F396004
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 183 | 301 | 357 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_10026789|Ga0307405_100267894 |
| Length | 343 |
| Sequence | MSLDFSRIQELLGDDAESLLGHVSKTISKEDLHLPGGDFVDRVWMSSDRTPAVLRSLQTLYGGGRLSGTGYLSILPVDQGIEHSAGASFAPNPQYFDPENIVKLAIEGGCNAVASTYGVLGAVARKYAHKIPFIVKINHNELLTYPNRFDQVMFGNIEECRNMGAVAVGATIEAFAYAHELGMATILWCYLRNNKFKTKEGDMHTAADLTGQANHLGVTIQADIIKQKLPERNGGYNVLGLESAYGKTNPKIYTDLSTDHPIDLVRYQVANCYMGRCGLINSGGESKGTGDMADAVRTAVINKRGGGSGLISGRKAFQRPMAEGVELLNAIQDVYLSGDVTVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 76 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 113 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 118 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 120 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 123 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 134 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 138 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 139 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 140 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 153 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 179 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 180 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 182 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 2.33 |
| Rhizosphere | 94.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000187 | 3300000549 | Bacteria | 11176 |
| 2 | Ga0065704_10099405 | 3300005289 | Bacteria | 2313 |
| 3 | Ga0065704_10180138 | 3300005289 | Bacteria | 1241 |
| 4 | Ga0065712_10185473 | 3300005290 | Bacteria | 1172 |
| 5 | Ga0065715_10103257 | 3300005293 | Unclassified | 3047 |
| 6 | Ga0070658_10001907 | 3300005327 | Bacteria | 17611 |
| 7 | Ga0070676_10242299 | 3300005328 | Bacteria | 1200 |
| 8 | Ga0070690_100003749 | 3300005330 | Bacteria | 8373 |
| 9 | Ga0070670_100007430 | 3300005331 | Bacteria | 9307 |
| 10 | Ga0070670_100033249 | 3300005331 | Bacteria | 4442 |
| 11 | Ga0070670_100154103 | 3300005331 | Bacteria | 1989 |
| 12 | Ga0070670_100173502 | 3300005331 | Bacteria | 1871 |
| 13 | Ga0068869_100034323 | 3300005334 | Bacteria | 3588 |
| 14 | Ga0068868_100196358 | 3300005338 | Bacteria | 1680 |
| 15 | Ga0070689_100038068 | 3300005340 | Bacteria | 3678 |
| 16 | Ga0070669_100001115 | 3300005353 | Bacteria | 19624 |
| 17 | Ga0070675_100059005 | 3300005354 | Bacteria | 3165 |
| 18 | Ga0070675_100100149 | 3300005354 | Bacteria | 2440 |
| 19 | Ga0070675_100155567 | 3300005354 | Bacteria | 1963 |
| 20 | Ga0070671_100009699 | 3300005355 | Bacteria | 7735 |
| 21 | Ga0070674_100055214 | 3300005356 | Bacteria | 2750 |
| 22 | Ga0070688_100001873 | 3300005365 | Bacteria | 10537 |
| 23 | Ga0070688_100069759 | 3300005365 | Bacteria | 2245 |
| 24 | Ga0070667_100032859 | 3300005367 | Bacteria | 4330 |
| 25 | Ga0070667_100185879 | 3300005367 | Bacteria | 1839 |
| 26 | Ga0070709_10000676 | 3300005434 | Bacteria | 19448 |
| 27 | Ga0070713_100001620 | 3300005436 | Bacteria | 14428 |
| 28 | Ga0070701_10018101 | 3300005438 | Bacteria | 3307 |
| 29 | Ga0070705_100003270 | 3300005440 | Bacteria | 7973 |
| 30 | Ga0070705_100035526 | 3300005440 | Bacteria | 2795 |
| 31 | Ga0070694_100064303 | 3300005444 | Bacteria | 2511 |
| 32 | Ga0070708_100007370 | 3300005445 | Bacteria | 8802 |
| 33 | Ga0068867_100001573 | 3300005459 | Bacteria | 15866 |
| 34 | Ga0068867_100268776 | 3300005459 | Bacteria | 1393 |
| 35 | Ga0070706_100012603 | 3300005467 | Bacteria | 7828 |
| 36 | Ga0070706_100241847 | 3300005467 | Bacteria | 1685 |
| 37 | Ga0070698_100026832 | 3300005471 | Bacteria | 5991 |
| 38 | Ga0070698_100050627 | 3300005471 | Bacteria | 4233 |
| 39 | Ga0070699_100092148 | 3300005518 | Bacteria | 2650 |
| 40 | Ga0070697_100096034 | 3300005536 | Bacteria | 2459 |
| 41 | Ga0068853_100141463 | 3300005539 | Bacteria | 2160 |
| 42 | Ga0070695_100037257 | 3300005545 | Bacteria | 3064 |
| 43 | Ga0070693_100002427 | 3300005547 | Bacteria | 8577 |
| 44 | Ga0070704_100001151 | 3300005549 | Bacteria | 13820 |
| 45 | Ga0070704_100004180 | 3300005549 | Bacteria | 8334 |
| 46 | Ga0070704_100006295 | 3300005549 | Bacteria | 6992 |
| 47 | Ga0070704_100137032 | 3300005549 | Bacteria | 1905 |
| 48 | Ga0068855_100077388 | 3300005563 | Bacteria | 3860 |
| 49 | Ga0070664_100106732 | 3300005564 | Bacteria | 2440 |
| 50 | Ga0068852_100129075 | 3300005616 | Bacteria | 2326 |
| 51 | Ga0068852_100202376 | 3300005616 | Bacteria | 1879 |
| 52 | Ga0068859_100016204 | 3300005617 | Bacteria | 7487 |
| 53 | Ga0068859_100039200 | 3300005617 | Bacteria | 4752 |
| 54 | Ga0068859_100174815 | 3300005617 | Unclassified | 2229 |
| 55 | Ga0068864_100007581 | 3300005618 | Bacteria | 8942 |
| 56 | Ga0068864_100018402 | 3300005618 | Bacteria | 5837 |
| 57 | Ga0068864_100031451 | 3300005618 | Bacteria | 4503 |
| 58 | Ga0068864_100085045 | 3300005618 | Bacteria | 2780 |
| 59 | Ga0068864_100167595 | 3300005618 | Bacteria | 2001 |
| 60 | Ga0068866_10004628 | 3300005718 | Bacteria | 5641 |
| 61 | Ga0068866_10131672 | 3300005718 | Unclassified | 1423 |
| 62 | Ga0068861_100017775 | 3300005719 | Bacteria | 5052 |
| 63 | Ga0068861_100417809 | 3300005719 | Bacteria | 1194 |
| 64 | Ga0068851_10047588 | 3300005834 | Bacteria | 2173 |
| 65 | Ga0068870_10011628 | 3300005840 | Bacteria | 4089 |
| 66 | Ga0068863_100007378 | 3300005841 | Bacteria | 10762 |
| 67 | Ga0068863_100024860 | 3300005841 | Bacteria | 5713 |
| 68 | Ga0068863_100094214 | 3300005841 | Bacteria | 2842 |
| 69 | Ga0068863_100112518 | 3300005841 | Bacteria | 2593 |
| 70 | Ga0068860_100006456 | 3300005843 | Bacteria | 11774 |
| 71 | Ga0068860_100016635 | 3300005843 | Bacteria | 7174 |
| 72 | Ga0068860_100021084 | 3300005843 | Bacteria | 6312 |
| 73 | Ga0068860_100165486 | 3300005843 | Bacteria | 2134 |
| 74 | Ga0068862_100021124 | 3300005844 | Bacteria | 5442 |
| 75 | Ga0068862_100037265 | 3300005844 | Bacteria | 4121 |
| 76 | Ga0068862_100106722 | 3300005844 | Bacteria | 2455 |
| 77 | Ga0068862_100235757 | 3300005844 | Bacteria | 1662 |
| 78 | Ga0081539_10000533 | 3300005985 | Bacteria | 79065 |
| 79 | Ga0081539_10000749 | 3300005985 | Bacteria | 64587 |
| 80 | Ga0070717_10254919 | 3300006028 | Bacteria | 1551 |
| 81 | Ga0070716_100010732 | 3300006173 | Bacteria | 4602 |
| 82 | Ga0070712_100112196 | 3300006175 | Bacteria | 2036 |
| 83 | Ga0097621_100324585 | 3300006237 | Bacteria | 1364 |
| 84 | Ga0068871_100095502 | 3300006358 | Bacteria | 2482 |
| 85 | Ga0068871_100116173 | 3300006358 | Bacteria | 2256 |
| 86 | Ga0075428_100000812 | 3300006844 | Bacteria | 32669 |
| 87 | Ga0075431_100017376 | 3300006847 | Bacteria | 7311 |
| 88 | Ga0075431_100133430 | 3300006847 | Bacteria | 2560 |
| 89 | Ga0075434_100170817 | 3300006871 | Bacteria | 2194 |
| 90 | Ga0075429_100242087 | 3300006880 | Bacteria | 1580 |
| 91 | Ga0068865_100033969 | 3300006881 | Bacteria | 3418 |
| 92 | Ga0068865_100068063 | 3300006881 | Bacteria | 2517 |
| 93 | Ga0097620_100016203 | 3300006931 | Bacteria | 7487 |
| 94 | Ga0097620_100039200 | 3300006931 | Bacteria | 4752 |
| 95 | Ga0097620_100174816 | 3300006931 | Unclassified | 2229 |
| 96 | Ga0105240_10457928 | 3300009093 | Bacteria | 1426 |
| 97 | Ga0111539_10035355 | 3300009094 | Bacteria | 6050 |
| 98 | Ga0111539_10177656 | 3300009094 | Bacteria | 2487 |
| 99 | Ga0105247_10024012 | 3300009101 | Bacteria | 3672 |
| 100 | Ga0114129_10014859 | 3300009147 | Bacteria | 11093 |
| 101 | Ga0114129_10138306 | 3300009147 | Bacteria | 3341 |
| 102 | Ga0114129_10260093 | 3300009147 | Bacteria | 2327 |
| 103 | Ga0105242_10027871 | 3300009176 | Bacteria | 4491 |
| 104 | Ga0105242_10070088 | 3300009176 | Bacteria | 2906 |
| 105 | Ga0105248_10017698 | 3300009177 | Bacteria | 7860 |
| 106 | Ga0105248_10023119 | 3300009177 | Bacteria | 6904 |
| 107 | Ga0105248_10056994 | 3300009177 | Unclassified | 4384 |
| 108 | Ga0105248_10189463 | 3300009177 | Bacteria | 2318 |
| 109 | Ga0105248_10402064 | 3300009177 | Bacteria | 1542 |
| 110 | Ga0105237_10000008 | 3300009545 | Bacteria | 363335 |
| 111 | Ga0105237_10030217 | 3300009545 | Bacteria | 5505 |
| 112 | Ga0105237_10110126 | 3300009545 | Bacteria | 2746 |
| 113 | Ga0105249_10014207 | 3300009553 | Bacteria | 7039 |
| 114 | Ga0105249_10015300 | 3300009553 | Bacteria | 6790 |
| 115 | Ga0105249_10029199 | 3300009553 | Bacteria | 4980 |
| 116 | Ga0105249_10029917 | 3300009553 | Bacteria | 4920 |
| 117 | Ga0105239_10008971 | 3300010375 | Bacteria | 11317 |
| 118 | Ga0105239_10039240 | 3300010375 | Bacteria | 5187 |
| 119 | Ga0105239_10045220 | 3300010375 | Bacteria | 4825 |
| 120 | Ga0157378_10000620 | 3300013297 | Bacteria | 33448 |
| 121 | Ga0157378_10002849 | 3300013297 | Bacteria | 15423 |
| 122 | Ga0157378_10184959 | 3300013297 | Bacteria | 1962 |
| 123 | Ga0163162_10012393 | 3300013306 | Bacteria | 8326 |
| 124 | Ga0163162_10039172 | 3300013306 | Bacteria | 4735 |
| 125 | Ga0163162_10059719 | 3300013306 | Bacteria | 3846 |
| 126 | Ga0163162_10234044 | 3300013306 | Bacteria | 1968 |
| 127 | Ga0157372_10243545 | 3300013307 | Bacteria | 2086 |
| 128 | Ga0157375_10017212 | 3300013308 | Bacteria | 6518 |
| 129 | Ga0157375_10025022 | 3300013308 | Bacteria | 5537 |
| 130 | Ga0157375_10101033 | 3300013308 | Bacteria | 2966 |
| 131 | Ga0157375_10115128 | 3300013308 | Bacteria | 2792 |
| 132 | Ga0163163_10070913 | 3300014325 | Bacteria | 3471 |
| 133 | Ga0163163_10085960 | 3300014325 | Unclassified | 3153 |
| 134 | Ga0163163_10121033 | 3300014325 | Bacteria | 2651 |
| 135 | Ga0157380_10004657 | 3300014326 | Bacteria | 9546 |
| 136 | Ga0157379_10007580 | 3300014968 | Bacteria | 9396 |
| 137 | Ga0163161_10087405 | 3300017792 | Unclassified | 2303 |
| 138 | Ga0206354_10600475 | 3300020081 | Bacteria | 1289 |
| 139 | Ga0213876_10000507 | 3300021384 | Bacteria | 30333 |
| 140 | Ga0213876_10038813 | 3300021384 | Bacteria | 2515 |
| 141 | Ga0207682_10051532 | 3300025893 | Bacteria | 1705 |
| 142 | Ga0207680_10134031 | 3300025903 | Bacteria | 1635 |
| 143 | Ga0207647_10096867 | 3300025904 | Bacteria | 1755 |
| 144 | Ga0207685_10078991 | 3300025905 | Bacteria | 1356 |
| 145 | Ga0207699_10000024 | 3300025906 | Bacteria | 169105 |
| 146 | Ga0207643_10015810 | 3300025908 | Bacteria | 4111 |
| 147 | Ga0207643_10032906 | 3300025908 | Bacteria | 2899 |
| 148 | Ga0207684_10029161 | 3300025910 | Bacteria | 4701 |
| 149 | Ga0207684_10084302 | 3300025910 | Bacteria | 2707 |
| 150 | Ga0207671_10000005 | 3300025914 | Bacteria | 844816 |
| 151 | Ga0207671_10017454 | 3300025914 | Bacteria | 5532 |
| 152 | Ga0207693_10011915 | 3300025915 | Bacteria | 7028 |
| 153 | Ga0207646_10120944 | 3300025922 | Bacteria | 2352 |
| 154 | Ga0207681_10033923 | 3300025923 | Bacteria | 3351 |
| 155 | Ga0207650_10014390 | 3300025925 | Bacteria | 5499 |
| 156 | Ga0207650_10019373 | 3300025925 | Bacteria | 4780 |
| 157 | Ga0207650_10150114 | 3300025925 | Bacteria | 1839 |
| 158 | Ga0207700_10004712 | 3300025928 | Bacteria | 8084 |
| 159 | Ga0207664_10122830 | 3300025929 | Bacteria | 2175 |
| 160 | Ga0207644_10221248 | 3300025931 | Bacteria | 1501 |
| 161 | Ga0207670_10005023 | 3300025936 | Bacteria | 7211 |
| 162 | Ga0207670_10035993 | 3300025936 | Bacteria | 3216 |
| 163 | Ga0207670_10041105 | 3300025936 | Bacteria | 3039 |
| 164 | Ga0207665_10027247 | 3300025939 | Bacteria | 3776 |
| 165 | Ga0207691_10022583 | 3300025940 | Bacteria | 5932 |
| 166 | Ga0207691_10049610 | 3300025940 | Bacteria | 3846 |
| 167 | Ga0207711_10010238 | 3300025941 | Bacteria | 7785 |
| 168 | Ga0207711_10042412 | 3300025941 | Bacteria | 3877 |
| 169 | Ga0207711_10044088 | 3300025941 | Bacteria | 3806 |
| 170 | Ga0207711_10046677 | 3300025941 | Bacteria | 3701 |
| 171 | Ga0207711_10192021 | 3300025941 | Bacteria | 1861 |
| 172 | Ga0207689_10072117 | 3300025942 | Bacteria | 2837 |
| 173 | Ga0207689_10153686 | 3300025942 | Bacteria | 1897 |
| 174 | Ga0207679_10037606 | 3300025945 | Bacteria | 3442 |
| 175 | Ga0207712_10008480 | 3300025961 | Bacteria | 6498 |
| 176 | Ga0207712_10011351 | 3300025961 | Bacteria | 5675 |
| 177 | Ga0207712_10022227 | 3300025961 | Bacteria | 4174 |
| 178 | Ga0207712_10207657 | 3300025961 | Bacteria | 1557 |
| 179 | Ga0207658_10006381 | 3300025986 | Bacteria | 8051 |
| 180 | Ga0207658_10072593 | 3300025986 | Bacteria | 2609 |
| 181 | Ga0207658_10183318 | 3300025986 | Bacteria | 1734 |
| 182 | Ga0207677_10060463 | 3300026023 | Bacteria | 2619 |
| 183 | Ga0207677_10237846 | 3300026023 | Unclassified | 1471 |
| 184 | Ga0207703_10004686 | 3300026035 | Bacteria | 11169 |
| 185 | Ga0207639_10123937 | 3300026041 | Bacteria | 2128 |
| 186 | Ga0207678_10120045 | 3300026067 | Bacteria | 2243 |
| 187 | Ga0207641_10002083 | 3300026088 | Bacteria | 18951 |
| 188 | Ga0207641_10064584 | 3300026088 | Bacteria | 3129 |
| 189 | Ga0207648_10000280 | 3300026089 | Bacteria | 55313 |
| 190 | Ga0207648_10221117 | 3300026089 | Bacteria | 1683 |
| 191 | Ga0207676_10001676 | 3300026095 | Bacteria | 16337 |
| 192 | Ga0207676_10012689 | 3300026095 | Bacteria | 6045 |
| 193 | Ga0207676_10066854 | 3300026095 | Bacteria | 2869 |
| 194 | Ga0207675_100007184 | 3300026118 | Bacteria | 10523 |
| 195 | Ga0207683_10075315 | 3300026121 | Bacteria | 2987 |
| 196 | Ga0207428_10019118 | 3300027907 | Bacteria | 5842 |
| 197 | Ga0268265_10007369 | 3300028380 | Bacteria | 7429 |
| 198 | Ga0268265_10021875 | 3300028380 | Bacteria | 4486 |
| 199 | Ga0268265_10037476 | 3300028380 | Bacteria | 3560 |
| 200 | Ga0268264_10001959 | 3300028381 | Bacteria | 18505 |
| 201 | Ga0268264_10016812 | 3300028381 | Bacteria | 5988 |
| 202 | Ga0268264_10240313 | 3300028381 | Bacteria | 1677 |
| 203 | Ga0265326_10009471 | 3300028558 | Bacteria | 2913 |
| 204 | Ga0265323_10005281 | 3300028653 | Bacteria | 5490 |
| 205 | Ga0265323_10059039 | 3300028653 | Bacteria | 1338 |
| 206 | Ga0265338_10000900 | 3300028800 | Bacteria | 49987 |
| 207 | Ga0265338_10015932 | 3300028800 | Bacteria | 8224 |
| 208 | Ga0265338_10036401 | 3300028800 | Bacteria | 4711 |
| 209 | Ga0265324_10037519 | 3300029957 | Bacteria | 1684 |
| 210 | Ga0265330_10000005 | 3300031235 | Bacteria | 246580 |
| 211 | Ga0265330_10001807 | 3300031235 | Bacteria | 12007 |
| 212 | Ga0265332_10000041 | 3300031238 | Bacteria | 125775 |
| 213 | Ga0265325_10011791 | 3300031241 | Bacteria | 5014 |
| 214 | Ga0265329_10002478 | 3300031242 | Bacteria | 8336 |
| 215 | Ga0265340_10010296 | 3300031247 | Bacteria | 5003 |
| 216 | Ga0265331_10009360 | 3300031250 | Bacteria | 5502 |
| 217 | Ga0265316_10001667 | 3300031344 | Bacteria | 23640 |
| 218 | Ga0307513_10001585 | 3300031456 | Bacteria | 32641 |
| 219 | Ga0265314_10000005 | 3300031711 | Bacteria | 668532 |
| 220 | Ga0265314_10000008 | 3300031711 | Bacteria | 485166 |
| 221 | Ga0265342_10000005 | 3300031712 | Bacteria | 247745 |
| 222 | Ga0265342_10004246 | 3300031712 | Bacteria | 11353 |
| 223 | Ga0307405_10026789 | 3300031731 | Bacteria | 3332 |
| 224 | Ga0307413_10000565 | 3300031824 | Bacteria | 12421 |
| 225 | Ga0307413_10003032 | 3300031824 | Bacteria | 6979 |
| 226 | Ga0307413_10157775 | 3300031824 | Bacteria | 1590 |
| 227 | Ga0307413_10159322 | 3300031824 | Bacteria | 1584 |
| 228 | Ga0307410_10001391 | 3300031852 | Bacteria | 10879 |
| 229 | Ga0307406_10004787 | 3300031901 | Bacteria | 7374 |
| 230 | Ga0307407_10001554 | 3300031903 | Bacteria | 8435 |
| 231 | Ga0307407_10201245 | 3300031903 | Bacteria | 1335 |
| 232 | Ga0307412_10009679 | 3300031911 | Bacteria | 5534 |
| 233 | Ga0307409_100065107 | 3300031995 | Bacteria | 2866 |
| 234 | Ga0307409_100257754 | 3300031995 | Bacteria | 1599 |
| 235 | Ga0307409_100316090 | 3300031995 | Bacteria | 1459 |
| 236 | Ga0307415_100031615 | 3300032126 | Bacteria | 3412 |
| 237 | Ga0316583_10003204 | 3300032133 | Bacteria | 5754 |
| 238 | Ga0373943_0089470 | 3300035170 | Bacteria | 1592 |
| 239 | Ga0373931_0102933 | 3300035691 | Bacteria | 1609 |
| 240 | Ga0373935_0006031 | 3300035692 | Bacteria | 7199 |
| 241 | Ga0373947_0062620 | 3300035725 | Bacteria | 2264 |
| 242 | Ga0373947_0114465 | 3300035725 | Bacteria | 1708 |
| 243 | Ga0316582_0021447 | 3300036647 | Bacteria | 3818 |
| 244 | Ga0316584_0064919 | 3300036712 | Bacteria | 2734 |
| 245 | Ga0373925_0008833 | 3300037068 | Bacteria | 7341 |
| 246 | Ga0395898_0080394 | 3300037466 | Bacteria | 3144 |
| 247 | Ga0395905_0006359 | 3300037471 | Bacteria | 11907 |
| 248 | Ga0395905_0283727 | 3300037471 | Bacteria | 1542 |
| 249 | Ga0436365_0069585 | 3300039437 | Bacteria | 2618 |
| 250 | Ga0436365_0378929 | 3300039437 | Bacteria | 49081 |
| 251 | Ga0436365_0731184 | 3300039437 | Bacteria | 51143 |
| 252 | Ga0436365_1872027 | 3300039437 | Bacteria | 5037 |
| 253 | Ga0453684_0011767 | 3300044712 | Bacteria | 14586 |
| 254 | Ga0451576_0079906 | 3300045051 | Bacteria | 3403 |
| 255 | Ga0466967_0323937 | 3300045976 | Bacteria | 1487 |
| 256 | Ga0495598_0009903 | 3300046537 | Bacteria | 2267 |
| 257 | Ga0495659_0017065 | 3300046664 | Bacteria | 2401 |
| 258 | Ga0496102_0004753 | 3300048905 | Bacteria | 11497 |
| 259 | Ga0496103_0010848 | 3300048906 | Bacteria | 5393 |
| 260 | Ga0496104_0325592 | 3300048907 | Bacteria | 1450 |
| 261 | Ga0496106_0052433 | 3300048909 | Bacteria | 3078 |
| 262 | Ga0496106_0068802 | 3300048909 | Bacteria | 2701 |
| 263 | Ga0496107_0059144 | 3300048910 | Bacteria | 2773 |
| 264 | Ga0496114_0044540 | 3300048917 | Bacteria | 3682 |
| 265 | Ga0501036_0016719 | 3300049572 | Bacteria | 6127 |
| 266 | Ga0501040_0002540 | 3300049576 | Bacteria | 11762 |
| 267 | Ga0501040_0006464 | 3300049576 | Bacteria | 7609 |
| 268 | Ga0501041_0003249 | 3300049577 | Bacteria | 9348 |
| 269 | Ga0501042_0061308 | 3300049578 | Bacteria | 2687 |
| 270 | Ga0501046_0051156 | 3300049580 | Bacteria | 3261 |
| 271 | Ga0501067_0172242 | 3300049583 | Bacteria | 1206 |
| 272 | Ga0501068_0101504 | 3300049584 | Bacteria | 1784 |
| 273 | Ga0501071_0017353 | 3300049587 | Bacteria | 4962 |
| 274 | Ga0501072_0001756 | 3300049588 | Bacteria | 16123 |
| 275 | Ga0501074_0013669 | 3300049590 | Bacteria | 5902 |
| 276 | Ga0501074_0248422 | 3300049590 | Bacteria | 1265 |
| 277 | Ga0501075_0079004 | 3300049591 | Bacteria | 2490 |
| 278 | Ga0501075_0141319 | 3300049591 | Bacteria | 1835 |
| 279 | Ga0501076_0016138 | 3300049592 | Bacteria | 5653 |
| 280 | Ga0501077_0014813 | 3300049593 | Bacteria | 4901 |
| 281 | Ga0501235_022428 | 3300049669 | Bacteria | 1404 |
| 282 | Ga0501080_0017388 | 3300049742 | Bacteria | 6650 |
| 283 | Ga0501080_0053154 | 3300049742 | Bacteria | 3771 |
| 284 | Ga0501081_0002826 | 3300049743 | Bacteria | 11013 |
| 285 | Ga0501081_0008303 | 3300049743 | Bacteria | 6739 |
| 286 | Ga0501083_0071586 | 3300049744 | Bacteria | 2305 |
| 287 | Ga0501045_0084023 | 3300049824 | Bacteria | 2348 |
| 288 | nmdc:mga05p37_119916_c1 | 3300050507 | Bacteria | 3231 |
| 289 | nmdc:mga05p37_148575_c1 | 3300050507 | Bacteria | 2868 |
| 290 | nmdc:mga05p37_254252_c1 | 3300050507 | Bacteria | 2106 |
| 291 | nmdc:mga05p37_2819_c1 | 3300050507 | Bacteria | 20214 |
| 292 | nmdc:mga09592_6675_c1 | 3300050508 | Bacteria | 9398 |
| 293 | nmdc:mga0qj67_2932_c1 | 3300050509 | Bacteria | 12238 |
| 294 | nmdc:mga06r32_32026_c1 | 3300050510 | Bacteria | 4942 |
| 295 | nmdc:mga08x19_21374_c1 | 3300050514 | Bacteria | 3994 |
| 296 | Ga0500577_0000211 | 3300053142 | Bacteria | 15464 |
| 297 | Ga0500616_0003002 | 3300053153 | Bacteria | 13320 |
| 298 | Ga0501084_0004179 | 3300054114 | Bacteria | 11776 |
| 299 | Ga0590075_009303 | 3300059424 | Bacteria | 2353 |
| 300 | Ga0501082_0084512 | 3300060353 | Bacteria | 2737 |
| 301 | Ga0530510_0008081 | 3300061734 | Bacteria | 7337 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048910 | Ga0496107_0059144 | Ga0496107_0059144_206_1231 | 339 |
| 2 | 3300014325 | Ga0163163_10070913 | Ga0163163_100709134 | 341 |
| 3 | 3300031731 | Ga0307405_10026789 | Ga0307405_100267894 | 343 |
| 4 | 3300031824 | Ga0307413_10000565 | Ga0307413_100005658 | 343 |
| 5 | 3300031995 | Ga0307409_100316090 | Ga0307409_1003160901 | 343 |
| 6 | 3300035725 | Ga0373947_0114465 | Ga0373947_0114465_307_1341 | 344 |
| 7 | 3300005438 | Ga0070701_10018101 | Ga0070701_100181013 | 347 |
| 8 | 3300006847 | Ga0075431_100017376 | Ga0075431_1000173762 | 348 |
| 9 | 3300009147 | Ga0114129_10138306 | Ga0114129_101383062 | 348 |
| 10 | 3300020081 | Ga0206354_10600475 | Ga0206354_106004752 | 348 |
| 11 | 3300032133 | Ga0316583_10003204 | Ga0316583_100032045 | 348 |
| 12 | 3300049572 | Ga0501036_0016719 | Ga0501036_0016719_4209_5261 | 348 |
| 13 | 3300049576 | Ga0501040_0002540 | Ga0501040_0002540_8526_9578 | 348 |
| 14 | 3300049577 | Ga0501041_0003249 | Ga0501041_0003249_1200_2252 | 348 |
| 15 | 3300049578 | Ga0501042_0061308 | Ga0501042_0061308_1381_2433 | 348 |
| 16 | 3300049580 | Ga0501046_0051156 | Ga0501046_0051156_370_1422 | 348 |
| 17 | 3300049587 | Ga0501071_0017353 | Ga0501071_0017353_1412_2464 | 348 |
| 18 | 3300049591 | Ga0501075_0079004 | Ga0501075_0079004_1024_2076 | 348 |
| 19 | 3300049592 | Ga0501076_0016138 | Ga0501076_0016138_249_1301 | 348 |
| 20 | 3300049593 | Ga0501077_0014813 | Ga0501077_0014813_1436_2488 | 348 |
| 21 | 3300049742 | Ga0501080_0053154 | Ga0501080_0053154_1930_2982 | 348 |
| 22 | 3300049743 | Ga0501081_0002826 | Ga0501081_0002826_8592_9644 | 348 |
| 23 | 3300049744 | Ga0501083_0071586 | Ga0501083_0071586_189_1241 | 348 |
| 24 | 3300049824 | Ga0501045_0084023 | Ga0501045_0084023_110_1162 | 348 |
| 25 | 3300050507 | nmdc:mga05p37_148575_c1 | nmdc:mga05p37_148575_c1_825_1874 | 348 |
| 26 | 3300050508 | nmdc:mga09592_6675_c1 | nmdc:mga09592_6675_c1_4045_5094 | 348 |
| 27 | 3300050509 | nmdc:mga0qj67_2932_c1 | nmdc:mga0qj67_2932_c1_7650_8699 | 348 |
| 28 | 3300050510 | nmdc:mga06r32_32026_c1 | nmdc:mga06r32_32026_c1_2491_3540 | 348 |
| 29 | 3300054114 | Ga0501084_0004179 | Ga0501084_0004179_1237_2289 | 348 |
| 30 | 3300060353 | Ga0501082_0084512 | Ga0501082_0084512_1450_2502 | 348 |
| 31 | 3300061734 | Ga0530510_0008081 | Ga0530510_0008081_520_1572 | 348 |
| 32 | 3300005328 | Ga0070676_10242299 | Ga0070676_102422991 | 349 |
| 33 | 3300006847 | Ga0075431_100133430 | Ga0075431_1001334303 | 349 |
| 34 | 3300006880 | Ga0075429_100242087 | Ga0075429_1002420873 | 349 |
| 35 | 3300009147 | Ga0114129_10260093 | Ga0114129_102600932 | 349 |
| 36 | 3300036647 | Ga0316582_0021447 | Ga0316582_0021447_1758_2810 | 349 |
| 37 | 3300050507 | nmdc:mga05p37_119916_c1 | nmdc:mga05p37_119916_c1_119_1171 | 349 |
| 38 | 3300044712 | Ga0453684_0011767 | Ga0453684_0011767_139_1197 | 350 |
| 39 | 3300005467 | Ga0070706_100241847 | Ga0070706_1002418472 | 352 |
| 40 | 3300006844 | Ga0075428_100000812 | Ga0075428_10000081217 | 352 |
| 41 | 3300009545 | Ga0105237_10000008 | Ga0105237_1000000882 | 352 |
| 42 | 3300025910 | Ga0207684_10084302 | Ga0207684_100843022 | 352 |
| 43 | 3300025914 | Ga0207671_10000005 | Ga0207671_1000000552 | 352 |
| 44 | 3300025936 | Ga0207670_10041105 | Ga0207670_100411052 | 352 |
| 45 | 3300026121 | Ga0207683_10075315 | Ga0207683_100753153 | 352 |
| 46 | 3300005331 | Ga0070670_100007430 | Ga0070670_1000074308 | 353 |
| 47 | 3300005340 | Ga0070689_100038068 | Ga0070689_1000380684 | 353 |
| 48 | 3300005353 | Ga0070669_100001115 | Ga0070669_10000111518 | 353 |
| 49 | 3300005354 | Ga0070675_100100149 | Ga0070675_1001001492 | 353 |
| 50 | 3300005365 | Ga0070688_100069759 | Ga0070688_1000697592 | 353 |
| 51 | 3300005445 | Ga0070708_100007370 | Ga0070708_10000737010 | 353 |
| 52 | 3300005459 | Ga0068867_100001573 | Ga0068867_10000157313 | 353 |
| 53 | 3300005471 | Ga0070698_100050627 | Ga0070698_1000506272 | 353 |
| 54 | 3300005545 | Ga0070695_100037257 | Ga0070695_1000372572 | 353 |
| 55 | 3300005549 | Ga0070704_100004180 | Ga0070704_1000041803 | 353 |
| 56 | 3300005549 | Ga0070704_100137032 | Ga0070704_1001370322 | 353 |
| 57 | 3300005564 | Ga0070664_100106732 | Ga0070664_1001067323 | 353 |
| 58 | 3300005618 | Ga0068864_100018402 | Ga0068864_1000184022 | 353 |
| 59 | 3300005618 | Ga0068864_100031451 | Ga0068864_1000314512 | 353 |
| 60 | 3300005719 | Ga0068861_100017775 | Ga0068861_1000177753 | 353 |
| 61 | 3300005840 | Ga0068870_10011628 | Ga0068870_100116282 | 353 |
| 62 | 3300005841 | Ga0068863_100007378 | Ga0068863_1000073783 | 353 |
| 63 | 3300005843 | Ga0068860_100165486 | Ga0068860_1001654863 | 353 |
| 64 | 3300006237 | Ga0097621_100324585 | Ga0097621_1003245851 | 353 |
| 65 | 3300006881 | Ga0068865_100068063 | Ga0068865_1000680632 | 353 |
| 66 | 3300009094 | Ga0111539_10177656 | Ga0111539_101776563 | 353 |
| 67 | 3300014325 | Ga0163163_10085960 | Ga0163163_100859602 | 353 |
| 68 | 3300014325 | Ga0163163_10121033 | Ga0163163_101210332 | 353 |
| 69 | 3300025908 | Ga0207643_10015810 | Ga0207643_100158102 | 353 |
| 70 | 3300025908 | Ga0207643_10032906 | Ga0207643_100329062 | 353 |
| 71 | 3300025923 | Ga0207681_10033923 | Ga0207681_100339232 | 353 |
| 72 | 3300025925 | Ga0207650_10014390 | Ga0207650_100143904 | 353 |
| 73 | 3300025940 | Ga0207691_10049610 | Ga0207691_100496104 | 353 |
| 74 | 3300025945 | Ga0207679_10037606 | Ga0207679_100376062 | 353 |
| 75 | 3300025961 | Ga0207712_10011351 | Ga0207712_100113512 | 353 |
| 76 | 3300026089 | Ga0207648_10000280 | Ga0207648_1000028021 | 353 |
| 77 | 3300026095 | Ga0207676_10012689 | Ga0207676_100126894 | 353 |
| 78 | 3300026118 | Ga0207675_100007184 | Ga0207675_1000071847 | 353 |
| 79 | 3300027907 | Ga0207428_10019118 | Ga0207428_100191186 | 353 |
| 80 | 3300028380 | Ga0268265_10021875 | Ga0268265_100218754 | 353 |
| 81 | 3300028558 | Ga0265326_10009471 | Ga0265326_100094712 | 353 |
| 82 | 3300028653 | Ga0265323_10005281 | Ga0265323_100052815 | 353 |
| 83 | 3300028653 | Ga0265323_10059039 | Ga0265323_100590391 | 353 |
| 84 | 3300028800 | Ga0265338_10015932 | Ga0265338_100159323 | 353 |
| 85 | 3300028800 | Ga0265338_10036401 | Ga0265338_100364014 | 353 |
| 86 | 3300029957 | Ga0265324_10037519 | Ga0265324_100375192 | 353 |
| 87 | 3300031235 | Ga0265330_10000005 | Ga0265330_1000000592 | 353 |
| 88 | 3300031235 | Ga0265330_10001807 | Ga0265330_100018073 | 353 |
| 89 | 3300031238 | Ga0265332_10000041 | Ga0265332_1000004198 | 353 |
| 90 | 3300031241 | Ga0265325_10011791 | Ga0265325_100117914 | 353 |
| 91 | 3300031242 | Ga0265329_10002478 | Ga0265329_100024785 | 353 |
| 92 | 3300031247 | Ga0265340_10010296 | Ga0265340_100102963 | 353 |
| 93 | 3300031250 | Ga0265331_10009360 | Ga0265331_100093602 | 353 |
| 94 | 3300031344 | Ga0265316_10001667 | Ga0265316_100016671 | 353 |
| 95 | 3300031711 | Ga0265314_10000005 | Ga0265314_10000005197 | 353 |
| 96 | 3300031711 | Ga0265314_10000008 | Ga0265314_10000008207 | 353 |
| 97 | 3300031712 | Ga0265342_10000005 | Ga0265342_10000005158 | 353 |
| 98 | 3300031712 | Ga0265342_10004246 | Ga0265342_100042467 | 353 |
| 99 | 3300035170 | Ga0373943_0089470 | Ga0373943_0089470_188_1252 | 353 |
| 100 | 3300035691 | Ga0373931_0102933 | Ga0373931_0102933_508_1572 | 353 |
| 101 | 3300035692 | Ga0373935_0006031 | Ga0373935_0006031_3336_4400 | 353 |
| 102 | 3300035725 | Ga0373947_0062620 | Ga0373947_0062620_357_1421 | 353 |
| 103 | 3300036712 | Ga0316584_0064919 | Ga0316584_0064919_1036_2103 | 353 |
| 104 | 3300037068 | Ga0373925_0008833 | Ga0373925_0008833_2527_3591 | 353 |
| 105 | 3300045051 | Ga0451576_0079906 | Ga0451576_0079906_665_1729 | 353 |
| 106 | 3300046664 | Ga0495659_0017065 | Ga0495659_0017065_984_2069 | 353 |
| 107 | 3300049576 | Ga0501040_0006464 | Ga0501040_0006464_3305_4369 | 353 |
| 108 | 3300049583 | Ga0501067_0172242 | Ga0501067_0172242_60_1133 | 353 |
| 109 | 3300049591 | Ga0501075_0141319 | Ga0501075_0141319_17_1081 | 353 |
| 110 | 3300049743 | Ga0501081_0008303 | Ga0501081_0008303_4673_5737 | 353 |
| 111 | 3300050514 | nmdc:mga08x19_21374_c1 | nmdc:mga08x19_21374_c1_2578_3645 | 353 |
| 112 | 3300059424 | Ga0590075_009303 | Ga0590075_009303_571_1650 | 353 |
| 113 | 3300005434 | Ga0070709_10000676 | Ga0070709_1000067615 | 354 |
| 114 | 3300005436 | Ga0070713_100001620 | Ga0070713_1000016202 | 354 |
| 115 | 3300005471 | Ga0070698_100026832 | Ga0070698_1000268325 | 354 |
| 116 | 3300005549 | Ga0070704_100001151 | Ga0070704_10000115113 | 354 |
| 117 | 3300006871 | Ga0075434_100170817 | Ga0075434_1001708172 | 354 |
| 118 | 3300009147 | Ga0114129_10014859 | Ga0114129_100148592 | 354 |
| 119 | 3300009545 | Ga0105237_10110126 | Ga0105237_101101262 | 354 |
| 120 | 3300010375 | Ga0105239_10008971 | Ga0105239_100089712 | 354 |
| 121 | 3300025903 | Ga0207680_10134031 | Ga0207680_101340312 | 354 |
| 122 | 3300025906 | Ga0207699_10000024 | Ga0207699_100000248 | 354 |
| 123 | 3300025928 | Ga0207700_10004712 | Ga0207700_100047128 | 354 |
| 124 | 3300025929 | Ga0207664_10122830 | Ga0207664_101228302 | 354 |
| 125 | 3300050507 | nmdc:mga05p37_254252_c1 | nmdc:mga05p37_254252_c1_467_1543 | 354 |
| 126 | 3300050507 | nmdc:mga05p37_2819_c1 | nmdc:mga05p37_2819_c1_5789_6862 | 354 |
| 127 | 3300005331 | Ga0070670_100173502 | Ga0070670_1001735022 | 355 |
| 128 | 3300005618 | Ga0068864_100167595 | Ga0068864_1001675952 | 355 |
| 129 | 3300025893 | Ga0207682_10051532 | Ga0207682_100515322 | 355 |
| 130 | 3300025940 | Ga0207691_10022583 | Ga0207691_100225834 | 355 |
| 131 | 3300026089 | Ga0207648_10221117 | Ga0207648_102211172 | 355 |
| 132 | 3300005338 | Ga0068868_100196358 | Ga0068868_1001963582 | 356 |
| 133 | 3300005367 | Ga0070667_100185879 | Ga0070667_1001858791 | 356 |
| 134 | 3300005440 | Ga0070705_100003270 | Ga0070705_1000032702 | 356 |
| 135 | 3300005440 | Ga0070705_100035526 | Ga0070705_1000355261 | 356 |
| 136 | 3300005444 | Ga0070694_100064303 | Ga0070694_1000643032 | 356 |
| 137 | 3300005518 | Ga0070699_100092148 | Ga0070699_1000921483 | 356 |
| 138 | 3300005536 | Ga0070697_100096034 | Ga0070697_1000960342 | 356 |
| 139 | 3300005539 | Ga0068853_100141463 | Ga0068853_1001414632 | 356 |
| 140 | 3300005547 | Ga0070693_100002427 | Ga0070693_1000024274 | 356 |
| 141 | 3300005549 | Ga0070704_100006295 | Ga0070704_1000062954 | 356 |
| 142 | 3300005563 | Ga0068855_100077388 | Ga0068855_1000773882 | 356 |
| 143 | 3300005718 | Ga0068866_10004628 | Ga0068866_100046285 | 356 |
| 144 | 3300005843 | Ga0068860_100006456 | Ga0068860_1000064567 | 356 |
| 145 | 3300005844 | Ga0068862_100235757 | Ga0068862_1002357572 | 356 |
| 146 | 3300006028 | Ga0070717_10254919 | Ga0070717_102549192 | 356 |
| 147 | 3300006173 | Ga0070716_100010732 | Ga0070716_1000107324 | 356 |
| 148 | 3300006175 | Ga0070712_100112196 | Ga0070712_1001121962 | 356 |
| 149 | 3300006881 | Ga0068865_100033969 | Ga0068865_1000339693 | 356 |
| 150 | 3300009093 | Ga0105240_10457928 | Ga0105240_104579282 | 356 |
| 151 | 3300009094 | Ga0111539_10035355 | Ga0111539_100353554 | 356 |
| 152 | 3300009101 | Ga0105247_10024012 | Ga0105247_100240122 | 356 |
| 153 | 3300009176 | Ga0105242_10070088 | Ga0105242_100700882 | 356 |
| 154 | 3300009177 | Ga0105248_10023119 | Ga0105248_100231192 | 356 |
| 155 | 3300009553 | Ga0105249_10029917 | Ga0105249_100299174 | 356 |
| 156 | 3300010375 | Ga0105239_10039240 | Ga0105239_100392403 | 356 |
| 157 | 3300010375 | Ga0105239_10045220 | Ga0105239_100452203 | 356 |
| 158 | 3300013297 | Ga0157378_10000620 | Ga0157378_1000062013 | 356 |
| 159 | 3300013297 | Ga0157378_10184959 | Ga0157378_101849591 | 356 |
| 160 | 3300013306 | Ga0163162_10012393 | Ga0163162_100123936 | 356 |
| 161 | 3300013306 | Ga0163162_10039172 | Ga0163162_100391722 | 356 |
| 162 | 3300013308 | Ga0157375_10101033 | Ga0157375_101010333 | 356 |
| 163 | 3300025904 | Ga0207647_10096867 | Ga0207647_100968672 | 356 |
| 164 | 3300025905 | Ga0207685_10078991 | Ga0207685_100789912 | 356 |
| 165 | 3300025915 | Ga0207693_10011915 | Ga0207693_100119154 | 356 |
| 166 | 3300025922 | Ga0207646_10120944 | Ga0207646_101209443 | 356 |
| 167 | 3300025939 | Ga0207665_10027247 | Ga0207665_100272472 | 356 |
| 168 | 3300025941 | Ga0207711_10042412 | Ga0207711_100424124 | 356 |
| 169 | 3300025941 | Ga0207711_10046677 | Ga0207711_100466772 | 356 |
| 170 | 3300025942 | Ga0207689_10072117 | Ga0207689_100721173 | 356 |
| 171 | 3300025986 | Ga0207658_10183318 | Ga0207658_101833181 | 356 |
| 172 | 3300026023 | Ga0207677_10060463 | Ga0207677_100604632 | 356 |
| 173 | 3300026041 | Ga0207639_10123937 | Ga0207639_101239372 | 356 |
| 174 | 3300028381 | Ga0268264_10016812 | Ga0268264_100168123 | 356 |
| 175 | 3300039437 | Ga0436365_1872027 | Ga0436365_1872027_2616_3692 | 356 |
| 176 | 3300048905 | Ga0496102_0004753 | Ga0496102_0004753_5026_6102 | 356 |
| 177 | 3300048906 | Ga0496103_0010848 | Ga0496103_0010848_1094_2170 | 356 |
| 178 | 3300048907 | Ga0496104_0325592 | Ga0496104_0325592_203_1279 | 356 |
| 179 | 3300048909 | Ga0496106_0052433 | Ga0496106_0052433_1373_2449 | 356 |
| 180 | 3300048909 | Ga0496106_0068802 | Ga0496106_0068802_1469_2545 | 356 |
| 181 | 3300009545 | Ga0105237_10030217 | Ga0105237_100302172 | 357 |
| 182 | 3300028800 | Ga0265338_10000900 | Ga0265338_1000090018 | 357 |
| 183 | 3300049669 | Ga0501235_022428 | Ga0501235_022428_286_1386 | 357 |
| 184 | 3300000549 | LJQas_1000187 | LJQas_10001874 | 358 |
| 185 | 3300005289 | Ga0065704_10099405 | Ga0065704_100994052 | 358 |
| 186 | 3300005289 | Ga0065704_10180138 | Ga0065704_101801381 | 358 |
| 187 | 3300005290 | Ga0065712_10185473 | Ga0065712_101854731 | 358 |
| 188 | 3300005293 | Ga0065715_10103257 | Ga0065715_101032572 | 358 |
| 189 | 3300005327 | Ga0070658_10001907 | Ga0070658_100019074 | 358 |
| 190 | 3300005330 | Ga0070690_100003749 | Ga0070690_1000037492 | 358 |
| 191 | 3300005331 | Ga0070670_100033249 | Ga0070670_1000332492 | 358 |
| 192 | 3300005331 | Ga0070670_100154103 | Ga0070670_1001541032 | 358 |
| 193 | 3300005334 | Ga0068869_100034323 | Ga0068869_1000343232 | 358 |
| 194 | 3300005354 | Ga0070675_100059005 | Ga0070675_1000590052 | 358 |
| 195 | 3300005354 | Ga0070675_100155567 | Ga0070675_1001555672 | 358 |
| 196 | 3300005355 | Ga0070671_100009699 | Ga0070671_1000096998 | 358 |
| 197 | 3300005356 | Ga0070674_100055214 | Ga0070674_1000552142 | 358 |
| 198 | 3300005365 | Ga0070688_100001873 | Ga0070688_1000018733 | 358 |
| 199 | 3300005367 | Ga0070667_100032859 | Ga0070667_1000328593 | 358 |
| 200 | 3300005459 | Ga0068867_100268776 | Ga0068867_1002687761 | 358 |
| 201 | 3300005467 | Ga0070706_100012603 | Ga0070706_1000126034 | 358 |
| 202 | 3300005616 | Ga0068852_100129075 | Ga0068852_1001290752 | 358 |
| 203 | 3300005616 | Ga0068852_100202376 | Ga0068852_1002023762 | 358 |
| 204 | 3300005617 | Ga0068859_100016204 | Ga0068859_1000162043 | 358 |
| 205 | 3300005617 | Ga0068859_100039200 | Ga0068859_1000392003 | 358 |
| 206 | 3300005617 | Ga0068859_100174815 | Ga0068859_1001748152 | 358 |
| 207 | 3300005618 | Ga0068864_100007581 | Ga0068864_1000075812 | 358 |
| 208 | 3300005618 | Ga0068864_100085045 | Ga0068864_1000850453 | 358 |
| 209 | 3300005718 | Ga0068866_10131672 | Ga0068866_101316722 | 358 |
| 210 | 3300005719 | Ga0068861_100417809 | Ga0068861_1004178091 | 358 |
| 211 | 3300005834 | Ga0068851_10047588 | Ga0068851_100475882 | 358 |
| 212 | 3300005841 | Ga0068863_100024860 | Ga0068863_1000248602 | 358 |
| 213 | 3300005841 | Ga0068863_100094214 | Ga0068863_1000942143 | 358 |
| 214 | 3300005841 | Ga0068863_100112518 | Ga0068863_1001125182 | 358 |
| 215 | 3300005843 | Ga0068860_100016635 | Ga0068860_1000166353 | 358 |
| 216 | 3300005843 | Ga0068860_100021084 | Ga0068860_1000210845 | 358 |
| 217 | 3300005844 | Ga0068862_100021124 | Ga0068862_1000211243 | 358 |
| 218 | 3300005844 | Ga0068862_100037265 | Ga0068862_1000372653 | 358 |
| 219 | 3300005844 | Ga0068862_100106722 | Ga0068862_1001067222 | 358 |
| 220 | 3300005985 | Ga0081539_10000533 | Ga0081539_1000053334 | 358 |
| 221 | 3300005985 | Ga0081539_10000749 | Ga0081539_1000074954 | 358 |
| 222 | 3300006358 | Ga0068871_100095502 | Ga0068871_1000955022 | 358 |
| 223 | 3300006358 | Ga0068871_100116173 | Ga0068871_1001161732 | 358 |
| 224 | 3300006931 | Ga0097620_100016203 | Ga0097620_1000162033 | 358 |
| 225 | 3300006931 | Ga0097620_100039200 | Ga0097620_1000392003 | 358 |
| 226 | 3300006931 | Ga0097620_100174816 | Ga0097620_1001748162 | 358 |
| 227 | 3300009176 | Ga0105242_10027871 | Ga0105242_100278713 | 358 |
| 228 | 3300009177 | Ga0105248_10017698 | Ga0105248_100176985 | 358 |
| 229 | 3300009177 | Ga0105248_10056994 | Ga0105248_100569943 | 358 |
| 230 | 3300009177 | Ga0105248_10189463 | Ga0105248_101894632 | 358 |
| 231 | 3300009177 | Ga0105248_10402064 | Ga0105248_104020641 | 358 |
| 232 | 3300009553 | Ga0105249_10014207 | Ga0105249_100142074 | 358 |
| 233 | 3300009553 | Ga0105249_10015300 | Ga0105249_100153004 | 358 |
| 234 | 3300009553 | Ga0105249_10029199 | Ga0105249_100291992 | 358 |
| 235 | 3300013297 | Ga0157378_10002849 | Ga0157378_100028499 | 358 |
| 236 | 3300013306 | Ga0163162_10059719 | Ga0163162_100597192 | 358 |
| 237 | 3300013306 | Ga0163162_10234044 | Ga0163162_102340442 | 358 |
| 238 | 3300013307 | Ga0157372_10243545 | Ga0157372_102435452 | 358 |
| 239 | 3300013308 | Ga0157375_10017212 | Ga0157375_100172122 | 358 |
| 240 | 3300013308 | Ga0157375_10025022 | Ga0157375_100250223 | 358 |
| 241 | 3300013308 | Ga0157375_10115128 | Ga0157375_101151281 | 358 |
| 242 | 3300014326 | Ga0157380_10004657 | Ga0157380_100046577 | 358 |
| 243 | 3300014968 | Ga0157379_10007580 | Ga0157379_100075805 | 358 |
| 244 | 3300017792 | Ga0163161_10087405 | Ga0163161_100874052 | 358 |
| 245 | 3300021384 | Ga0213876_10000507 | Ga0213876_100005077 | 358 |
| 246 | 3300021384 | Ga0213876_10038813 | Ga0213876_100388132 | 358 |
| 247 | 3300025910 | Ga0207684_10029161 | Ga0207684_100291615 | 358 |
| 248 | 3300025914 | Ga0207671_10017454 | Ga0207671_100174543 | 358 |
| 249 | 3300025925 | Ga0207650_10019373 | Ga0207650_100193732 | 358 |
| 250 | 3300025925 | Ga0207650_10150114 | Ga0207650_101501141 | 358 |
| 251 | 3300025931 | Ga0207644_10221248 | Ga0207644_102212482 | 358 |
| 252 | 3300025936 | Ga0207670_10005023 | Ga0207670_100050238 | 358 |
| 253 | 3300025936 | Ga0207670_10035993 | Ga0207670_100359931 | 358 |
| 254 | 3300025941 | Ga0207711_10010238 | Ga0207711_100102389 | 358 |
| 255 | 3300025941 | Ga0207711_10044088 | Ga0207711_100440882 | 358 |
| 256 | 3300025941 | Ga0207711_10192021 | Ga0207711_101920212 | 358 |
| 257 | 3300025942 | Ga0207689_10153686 | Ga0207689_101536861 | 358 |
| 258 | 3300025961 | Ga0207712_10008480 | Ga0207712_100084802 | 358 |
| 259 | 3300025961 | Ga0207712_10022227 | Ga0207712_100222273 | 358 |
| 260 | 3300025961 | Ga0207712_10207657 | Ga0207712_102076571 | 358 |
| 261 | 3300025986 | Ga0207658_10006381 | Ga0207658_100063812 | 358 |
| 262 | 3300025986 | Ga0207658_10072593 | Ga0207658_100725933 | 358 |
| 263 | 3300026023 | Ga0207677_10237846 | Ga0207677_102378462 | 358 |
| 264 | 3300026035 | Ga0207703_10004686 | Ga0207703_100046862 | 358 |
| 265 | 3300026067 | Ga0207678_10120045 | Ga0207678_101200452 | 358 |
| 266 | 3300026088 | Ga0207641_10002083 | Ga0207641_100020838 | 358 |
| 267 | 3300026088 | Ga0207641_10064584 | Ga0207641_100645842 | 358 |
| 268 | 3300026095 | Ga0207676_10001676 | Ga0207676_100016769 | 358 |
| 269 | 3300026095 | Ga0207676_10066854 | Ga0207676_100668542 | 358 |
| 270 | 3300028380 | Ga0268265_10007369 | Ga0268265_100073694 | 358 |
| 271 | 3300028380 | Ga0268265_10037476 | Ga0268265_100374762 | 358 |
| 272 | 3300028381 | Ga0268264_10001959 | Ga0268264_100019593 | 358 |
| 273 | 3300028381 | Ga0268264_10240313 | Ga0268264_102403132 | 358 |
| 274 | 3300031456 | Ga0307513_10001585 | Ga0307513_1000158524 | 358 |
| 275 | 3300031824 | Ga0307413_10003032 | Ga0307413_100030323 | 358 |
| 276 | 3300031824 | Ga0307413_10157775 | Ga0307413_101577752 | 358 |
| 277 | 3300031824 | Ga0307413_10159322 | Ga0307413_101593221 | 358 |
| 278 | 3300031852 | Ga0307410_10001391 | Ga0307410_100013912 | 358 |
| 279 | 3300031901 | Ga0307406_10004787 | Ga0307406_100047876 | 358 |
| 280 | 3300031903 | Ga0307407_10001554 | Ga0307407_100015542 | 358 |
| 281 | 3300031903 | Ga0307407_10201245 | Ga0307407_102012451 | 358 |
| 282 | 3300031911 | Ga0307412_10009679 | Ga0307412_100096794 | 358 |
| 283 | 3300031995 | Ga0307409_100065107 | Ga0307409_1000651073 | 358 |
| 284 | 3300031995 | Ga0307409_100257754 | Ga0307409_1002577542 | 358 |
| 285 | 3300032126 | Ga0307415_100031615 | Ga0307415_1000316153 | 358 |
| 286 | 3300037466 | Ga0395898_0080394 | Ga0395898_0080394_880_1977 | 358 |
| 287 | 3300037471 | Ga0395905_0006359 | Ga0395905_0006359_9028_10125 | 358 |
| 288 | 3300037471 | Ga0395905_0283727 | Ga0395905_0283727_345_1442 | 358 |
| 289 | 3300039437 | Ga0436365_0069585 | Ga0436365_0069585_860_1957 | 358 |
| 290 | 3300039437 | Ga0436365_0378929 | Ga0436365_0378929_8406_9503 | 358 |
| 291 | 3300039437 | Ga0436365_0731184 | Ga0436365_0731184_6706_7956 | 358 |
| 292 | 3300045976 | Ga0466967_0323937 | Ga0466967_0323937_274_1350 | 358 |
| 293 | 3300046537 | Ga0495598_0009903 | Ga0495598_0009903_97_1173 | 358 |
| 294 | 3300048917 | Ga0496114_0044540 | Ga0496114_0044540_2562_3638 | 358 |
| 295 | 3300049584 | Ga0501068_0101504 | Ga0501068_0101504_595_1680 | 358 |
| 296 | 3300049588 | Ga0501072_0001756 | Ga0501072_0001756_14624_15700 | 358 |
| 297 | 3300049590 | Ga0501074_0013669 | Ga0501074_0013669_483_1568 | 358 |
| 298 | 3300049590 | Ga0501074_0248422 | Ga0501074_0248422_35_1111 | 358 |
| 299 | 3300049742 | Ga0501080_0017388 | Ga0501080_0017388_3942_5027 | 358 |
| 300 | 3300053142 | Ga0500577_0000211 | Ga0500577_0000211_11282_12358 | 358 |
| 301 | 3300053153 | Ga0500616_0003002 | Ga0500616_0003002_4284_5381 | 358 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qjg-assembly2.cif.gz_I | m. jannaschii adh synthase complexed with f1,6p | 0.911 | 43 | 346 |
| 2qjg-assembly1.cif.gz_C | m. jannaschii adh synthase complexed with f1,6p | 0.901 | 44 | 350 |
| 2qjg-assembly2.cif.gz_T | m. jannaschii adh synthase complexed with f1,6p | 0.9005 | 43 | 351 |
| 2qjg-assembly1.cif.gz_K | m. jannaschii adh synthase complexed with f1,6p | 0.899 | 43 | 346 |
| 2qji-assembly2.cif.gz_T | m. jannaschii adh synthase complexed with dihydroxyacetone phosphate and glycerol | 0.8983 | 43 | 351 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A991_40_348_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9913 | 47 | 356 | 3.20.20.70 |
| af_P0A991_40_348_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9786 | 47 | 356 | 3.20.20.70 |
| 2qjgK00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.899 | 43 | 346 | 3.20.20.70 |
| 1ok6A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8419 | 56 | 350 | 3.20.20.70 |
| 2qjgK00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8314 | 43 | 346 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6D0IF93-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 0.9929 | 156 | 358 |
GO:0004332
|
| AF-P0A992-F1-model_v4 | Fructose-bisphosphate aldolase class 1 (EC 4.1.2.13) (Fructose-bisphosphate aldolase class I) (FBP aldolase) | 0.9926 | 8 | 358 |
GO:0004332
GO:0005737 GO:0006096 |
| AF-A0A6H0K889-F1-model_v4 | deleted | 0.9926 | 8 | 358 |
|
| AF-S3JRH4-F1-model_v4 | fructose-bisphosphate aldolase (EC 4.1.2.13) | 0.9925 | 8 | 358 |
GO:0004332
|
| AF-A0A828AJA0-F1-model_v4 | deleted | 0.9922 | 26 | 358 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar