0501074_0024367 3300049590 Bacteria 4398
269 Ga0501074_0301911 3300049590 Bacteria 1137
270 Ga0501074_0471139 3300049590 Bacteria 890
271 Ga0501075_0156360 3300049591 Bacteria 1738
272 Ga0501079_1070814 3300049741 Bacteria 635
273 Ga0501080_0033135 3300049742 Bacteria 4822
274 Ga0501080_0427443 3300049742 Bacteria 1189
275 Ga0501080_0707941 3300049742 Bacteria 888
276 Ga0501035_0393455 3300049822 Bacteria 1154
277 Ga0501044_0555195 3300049823 Bacteria 1045
278 Ga0501044_1138689 3300049823 Bacteria 649
279 nmdc:mga05p37_27097_c1 3300050507 Bacteria 6975
280 nmdc:mga06r32_543991_c1 3300050510 Bacteria 1135
281 nmdc:mga0n895_236644_c1 3300050512 Bacteria 1853
282 nmdc:mga0rr50_1178511_c1 3300050513 Bacteria 651
283 nmdc:mga0rr50_60270_c1 3300050513 Bacteria 2854
284 nmdc:mga0a205_221028_c1 3300050515 Bacteria 1779
285 Ga0495601_0009396 3300053077 Bacteria 5784
286 Ga0495601_0330291 3300053077 Bacteria 992
287 Ga0495601_0408855 3300053077 Bacteria 879
288 Ga0495601_0637471 3300053077 Bacteria 682
289 Ga0495612_0064101 3300053078 Bacteria 1525
290 Ga0495612_0402822 3300053078 Bacteria 622
291 Ga0495612_0478437 3300053078 Bacteria 570
292 Ga0495595_0009652 3300053084 Bacteria 3996
293 Ga0495595_0022125 3300053084 Bacteria 2787
294 Ga0495595_0389789 3300053084 Unclassified 705
295 Ga0495619_0040623 3300053085 Bacteria 3040
296 Ga0495619_0047881 3300053085 Bacteria 2816
297 Ga0495619_0075373 3300053085 Bacteria 2264
298 Ga0495619_0643750 3300053085 Bacteria 723
299 Ga0501084_0279285 3300054114 Bacteria 1410
300 Ga0501082_1481662 3300060353 Bacteria 593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046533 Ga0495640_0326511 Ga0495640_0326511_213_617 101
2 3300053078 Ga0495612_0478437 Ga0495612_0478437_23_427 101
3 3300046536 Ga0495587_0393767 Ga0495587_0393767_321_725 102
4 3300046559 Ga0495667_0177738 Ga0495667_0177738_321_725 102
5 3300053085 Ga0495619_0047881 Ga0495619_0047881_2381_2785 102
6 3300046463 Ga0495653_0267097 Ga0495653_0267097_159_563 103
7 3300046477 Ga0495664_0582182 Ga0495664_0582182_139_543 103
8 3300046511 Ga0495608_0051184 Ga0495608_0051184_2126_2530 103
9 3300046514 Ga0495618_0123287 Ga0495618_0123287_882_1286 103
10 3300046517 Ga0495630_0238284 Ga0495630_0238284_95_499 103
11 3300046529 Ga0495652_0536880 Ga0495652_0536880_65_469 103
12 3300046536 Ga0495587_0499368 Ga0495587_0499368_215_619 103
13 3300046543 Ga0495645_0862334 Ga0495645_0862334_106_510 103
14 3300046642 Ga0495634_0285123 Ga0495634_0285123_120_524 103
15 3300046663 Ga0495635_0138794 Ga0495635_0138794_491_895 103
16 3300046675 Ga0495657_0200397 Ga0495657_0200397_39_443 103
17 3300046680 Ga0495646_0522312 Ga0495646_0522312_75_479 103
18 3300046809 Ga0495600_0146721 Ga0495600_0146721_873_1277 103
19 3300047317 Ga0495604_0410298 Ga0495604_0410298_281_685 103
20 3300047319 Ga0495674_0037520 Ga0495674_0037520_184_588 103
21 3300047444 Ga0495675_0375328 Ga0495675_0375328_240_644 103
22 3300047471 Ga0495684_0298215 Ga0495684_0298215_20_424 103
23 3300053077 Ga0495601_0009396 Ga0495601_0009396_2203_2607 103
24 3300053078 Ga0495612_0064101 Ga0495612_0064101_562_966 103
25 3300053085 Ga0495619_0643750 Ga0495619_0643750_124_528 103
26 3300046473 Ga0495582_0353116 Ga0495582_0353116_303_707 104
27 3300046511 Ga0495608_0272108 Ga0495608_0272108_146_550 104
28 3300046675 Ga0495657_0120973 Ga0495657_0120973_622_1026 104
29 3300047322 Ga0495680_0103281 Ga0495680_0103281_1404_1808 104
30 3300005337 Ga0070682_100789856 Ga0070682_1007898562 105
31 3300005467 Ga0070706_101392572 Ga0070706_1013925722 105
32 3300013297 Ga0157378_10748439 Ga0157378_107484392 105
33 3300035172 Ga0373955_0617466 Ga0373955_0617466_189_590 105
34 3300046454 Ga0495592_0091772 Ga0495592_0091772_862_1263 105
35 3300046459 Ga0495629_0099311 Ga0495629_0099311_633_1034 105
36 3300046461 Ga0495641_0106897 Ga0495641_0106897_602_1003 105
37 3300046462 Ga0495651_0003210 Ga0495651_0003210_11231_11632 105
38 3300046472 Ga0495580_0667172 Ga0495580_0667172_216_617 105
39 3300046475 Ga0495639_0051215 Ga0495639_0051215_731_1132 105
40 3300046477 Ga0495664_0098252 Ga0495664_0098252_749_1150 105
41 3300046511 Ga0495608_0053821 Ga0495608_0053821_1294_1695 105
42 3300046516 Ga0495628_0010049 Ga0495628_0010049_950_1351 105
43 3300046517 Ga0495630_0037419 Ga0495630_0037419_1009_1410 105
44 3300046529 Ga0495652_0169436 Ga0495652_0169436_34_435 105
45 3300046531 Ga0495665_0324545 Ga0495665_0324545_141_542 105
46 3300046533 Ga0495640_0059002 Ga0495640_0059002_985_1386 105
47 3300046535 Ga0495586_0131377 Ga0495586_0131377_85_486 105
48 3300046543 Ga0495645_0117295 Ga0495645_0117295_939_1340 105
49 3300046559 Ga0495667_0044468 Ga0495667_0044468_1583_1984 105
50 3300046642 Ga0495634_0025870 Ga0495634_0025870_2714_3115 105
51 3300046675 Ga0495657_0088518 Ga0495657_0088518_981_1382 105
52 3300046678 Ga0495599_0067544 Ga0495599_0067544_857_1258 105
53 3300046809 Ga0495600_0141645 Ga0495600_0141645_273_674 105
54 3300047315 Ga0495581_0035720 Ga0495581_0035720_2173_2574 105
55 3300047317 Ga0495604_0158497 Ga0495604_0158497_247_648 105
56 3300047319 Ga0495674_0003880 Ga0495674_0003880_13112_13513 105
57 3300047322 Ga0495680_0001771 Ga0495680_0001771_21058_21459 105
58 3300047471 Ga0495684_0048325 Ga0495684_0048325_1679_2080 105
59 3300048088 Ga0495602_0223286 Ga0495602_0223286_533_934 105
60 3300048089 Ga0495614_0076810 Ga0495614_0076810_876_1277 105
61 3300053078 Ga0495612_0402822 Ga0495612_0402822_158_559 105
62 3300053084 Ga0495595_0022125 Ga0495595_0022125_2222_2623 105
63 3300053085 Ga0495619_0075373 Ga0495619_0075373_460_861 105
64 3300006173 Ga0070716_100953890 Ga0070716_1009538902 106
65 3300013105 Ga0157369_11258414 Ga0157369_112584142 106
66 3300025910 Ga0207684_10710765 Ga0207684_107107651 106
67 3300005336 Ga0070680_100513520 Ga0070680_1005135202 108
68 3300005467 Ga0070706_101833445 Ga0070706_1018334452 108
69 3300020082 Ga0206353_10228123 Ga0206353_102281234 108
70 3300025917 Ga0207660_10421464 Ga0207660_104214643 108
71 3300025939 Ga0207665_10703332 Ga0207665_107033321 108
72 3300037418 Ga0395900_0234987 Ga0395900_0234987_487_870 108
73 3300037466 Ga0395898_0071256 Ga0395898_0071256_70_453 108
74 3300038443 Ga0395901_0011295 Ga0395901_0011295_245_628 108
75 3300042005 Ga0439448_0070518 Ga0439448_0070518_199_588 108
76 3300046517 Ga0495630_0234912 Ga0495630_0234912_321_725 108
77 3300049569 Ga0501032_0382435 Ga0501032_0382435_303_701 108
78 3300049571 Ga0501034_0083040 Ga0501034_0083040_508_906 108
79 3300049572 Ga0501036_1691697 Ga0501036_1691697_25_423 108
80 3300049581 Ga0501047_0061053 Ga0501047_0061053_1179_1577 108
81 3300049590 Ga0501074_0471139 Ga0501074_0471139_102_497 108
82 3300049591 Ga0501075_0156360 Ga0501075_0156360_381_776 108
83 3300049741 Ga0501079_1070814 Ga0501079_1070814_47_442 108
84 3300049742 Ga0501080_0707941 Ga0501080_0707941_272_670 108
85 3300049822 Ga0501035_0393455 Ga0501035_0393455_627_1025 108
86 3300054114 Ga0501084_0279285 Ga0501084_0279285_198_593 108
87 3300045976 Ga0466967_0050838 Ga0466967_0050838_2419_2796 110
88 3300005336 Ga0070680_101827201 Ga0070680_1018272011 113
89 3300005458 Ga0070681_10581330 Ga0070681_105813302 113
90 3300021377 Ga0213874_10181724 Ga0213874_101817241 113
91 3300037312 Ga0395899_0009173 Ga0395899_0009173_5115_5492 113
92 3300037418 Ga0395900_0039568 Ga0395900_0039568_2175_2552 113
93 3300037466 Ga0395898_0011197 Ga0395898_0011197_5521_5898 113
94 3300037853 Ga0436364_0756136 Ga0436364_0756136_696_1076 113
95 3300038443 Ga0395901_0043210 Ga0395901_0043210_227_604 113
96 3300039437 Ga0436365_0219629 Ga0436365_0219629_2216_2596 113
97 3300049586 Ga0501070_0303302 Ga0501070_0303302_236_631 113
98 3300006871 Ga0075434_100339847 Ga0075434_1003398472 114
99 3300007076 Ga0075435_100021707 Ga0075435_1000217074 114
100 3300028563 Ga0265319_1041637 Ga0265319_10416372 114
101 3300028577 Ga0265318_10004174 Ga0265318_100041743 114
102 3300028577 Ga0265318_10139576 Ga0265318_101395762 114
103 3300028800 Ga0265338_10013411 Ga0265338_1001341110 114
104 3300031240 Ga0265320_10007007 Ga0265320_100070072 114
105 3300031240 Ga0265320_10246093 Ga0265320_102460932 114
106 3300031242 Ga0265329_10029768 Ga0265329_100297682 114
107 3300031249 Ga0265339_10067784 Ga0265339_100677842 114
108 3300031250 Ga0265331_10102313 Ga0265331_101023132 114
109 3300031251 Ga0265327_10085693 Ga0265327_100856932 114
110 3300031344 Ga0265316_10104872 Ga0265316_101048722 114
111 3300031595 Ga0265313_10034753 Ga0265313_100347532 114
112 3300031711 Ga0265314_10010317 Ga0265314_100103176 114
113 3300031712 Ga0265342_10041592 Ga0265342_100415922 114
114 3300044842 Ga0466957_0448300 Ga0466957_0448300_71_460 114
115 3300046461 Ga0495641_0223519 Ga0495641_0223519_112_504 114
116 3300050513 nmdc:mga0rr50_60270_c1 nmdc:mga0rr50_60270_c1_1795_2190 114
117 3300053084 Ga0495595_0389789 Ga0495595_0389789_122_514 114
118 3300005436 Ga0070713_100376330 Ga0070713_1003763302 115
119 3300006847 Ga0075431_100452817 Ga0075431_1004528171 115
120 3300006852 Ga0075433_10239160 Ga0075433_102391602 115
121 3300006914 Ga0075436_100607229 Ga0075436_1006072292 115
122 3300007076 Ga0075435_100460323 Ga0075435_1004603232 115
123 3300009147 Ga0114129_10044970 Ga0114129_100449703 115
124 3300036401 Ga0373937_1209968 Ga0373937_1209968_265_654 115
125 3300046454 Ga0495592_0163019 Ga0495592_0163019_237_641 115
126 3300046463 Ga0495653_0084618 Ga0495653_0084618_963_1352 115
127 3300046477 Ga0495664_0065766 Ga0495664_0065766_1674_2078 115
128 3300046514 Ga0495618_0141751 Ga0495618_0141751_306_710 115
129 3300046559 Ga0495667_0031186 Ga0495667_0031186_587_976 115
130 3300047319 Ga0495674_0049411 Ga0495674_0049411_2701_3090 115
131 3300050507 nmdc:mga05p37_27097_c1 nmdc:mga05p37_27097_c1_2412_2789 115
132 3300050510 nmdc:mga06r32_543991_c1 nmdc:mga06r32_543991_c1_646_1023 115
133 3300050513 nmdc:mga0rr50_1178511_c1 nmdc:mga0rr50_1178511_c1_127_504 115
134 3300053077 Ga0495601_0330291 Ga0495601_0330291_381_785 115
135 3300028577 Ga0265318_10039632 Ga0265318_100396322 116
136 3300028666 Ga0265336_10034893 Ga0265336_100348932 116
137 3300028800 Ga0265338_10077509 Ga0265338_100775093 116
138 3300031241 Ga0265325_10126622 Ga0265325_101266222 116
139 3300045976 Ga0466967_0023679 Ga0466967_0023679_1142_1525 116
140 3300044694 Ga0466963_0048280 Ga0466963_0048280_1833_2213 117
141 3300045976 Ga0466967_1788356 Ga0466967_1788356_66_446 117
142 3300005437 Ga0070710_10406361 Ga0070710_104063611 118
143 3300006175 Ga0070712_100070957 Ga0070712_1000709571 118
144 3300015262 Ga0182007_10029232 Ga0182007_100292323 118
145 3300025898 Ga0207692_10056423 Ga0207692_100564233 118
146 3300025915 Ga0207693_10209050 Ga0207693_102090501 118
147 3300025916 Ga0207663_10179622 Ga0207663_101796223 118
148 3300035119 Ga0373956_0042028 Ga0373956_0042028_64_456 118
149 3300035120 Ga0373957_0215895 Ga0373957_0215895_335_727 118
150 3300035170 Ga0373943_0023147 Ga0373943_0023147_2299_2688 118
151 3300035410 Ga0373924_0052577 Ga0373924_0052577_530_922 118
152 3300035695 Ga0373927_0854689 Ga0373927_0854689_119_508 118
153 3300035724 Ga0373933_0219860 Ga0373933_0219860_796_1188 118
154 3300036401 Ga0373937_0939511 Ga0373937_0939511_389_781 118
155 3300046454 Ga0495592_0042603 Ga0495592_0042603_1689_2081 118
156 3300046462 Ga0495651_0037950 Ga0495651_0037950_2452_2844 118
157 3300046463 Ga0495653_0054222 Ga0495653_0054222_873_1265 118
158 3300046511 Ga0495608_0035421 Ga0495608_0035421_1251_1643 118
159 3300046516 Ga0495628_0118583 Ga0495628_0118583_62_454 118
160 3300046517 Ga0495630_0009936 Ga0495630_0009936_6236_6628 118
161 3300046529 Ga0495652_0031683 Ga0495652_0031683_3158_3550 118
162 3300046531 Ga0495665_0203540 Ga0495665_0203540_258_650 118
163 3300046533 Ga0495640_0212170 Ga0495640_0212170_650_1042 118
164 3300046536 Ga0495587_0122150 Ga0495587_0122150_492_884 118
165 3300046543 Ga0495645_0069852 Ga0495645_0069852_1312_1704 118
166 3300046559 Ga0495667_0011363 Ga0495667_0011363_3740_4132 118
167 3300046663 Ga0495635_0023113 Ga0495635_0023113_2136_2528 118
168 3300046675 Ga0495657_0045353 Ga0495657_0045353_990_1382 118
169 3300046678 Ga0495599_0025522 Ga0495599_0025522_1850_2242 118
170 3300046679 Ga0495623_0082434 Ga0495623_0082434_537_929 118
171 3300046680 Ga0495646_0018651 Ga0495646_0018651_1219_1611 118
172 3300046809 Ga0495600_0005717 Ga0495600_0005717_5365_5757 118
173 3300047322 Ga0495680_0020971 Ga0495680_0020971_1492_1884 118
174 3300047444 Ga0495675_0027141 Ga0495675_0027141_2086_2478 118
175 3300047471 Ga0495684_0142381 Ga0495684_0142381_916_1308 118
176 3300047673 Ga0495593_0582760 Ga0495593_0582760_92_484 118
177 3300048907 Ga0496104_0800022 Ga0496104_0800022_85_477 118
178 3300053077 Ga0495601_0637471 Ga0495601_0637471_189_581 118
179 3300053084 Ga0495595_0009652 Ga0495595_0009652_2615_3007 118
180 3300053085 Ga0495619_0040623 Ga0495619_0040623_752_1144 118
181 3300005563 Ga0068855_100212761 Ga0068855_1002127612 119
182 3300005436 Ga0070713_100130555 Ga0070713_1001305551 120
183 3300006028 Ga0070717_10111333 Ga0070717_101113333 120
184 3300025928 Ga0207700_10337735 Ga0207700_103377352 120
185 3300028800 Ga0265338_10390052 Ga0265338_103900522 120
186 3300005985 Ga0081539_10000913 Ga0081539_1000091313 125
187 3300049581 Ga0501047_0010692 Ga0501047_0010692_3536_3913 125
188 3300049585 Ga0501069_0070573 Ga0501069_0070573_712_1089 125
189 3300049586 Ga0501070_0035036 Ga0501070_0035036_3786_4163 125
190 3300049590 Ga0501074_0024367 Ga0501074_0024367_1954_2331 125
191 3300049823 Ga0501044_0555195 Ga0501044_0555195_197_574 125
192 3300060353 Ga0501082_1481662 Ga0501082_1481662_135_512 125
193 3300005439 Ga0070711_101174658 Ga0070711_1011746581 126
194 3300005518 Ga0070699_100692463 Ga0070699_1006924632 126
195 3300006871 Ga0075434_100236644 Ga0075434_1002366442 126
196 3300021441 Ga0213871_10045020 Ga0213871_100450202 126
197 3300028800 Ga0265338_10587688 Ga0265338_105876882 126
198 3300031251 Ga0265327_10192475 Ga0265327_101924752 126
199 3300031595 Ga0265313_10197983 Ga0265313_101979832 126
200 3300035116 Ga0373945_0409906 Ga0373945_0409906_21_410 126
201 3300035725 Ga0373947_0023812 Ga0373947_0023812_473_862 126
202 3300039438 Ga0436360_0542900 Ga0436360_0542900_989_1378 126
203 3300039453 Ga0436362_0813424 Ga0436362_0813424_4520_4909 126
204 3300044694 Ga0466963_0051734 Ga0466963_0051734_2079_2459 126
205 3300044694 Ga0466963_0788214 Ga0466963_0788214_99_485 126
206 3300045976 Ga0466967_0019651 Ga0466967_0019651_595_975 126
207 3300045976 Ga0466967_0078516 Ga0466967_0078516_2056_2436 126
208 3300046475 Ga0495639_0502466 Ga0495639_0502466_187_576 126
209 3300046517 Ga0495630_0550176 Ga0495630_0550176_290_679 126
210 3300046690 Ga0495624_0903981 Ga0495624_0903981_80_469 126
211 3300047321 Ga0495676_0078576 Ga0495676_0078576_867_1256 126
212 3300049579 Ga0501043_0525280 Ga0501043_0525280_475_864 126
213 3300049581 Ga0501047_0139407 Ga0501047_0139407_1483_1878 126
214 3300049586 Ga0501070_0000104 Ga0501070_0000104_14204_14587 126
215 3300049742 Ga0501080_0033135 Ga0501080_0033135_2537_2932 126
216 3300049742 Ga0501080_0427443 Ga0501080_0427443_26_409 126
217 3300050512 nmdc:mga0n895_236644_c1 nmdc:mga0n895_236644_c1_269_658 126
218 3300050515 nmdc:mga0a205_221028_c1 nmdc:mga0a205_221028_c1_1022_1411 126
219 3300005327 Ga0070658_10098008 Ga0070658_100980085 127
220 3300005339 Ga0070660_100017027 Ga0070660_1000170273 127
221 3300005339 Ga0070660_100916780 Ga0070660_1009167802 127
222 3300005341 Ga0070691_10087521 Ga0070691_100875212 127
223 3300005366 Ga0070659_101327290 Ga0070659_1013272901 127
224 3300005435 Ga0070714_100383749 Ga0070714_1003837492 127
225 3300005439 Ga0070711_100048113 Ga0070711_1000481132 127
226 3300005535 Ga0070684_100305551 Ga0070684_1003055512 127
227 3300005547 Ga0070693_100623366 Ga0070693_1006233662 127
228 3300005563 Ga0068855_100103762 Ga0068855_1001037623 127
229 3300005614 Ga0068856_100112622 Ga0068856_1001126223 127
230 3300005614 Ga0068856_100162360 Ga0068856_1001623602 127
231 3300006028 Ga0070717_10021490 Ga0070717_100214905 127
232 3300009093 Ga0105240_10393590 Ga0105240_103935902 127
233 3300013104 Ga0157370_10086227 Ga0157370_100862273 127
234 3300020082 Ga0206353_11417796 Ga0206353_114177963 127
235 3300025905 Ga0207685_10418241 Ga0207685_104182412 127
236 3300025906 Ga0207699_10046430 Ga0207699_100464302 127
237 3300025909 Ga0207705_10086328 Ga0207705_100863282 127
238 3300025915 Ga0207693_10069757 Ga0207693_100697573 127
239 3300025916 Ga0207663_10037040 Ga0207663_100370402 127
240 3300025919 Ga0207657_10059467 Ga0207657_100594674 127
241 3300025921 Ga0207652_11008757 Ga0207652_110087572 127
242 3300025922 Ga0207646_10786958 Ga0207646_107869582 127
243 3300025928 Ga0207700_10580911 Ga0207700_105809112 127
244 3300025928 Ga0207700_10786752 Ga0207700_107867521 127
245 3300025931 Ga0207644_10470024 Ga0207644_104700242 127
246 3300025932 Ga0207690_11345239 Ga0207690_113452391 127
247 3300025932 Ga0207690_11616395 Ga0207690_116163951 127
248 3300025939 Ga0207665_10514552 Ga0207665_105145522 127
249 3300025949 Ga0207667_10116994 Ga0207667_101169942 127
250 3300026078 Ga0207702_10384894 Ga0207702_103848942 127
251 3300026078 Ga0207702_10760059 Ga0207702_107600592 127
252 3300035117 Ga0373953_0049284 Ga0373953_0049284_875_1267 127
253 3300037466 Ga0395898_1028882 Ga0395898_1028882_237_626 127
254 3300037466 Ga0395898_1306220 Ga0395898_1306220_147_539 127
255 3300038443 Ga0395901_0646705 Ga0395901_0646705_522_920 127
256 3300044694 Ga0466963_0128189 Ga0466963_0128189_17_403 127
257 3300045976 Ga0466967_0097900 Ga0466967_0097900_206_595 127
258 3300046462 Ga0495651_0210428 Ga0495651_0210428_363_755 127
259 3300046463 Ga0495653_0868262 Ga0495653_0868262_51_443 127
260 3300046511 Ga0495608_0365257 Ga0495608_0365257_367_759 127
261 3300046516 Ga0495628_0281014 Ga0495628_0281014_196_588 127
262 3300046529 Ga0495652_0076512 Ga0495652_0076512_334_726 127
263 3300046536 Ga0495587_0102427 Ga0495587_0102427_935_1327 127
264 3300046559 Ga0495667_0082956 Ga0495667_0082956_122_514 127
265 3300046663 Ga0495635_0496484 Ga0495635_0496484_24_416 127
266 3300046665 Ga0495661_0066428 Ga0495661_0066428_664_1056 127
267 3300046678 Ga0495599_0083982 Ga0495599_0083982_484_888 127
268 3300046678 Ga0495599_0093959 Ga0495599_0093959_1013_1405 127
269 3300046680 Ga0495646_0124943 Ga0495646_0124943_481_873 127
270 3300047317 Ga0495604_0193680 Ga0495604_0193680_892_1284 127
271 3300047317 Ga0495604_0226201 Ga0495604_0226201_720_1112 127
272 3300047471 Ga0495684_0786397 Ga0495684_0786397_11_403 127
273 3300048088 Ga0495602_0082237 Ga0495602_0082237_1075_1467 127
274 3300048903 Ga0496100_0130208 Ga0496100_0130208_1278_1682 127
275 3300048903 Ga0496100_0236023 Ga0496100_0236023_82_465 127
276 3300048904 Ga0496101_0003466 Ga0496101_0003466_6687_7091 127
277 3300048905 Ga0496102_0178492 Ga0496102_0178492_1136_1519 127
278 3300048905 Ga0496102_0382997 Ga0496102_0382997_436_819 127
279 3300048905 Ga0496102_1383979 Ga0496102_1383979_178_582 127
280 3300048906 Ga0496103_0202579 Ga0496103_0202579_211_594 127
281 3300048907 Ga0496104_0081212 Ga0496104_0081212_143_526 127
282 3300048909 Ga0496106_0120484 Ga0496106_0120484_895_1299 127
283 3300048910 Ga0496107_0082941 Ga0496107_0082941_1818_2222 127
284 3300048912 Ga0496109_0431053 Ga0496109_0431053_817_1200 127
285 3300048913 Ga0496110_0038638 Ga0496110_0038638_40_423 127
286 3300048914 Ga0496111_0043204 Ga0496111_0043204_1650_2033 127
287 3300048915 Ga0496112_0265195 Ga0496112_0265195_452_835 127
288 3300048915 Ga0496112_0401452 Ga0496112_0401452_409_792 127
289 3300048915 Ga0496112_0541348 Ga0496112_0541348_535_936 127
290 3300048915 Ga0496112_0555373 Ga0496112_0555373_509_892 127
291 3300048916 Ga0496113_0598157 Ga0496113_0598157_143_526 127
292 3300048916 Ga0496113_0712913 Ga0496113_0712913_326_709 127
293 3300048917 Ga0496114_0118055 Ga0496114_0118055_713_1105 127
294 3300048918 Ga0496115_0098785 Ga0496115_0098785_1278_1670 127
295 3300048918 Ga0496115_0190585 Ga0496115_0190585_934_1338 127
296 3300048918 Ga0496115_0363729 Ga0496115_0363729_318_701 127
297 3300049581 Ga0501047_0654672 Ga0501047_0654672_299_682 127
298 3300049590 Ga0501074_0301911 Ga0501074_0301911_77_463 127
299 3300049823 Ga0501044_1138689 Ga0501044_1138689_77_463 127
300 3300053077 Ga0495601_0408855 Ga0495601_0408855_424_816 127

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ucj-assembly2.cif.gz_B mutants of rnase sa 0.8079 48 71
1ucl-assembly2.cif.gz_B mutants of rnase sa 0.8066 48 71
1uci-assembly2.cif.gz_B mutants of rnase sa 0.806 48 71
1t2i-assembly1.cif.gz_A t76w mutant of rnase sa from streptomyces aureofaciens 0.8055 48 71
1uck-assembly2.cif.gz_B mutants of rnase sa 0.8054 48 71
ID Description Score Start End Superfamily
af_Q9U0J4_195_468_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8009 49 104 2.130.10.10
af_Q8VI51_220_379_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7872 49 114 2.130.10.10
af_Q8GWR1_209_435_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7651 37 117 2.130.10.10
af_A0A0P0V8T8_135_297_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7527 41 117 2.40.128.630
af_A0A0G2L9M4_27_162_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7474 41 113 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7W1Q8N4-F1-model_v4 Exo-alpha-sialidase 0.9793 1 127
AF-A0A2N1R692-F1-model_v4 DUF4015 domain-containing protein 0.9629 83 114
AF-X1MXQ1-F1-model_v4 Sortilin N-terminal domain-containing protein 0.916 62 118
AF-A0A661B5Y5-F1-model_v4 Secretion system C-terminal sorting domain-containing protein 0.9059 49 113
AF-A0A7V9RAN8-F1-model_v4 Exo-alpha-sialidase 0.8995 1 126

Feature Viewer

pLDDT pTM Quality
95.86 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map