F396004

General Info

Members Datasets Scaffolds Average Seq Length
301 183 301 357

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10026789|Ga0307405_100267894
Length 343
Sequence MSLDFSRIQELLGDDAESLLGHVSKTISKEDLHLPGGDFVDRVWMSSDRTPAVLRSLQTLYGGGRLSGTGYLSILPVDQGIEHSAGASFAPNPQYFDPENIVKLAIEGGCNAVASTYGVLGAVARKYAHKIPFIVKINHNELLTYPNRFDQVMFGNIEECRNMGAVAVGATIEAFAYAHELGMATILWCYLRNNKFKTKEGDMHTAADLTGQANHLGVTIQADIIKQKLPERNGGYNVLGLESAYGKTNPKIYTDLSTDHPIDLVRYQVANCYMGRCGLINSGGESKGTGDMADAVRTAVINKRGGGSGLISGRKAFQRPMAEGVELLNAIQDVYLSGDVTVA

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 2.33
Rhizosphere 94.68
Stem 0
Stem Tuber 0
Unclassified 2.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000187 3300000549 Bacteria 11176
2 Ga0065704_10099405 3300005289 Bacteria 2313
3 Ga0065704_10180138 3300005289 Bacteria 1241
4 Ga0065712_10185473 3300005290 Bacteria 1172
5 Ga0065715_10103257 3300005293 Unclassified 3047
6 Ga0070658_10001907 3300005327 Bacteria 17611
7 Ga0070676_10242299 3300005328 Bacteria 1200
8 Ga0070690_100003749 3300005330 Bacteria 8373
9 Ga0070670_100007430 3300005331 Bacteria 9307
10 Ga0070670_100033249 3300005331 Bacteria 4442
11 Ga0070670_100154103 3300005331 Bacteria 1989
12 Ga0070670_100173502 3300005331 Bacteria 1871
13 Ga0068869_100034323 3300005334 Bacteria 3588
14 Ga0068868_100196358 3300005338 Bacteria 1680
15 Ga0070689_100038068 3300005340 Bacteria 3678
16 Ga0070669_100001115 3300005353 Bacteria 19624
17 Ga0070675_100059005 3300005354 Bacteria 3165
18 Ga0070675_100100149 3300005354 Bacteria 2440
19 Ga0070675_100155567 3300005354 Bacteria 1963
20 Ga0070671_100009699 3300005355 Bacteria 7735
21 Ga0070674_100055214 3300005356 Bacteria 2750
22 Ga0070688_100001873 3300005365 Bacteria 10537
23 Ga0070688_100069759 3300005365 Bacteria 2245
24 Ga0070667_100032859 3300005367 Bacteria 4330
25 Ga0070667_100185879 3300005367 Bacteria 1839
26 Ga0070709_10000676 3300005434 Bacteria 19448
27 Ga0070713_100001620 3300005436 Bacteria 14428
28 Ga0070701_10018101 3300005438 Bacteria 3307
29 Ga0070705_100003270 3300005440 Bacteria 7973
30 Ga0070705_100035526 3300005440 Bacteria 2795
31 Ga0070694_100064303 3300005444 Bacteria 2511
32 Ga0070708_100007370 3300005445 Bacteria 8802
33 Ga0068867_100001573 3300005459 Bacteria 15866
34 Ga0068867_100268776 3300005459 Bacteria 1393
35 Ga0070706_100012603 3300005467 Bacteria 7828
36 Ga0070706_100241847 3300005467 Bacteria 1685
37 Ga0070698_100026832 3300005471 Bacteria 5991
38 Ga0070698_100050627 3300005471 Bacteria 4233
39 Ga0070699_100092148 3300005518 Bacteria 2650
40 Ga0070697_100096034 3300005536 Bacteria 2459
41 Ga0068853_100141463 3300005539 Bacteria 2160
42 Ga0070695_100037257 3300005545 Bacteria 3064
43 Ga0070693_100002427 3300005547 Bacteria 8577
44 Ga0070704_100001151 3300005549 Bacteria 13820
45 Ga0070704_100004180 3300005549 Bacteria 8334
46 Ga0070704_100006295 3300005549 Bacteria 6992
47 Ga0070704_100137032 3300005549 Bacteria 1905
48 Ga0068855_100077388 3300005563 Bacteria 3860
49 Ga0070664_100106732 3300005564 Bacteria 2440
50 Ga0068852_100129075 3300005616 Bacteria 2326
51 Ga0068852_100202376 3300005616 Bacteria 1879
52 Ga0068859_100016204 3300005617 Bacteria 7487
53 Ga0068859_100039200 3300005617 Bacteria 4752
54 Ga0068859_100174815 3300005617 Unclassified 2229
55 Ga0068864_100007581 3300005618 Bacteria 8942
56 Ga0068864_100018402 3300005618 Bacteria 5837
57 Ga0068864_100031451 3300005618 Bacteria 4503
58 Ga0068864_100085045 3300005618 Bacteria 2780
59 Ga0068864_100167595 3300005618 Bacteria 2001
60 Ga0068866_10004628 3300005718 Bacteria 5641
61 Ga0068866_10131672 3300005718 Unclassified 1423
62 Ga0068861_100017775 3300005719 Bacteria 5052
63 Ga0068861_100417809 3300005719 Bacteria 1194
64 Ga0068851_10047588 3300005834 Bacteria 2173
65 Ga0068870_10011628 3300005840 Bacteria 4089
66 Ga0068863_100007378 3300005841 Bacteria 10762
67 Ga0068863_100024860 3300005841 Bacteria 5713
68 Ga0068863_100094214 3300005841 Bacteria 2842
69 Ga0068863_100112518 3300005841 Bacteria 2593
70 Ga0068860_100006456 3300005843 Bacteria 11774
71 Ga0068860_100016635 3300005843 Bacteria 7174
72 Ga0068860_100021084 3300005843 Bacteria 6312
73 Ga0068860_100165486 3300005843 Bacteria 2134
74 Ga0068862_100021124 3300005844 Bacteria 5442
75 Ga0068862_100037265 3300005844 Bacteria 4121
76 Ga0068862_100106722 3300005844 Bacteria 2455
77 Ga0068862_100235757 3300005844 Bacteria 1662
78 Ga0081539_10000533 3300005985 Bacteria 79065
79 Ga0081539_10000749 3300005985 Bacteria 64587
80 Ga0070717_10254919 3300006028 Bacteria 1551
81 Ga0070716_100010732 3300006173 Bacteria 4602
82 Ga0070712_100112196 3300006175 Bacteria 2036
83 Ga0097621_100324585 3300006237 Bacteria 1364
84 Ga0068871_100095502 3300006358 Bacteria 2482
85 Ga0068871_100116173 3300006358 Bacteria 2256
86 Ga0075428_100000812 3300006844 Bacteria 32669
87 Ga0075431_100017376 3300006847 Bacteria 7311
88 Ga0075431_100133430 3300006847 Bacteria 2560
89 Ga0075434_100170817 3300006871 Bacteria 2194
90 Ga0075429_100242087 3300006880 Bacteria 1580
91 Ga0068865_100033969 3300006881 Bacteria 3418
92 Ga0068865_100068063 3300006881 Bacteria 2517
93 Ga0097620_100016203 3300006931 Bacteria 7487
94 Ga0097620_100039200 3300006931 Bacteria 4752
95 Ga0097620_100174816 3300006931 Unclassified 2229
96 Ga0105240_10457928 3300009093 Bacteria 1426
97 Ga0111539_10035355 3300009094 Bacteria 6050
98 Ga0111539_10177656 3300009094 Bacteria 2487
99 Ga0105247_10024012 3300009101 Bacteria 3672
100 Ga0114129_10014859 3300009147 Bacteria 11093
101 Ga0114129_10138306 3300009147 Bacteria 3341
102 Ga0114129_10260093 3300009147 Bacteria 2327
103 Ga0105242_10027871 3300009176 Bacteria 4491
104 Ga0105242_10070088 3300009176 Bacteria 2906
105 Ga0105248_10017698 3300009177 Bacteria 7860
106 Ga0105248_10023119 3300009177 Bacteria 6904
107 Ga0105248_10056994 3300009177 Unclassified 4384
108 Ga0105248_10189463 3300009177 Bacteria 2318
109 Ga0105248_10402064 3300009177 Bacteria 1542
110 Ga0105237_10000008 3300009545 Bacteria 363335
111 Ga0105237_10030217 3300009545 Bacteria 5505
112 Ga0105237_10110126 3300009545 Bacteria 2746
113 Ga0105249_10014207 3300009553 Bacteria 7039
114 Ga0105249_10015300 3300009553 Bacteria 6790
115 Ga0105249_10029199 3300009553 Bacteria 4980
116 Ga0105249_10029917 3300009553 Bacteria 4920
117 Ga0105239_10008971 3300010375 Bacteria 11317
118 Ga0105239_10039240 3300010375 Bacteria 5187
119 Ga0105239_10045220 3300010375 Bacteria 4825
120 Ga0157378_10000620 3300013297 Bacteria 33448
121 Ga0157378_10002849 3300013297 Bacteria 15423
122 Ga0157378_10184959 3300013297 Bacteria 1962
123 Ga0163162_10012393 3300013306 Bacteria 8326
124 Ga0163162_10039172 3300013306 Bacteria 4735
125 Ga0163162_10059719 3300013306 Bacteria 3846
126 Ga0163162_10234044 3300013306 Bacteria 1968
127 Ga0157372_10243545 3300013307 Bacteria 2086
128 Ga0157375_10017212 3300013308 Bacteria 6518
129 Ga0157375_10025022 3300013308 Bacteria 5537
130 Ga0157375_10101033 3300013308 Bacteria 2966
131 Ga0157375_10115128 3300013308 Bacteria 2792
132 Ga0163163_10070913 3300014325 Bacteria 3471
133 Ga0163163_10085960 3300014325 Unclassified 3153
134 Ga0163163_10121033 3300014325 Bacteria 2651
135 Ga0157380_10004657 3300014326 Bacteria 9546
136 Ga0157379_10007580 3300014968 Bacteria 9396
137 Ga0163161_10087405 3300017792 Unclassified 2303
138 Ga0206354_10600475 3300020081 Bacteria 1289
139 Ga0213876_10000507 3300021384 Bacteria 30333
140 Ga0213876_10038813 3300021384 Bacteria 2515
141 Ga0207682_10051532 3300025893 Bacteria 1705
142 Ga0207680_10134031 3300025903 Bacteria 1635
143 Ga0207647_10096867 3300025904 Bacteria 1755
144 Ga0207685_10078991 3300025905 Bacteria 1356
145 Ga0207699_10000024 3300025906 Bacteria 169105
146 Ga0207643_10015810 3300025908 Bacteria 4111
147 Ga0207643_10032906 3300025908 Bacteria 2899
148 Ga0207684_10029161 3300025910 Bacteria 4701
149 Ga0207684_10084302 3300025910 Bacteria 2707
150 Ga0207671_10000005 3300025914 Bacteria 844816
151 Ga0207671_10017454 3300025914 Bacteria 5532
152 Ga0207693_10011915 3300025915 Bacteria 7028
153 Ga0207646_10120944 3300025922 Bacteria 2352
154 Ga0207681_10033923 3300025923 Bacteria 3351
155 Ga0207650_10014390 3300025925 Bacteria 5499
156 Ga0207650_10019373 3300025925 Bacteria 4780
157 Ga0207650_10150114 3300025925 Bacteria 1839
158 Ga0207700_10004712 3300025928 Bacteria 8084
159 Ga0207664_10122830 3300025929 Bacteria 2175
160 Ga0207644_10221248 3300025931 Bacteria 1501
161 Ga0207670_10005023 3300025936 Bacteria 7211
162 Ga0207670_10035993 3300025936 Bacteria 3216
163 Ga0207670_10041105 3300025936 Bacteria 3039
164 Ga0207665_10027247 3300025939 Bacteria 3776
165 Ga0207691_10022583 3300025940 Bacteria 5932
166 Ga0207691_10049610 3300025940 Bacteria 3846
167 Ga0207711_10010238 3300025941 Bacteria 7785
168 Ga0207711_10042412 3300025941 Bacteria 3877
169 Ga0207711_10044088 3300025941 Bacteria 3806
170 Ga0207711_10046677 3300025941 Bacteria 3701
171 Ga0207711_10192021 3300025941 Bacteria 1861
172 Ga0207689_10072117 3300025942 Bacteria 2837
173 Ga0207689_10153686 3300025942 Bacteria 1897
174 Ga0207679_10037606 3300025945 Bacteria 3442
175 Ga0207712_10008480 3300025961 Bacteria 6498
176 Ga0207712_10011351 3300025961 Bacteria 5675
177 Ga0207712_10022227 3300025961 Bacteria 4174
178 Ga0207712_10207657 3300025961 Bacteria 1557
179 Ga0207658_10006381 3300025986 Bacteria 8051
180 Ga0207658_10072593 3300025986 Bacteria 2609
181 Ga0207658_10183318 3300025986 Bacteria 1734
182 Ga0207677_10060463 3300026023 Bacteria 2619
183 Ga0207677_10237846 3300026023 Unclassified 1471
184 Ga0207703_10004686 3300026035 Bacteria 11169
185 Ga0207639_10123937 3300026041 Bacteria 2128
186 Ga0207678_10120045 3300026067 Bacteria 2243
187 Ga0207641_10002083 3300026088 Bacteria 18951
188 Ga0207641_10064584 3300026088 Bacteria 3129
189 Ga0207648_10000280 3300026089 Bacteria 55313
190 Ga0207648_10221117 3300026089 Bacteria 1683
191 Ga0207676_10001676 3300026095 Bacteria 16337
192 Ga0207676_10012689 3300026095 Bacteria 6045
193 Ga0207676_10066854 3300026095 Bacteria 2869
194 Ga0207675_100007184 3300026118 Bacteria 10523
195 Ga0207683_10075315 3300026121 Bacteria 2987
196 Ga0207428_10019118 3300027907 Bacteria 5842
197 Ga0268265_10007369 3300028380 Bacteria 7429
198 Ga0268265_10021875 3300028380 Bacteria 4486
199 Ga0268265_10037476 3300028380 Bacteria 3560
200 Ga0268264_10001959 3300028381 Bacteria 18505
201 Ga0268264_10016812 3300028381 Bacteria 5988
202 Ga0268264_10240313 3300028381 Bacteria 1677
203 Ga0265326_10009471 3300028558 Bacteria 2913
204 Ga0265323_10005281 3300028653 Bacteria 5490
205 Ga0265323_10059039 3300028653 Bacteria 1338
206 Ga0265338_10000900 3300028800 Bacteria 49987
207 Ga0265338_10015932 3300028800 Bacteria 8224
208 Ga0265338_10036401 3300028800 Bacteria 4711
209 Ga0265324_10037519 3300029957 Bacteria 1684
210 Ga0265330_10000005 3300031235 Bacteria 246580
211 Ga0265330_10001807 3300031235 Bacteria 12007
212 Ga0265332_10000041 3300031238 Bacteria 125775
213 Ga0265325_10011791 3300031241 Bacteria 5014
214 Ga0265329_10002478 3300031242 Bacteria 8336
215 Ga0265340_10010296 3300031247 Bacteria 5003
216 Ga0265331_10009360 3300031250 Bacteria 5502
217 Ga0265316_10001667 3300031344 Bacteria 23640
218 Ga0307513_10001585 3300031456 Bacteria 32641
219 Ga0265314_10000005 3300031711 Bacteria 668532
220 Ga0265314_10000008 3300031711 Bacteria 485166
221 Ga0265342_10000005 3300031712 Bacteria 247745
222 Ga0265342_10004246 3300031712 Bacteria 11353
223 Ga0307405_10026789 3300031731 Bacteria 3332
224 Ga0307413_10000565 3300031824 Bacteria 12421
225 Ga0307413_10003032 3300031824 Bacteria 6979
226 Ga0307413_10157775 3300031824 Bacteria 1590
227 Ga0307413_10159322 3300031824 Bacteria 1584
228 Ga0307410_10001391 3300031852 Bacteria 10879
229 Ga0307406_10004787 3300031901 Bacteria 7374
230 Ga0307407_10001554 3300031903 Bacteria 8435
231 Ga0307407_10201245 3300031903 Bacteria 1335
232 Ga0307412_10009679 3300031911 Bacteria 5534
233 Ga0307409_100065107 3300031995 Bacteria 2866
234 Ga0307409_100257754 3300031995 Bacteria 1599
235 Ga0307409_100316090 3300031995 Bacteria 1459
236 Ga0307415_100031615 3300032126 Bacteria 3412
237 Ga0316583_10003204 3300032133 Bacteria 5754
238 Ga0373943_0089470 3300035170 Bacteria 1592
239 Ga0373931_0102933 3300035691 Bacteria 1609
240 Ga0373935_0006031 3300035692 Bacteria 7199
241 Ga0373947_0062620 3300035725 Bacteria 2264
242 Ga0373947_0114465 3300035725 Bacteria 1708
243 Ga0316582_0021447 3300036647 Bacteria 3818
244 Ga0316584_0064919 3300036712 Bacteria 2734
245 Ga0373925_0008833 3300037068 Bacteria 7341
246 Ga0395898_0080394 3300037466 Bacteria 3144
247 Ga0395905_0006359 3300037471 Bacteria 11907
248 Ga0395905_0283727 3300037471 Bacteria 1542
249 Ga0436365_0069585 3300039437 Bacteria 2618
250 Ga0436365_0378929 3300039437 Bacteria 49081
251 Ga0436365_0731184 3300039437 Bacteria 51143
252 Ga0436365_1872027 3300039437 Bacteria 5037
253 Ga0453684_0011767 3300044712 Bacteria 14586
254 Ga0451576_0079906 3300045051 Bacteria 3403
255 Ga0466967_0323937 3300045976 Bacteria 1487
256 Ga0495598_0009903 3300046537 Bacteria 2267
257 Ga0495659_0017065 3300046664 Bacteria 2401
258 Ga0496102_0004753 3300048905 Bacteria 11497
259 Ga0496103_0010848 3300048906 Bacteria 5393
260 Ga0496104_0325592 3300048907 Bacteria 1450
261 Ga0496106_0052433 3300048909 Bacteria 3078
262 Ga0496106_0068802 3300048909 Bacteria 2701
263 Ga0496107_0059144 3300048910 Bacteria 2773
264 Ga0496114_0044540 3300048917 Bacteria 3682
265 Ga0501036_0016719 3300049572 Bacteria 6127
266 Ga0501040_0002540 3300049576 Bacteria 11762
267 Ga0501040_0006464 3300049576 Bacteria 7609
268 Ga0501041_0003249 3300049577 Bacteria 9348
269 Ga0501042_0061308 3300049578 Bacteria 2687
270 Ga0501046_0051156 3300049580 Bacteria 3261
271 Ga0501067_0172242 3300049583 Bacteria 1206
272 Ga0501068_0101504 3300049584 Bacteria 1784
273 Ga0501071_0017353 3300049587 Bacteria 4962
274 Ga0501072_0001756 3300049588 Bacteria 16123
275 Ga0501074_0013669 3300049590 Bacteria 5902
276 Ga0501074_0248422 3300049590 Bacteria 1265
277 Ga0501075_0079004 3300049591 Bacteria 2490
278 Ga0501075_0141319 3300049591 Bacteria 1835
279 Ga0501076_0016138 3300049592 Bacteria 5653
280 Ga0501077_0014813 3300049593 Bacteria 4901
281 Ga0501235_022428 3300049669 Bacteria 1404
282 Ga0501080_0017388 3300049742 Bacteria 6650
283 Ga0501080_0053154 3300049742 Bacteria 3771
284 Ga0501081_0002826 3300049743 Bacteria 11013
285 Ga0501081_0008303 3300049743 Bacteria 6739
286 Ga0501083_0071586 3300049744 Bacteria 2305
287 Ga0501045_0084023 3300049824 Bacteria 2348
288 nmdc:mga05p37_119916_c1 3300050507 Bacteria 3231
289 nmdc:mga05p37_148575_c1 3300050507 Bacteria 2868
290 nmdc:mga05p37_254252_c1 3300050507 Bacteria 2106
291 nmdc:mga05p37_2819_c1 3300050507 Bacteria 20214
292 nmdc:mga09592_6675_c1 3300050508 Bacteria 9398
293 nmdc:mga0qj67_2932_c1 3300050509 Bacteria 12238
294 nmdc:mga06r32_32026_c1 3300050510 Bacteria 4942
295 nmdc:mga08x19_21374_c1 3300050514 Bacteria 3994
296 Ga0500577_0000211 3300053142 Bacteria 15464
297 Ga0500616_0003002 3300053153 Bacteria 13320
298 Ga0501084_0004179 3300054114 Bacteria 11776
299 Ga0590075_009303 3300059424 Bacteria 2353
300 Ga0501082_0084512 3300060353 Bacteria 2737
301 Ga0530510_0008081 3300061734 Bacteria 7337

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0059144 Ga0496107_0059144_206_1231 339
2 3300014325 Ga0163163_10070913 Ga0163163_100709134 341
3 3300031731 Ga0307405_10026789 Ga0307405_100267894 343
4 3300031824 Ga0307413_10000565 Ga0307413_100005658 343
5 3300031995 Ga0307409_100316090 Ga0307409_1003160901 343
6 3300035725 Ga0373947_0114465 Ga0373947_0114465_307_1341 344
7 3300005438 Ga0070701_10018101 Ga0070701_100181013 347
8 3300006847 Ga0075431_100017376 Ga0075431_1000173762 348
9 3300009147 Ga0114129_10138306 Ga0114129_101383062 348
10 3300020081 Ga0206354_10600475 Ga0206354_106004752 348
11 3300032133 Ga0316583_10003204 Ga0316583_100032045 348
12 3300049572 Ga0501036_0016719 Ga0501036_0016719_4209_5261 348
13 3300049576 Ga0501040_0002540 Ga0501040_0002540_8526_9578 348
14 3300049577 Ga0501041_0003249 Ga0501041_0003249_1200_2252 348
15 3300049578 Ga0501042_0061308 Ga0501042_0061308_1381_2433 348
16 3300049580 Ga0501046_0051156 Ga0501046_0051156_370_1422 348
17 3300049587 Ga0501071_0017353 Ga0501071_0017353_1412_2464 348
18 3300049591 Ga0501075_0079004 Ga0501075_0079004_1024_2076 348
19 3300049592 Ga0501076_0016138 Ga0501076_0016138_249_1301 348
20 3300049593 Ga0501077_0014813 Ga0501077_0014813_1436_2488 348
21 3300049742 Ga0501080_0053154 Ga0501080_0053154_1930_2982 348
22 3300049743 Ga0501081_0002826 Ga0501081_0002826_8592_9644 348
23 3300049744 Ga0501083_0071586 Ga0501083_0071586_189_1241 348
24 3300049824 Ga0501045_0084023 Ga0501045_0084023_110_1162 348
25 3300050507 nmdc:mga05p37_148575_c1 nmdc:mga05p37_148575_c1_825_1874 348
26 3300050508 nmdc:mga09592_6675_c1 nmdc:mga09592_6675_c1_4045_5094 348
27 3300050509 nmdc:mga0qj67_2932_c1 nmdc:mga0qj67_2932_c1_7650_8699 348
28 3300050510 nmdc:mga06r32_32026_c1 nmdc:mga06r32_32026_c1_2491_3540 348
29 3300054114 Ga0501084_0004179 Ga0501084_0004179_1237_2289 348
30 3300060353 Ga0501082_0084512 Ga0501082_0084512_1450_2502 348
31 3300061734 Ga0530510_0008081 Ga0530510_0008081_520_1572 348
32 3300005328 Ga0070676_10242299 Ga0070676_102422991 349
33 3300006847 Ga0075431_100133430 Ga0075431_1001334303 349
34 3300006880 Ga0075429_100242087 Ga0075429_1002420873 349
35 3300009147 Ga0114129_10260093 Ga0114129_102600932 349
36 3300036647 Ga0316582_0021447 Ga0316582_0021447_1758_2810 349
37 3300050507 nmdc:mga05p37_119916_c1 nmdc:mga05p37_119916_c1_119_1171 349
38 3300044712 Ga0453684_0011767 Ga0453684_0011767_139_1197 350
39 3300005467 Ga0070706_100241847 Ga0070706_1002418472 352
40 3300006844 Ga0075428_100000812 Ga0075428_10000081217 352
41 3300009545 Ga0105237_10000008 Ga0105237_1000000882 352
42 3300025910 Ga0207684_10084302 Ga0207684_100843022 352
43 3300025914 Ga0207671_10000005 Ga0207671_1000000552 352
44 3300025936 Ga0207670_10041105 Ga0207670_100411052 352
45 3300026121 Ga0207683_10075315 Ga0207683_100753153 352
46 3300005331 Ga0070670_100007430 Ga0070670_1000074308 353
47 3300005340 Ga0070689_100038068 Ga0070689_1000380684 353
48 3300005353 Ga0070669_100001115 Ga0070669_10000111518 353
49 3300005354 Ga0070675_100100149 Ga0070675_1001001492 353
50 3300005365 Ga0070688_100069759 Ga0070688_1000697592 353
51 3300005445 Ga0070708_100007370 Ga0070708_10000737010 353
52 3300005459 Ga0068867_100001573 Ga0068867_10000157313 353
53 3300005471 Ga0070698_100050627 Ga0070698_1000506272 353
54 3300005545 Ga0070695_100037257 Ga0070695_1000372572 353
55 3300005549 Ga0070704_100004180 Ga0070704_1000041803 353
56 3300005549 Ga0070704_100137032 Ga0070704_1001370322 353
57 3300005564 Ga0070664_100106732 Ga0070664_1001067323 353
58 3300005618 Ga0068864_100018402 Ga0068864_1000184022 353
59 3300005618 Ga0068864_100031451 Ga0068864_1000314512 353
60 3300005719 Ga0068861_100017775 Ga0068861_1000177753 353
61 3300005840 Ga0068870_10011628 Ga0068870_100116282 353
62 3300005841 Ga0068863_100007378 Ga0068863_1000073783 353
63 3300005843 Ga0068860_100165486 Ga0068860_1001654863 353
64 3300006237 Ga0097621_100324585 Ga0097621_1003245851 353
65 3300006881 Ga0068865_100068063 Ga0068865_1000680632 353
66 3300009094 Ga0111539_10177656 Ga0111539_101776563 353
67 3300014325 Ga0163163_10085960 Ga0163163_100859602 353
68 3300014325 Ga0163163_10121033 Ga0163163_101210332 353
69 3300025908 Ga0207643_10015810 Ga0207643_100158102 353
70 3300025908 Ga0207643_10032906 Ga0207643_100329062 353
71 3300025923 Ga0207681_10033923 Ga0207681_100339232 353
72 3300025925 Ga0207650_10014390 Ga0207650_100143904 353
73 3300025940 Ga0207691_10049610 Ga0207691_100496104 353
74 3300025945 Ga0207679_10037606 Ga0207679_100376062 353
75 3300025961 Ga0207712_10011351 Ga0207712_100113512 353
76 3300026089 Ga0207648_10000280 Ga0207648_1000028021 353
77 3300026095 Ga0207676_10012689 Ga0207676_100126894 353
78 3300026118 Ga0207675_100007184 Ga0207675_1000071847 353
79 3300027907 Ga0207428_10019118 Ga0207428_100191186 353
80 3300028380 Ga0268265_10021875 Ga0268265_100218754 353
81 3300028558 Ga0265326_10009471 Ga0265326_100094712 353
82 3300028653 Ga0265323_10005281 Ga0265323_100052815 353
83 3300028653 Ga0265323_10059039 Ga0265323_100590391 353
84 3300028800 Ga0265338_10015932 Ga0265338_100159323 353
85 3300028800 Ga0265338_10036401 Ga0265338_100364014 353
86 3300029957 Ga0265324_10037519 Ga0265324_100375192 353
87 3300031235 Ga0265330_10000005 Ga0265330_1000000592 353
88 3300031235 Ga0265330_10001807 Ga0265330_100018073 353
89 3300031238 Ga0265332_10000041 Ga0265332_1000004198 353
90 3300031241 Ga0265325_10011791 Ga0265325_100117914 353
91 3300031242 Ga0265329_10002478 Ga0265329_100024785 353
92 3300031247 Ga0265340_10010296 Ga0265340_100102963 353
93 3300031250 Ga0265331_10009360 Ga0265331_100093602 353
94 3300031344 Ga0265316_10001667 Ga0265316_100016671 353
95 3300031711 Ga0265314_10000005 Ga0265314_10000005197 353
96 3300031711 Ga0265314_10000008 Ga0265314_10000008207 353
97 3300031712 Ga0265342_10000005 Ga0265342_10000005158 353
98 3300031712 Ga0265342_10004246 Ga0265342_100042467 353
99 3300035170 Ga0373943_0089470 Ga0373943_0089470_188_1252 353
100 3300035691 Ga0373931_0102933 Ga0373931_0102933_508_1572 353
101 3300035692 Ga0373935_0006031 Ga0373935_0006031_3336_4400 353
102 3300035725 Ga0373947_0062620 Ga0373947_0062620_357_1421 353
103 3300036712 Ga0316584_0064919 Ga0316584_0064919_1036_2103 353
104 3300037068 Ga0373925_0008833 Ga0373925_0008833_2527_3591 353
105 3300045051 Ga0451576_0079906 Ga0451576_0079906_665_1729 353
106 3300046664 Ga0495659_0017065 Ga0495659_0017065_984_2069 353
107 3300049576 Ga0501040_0006464 Ga0501040_0006464_3305_4369 353
108 3300049583 Ga0501067_0172242 Ga0501067_0172242_60_1133 353
109 3300049591 Ga0501075_0141319 Ga0501075_0141319_17_1081 353
110 3300049743 Ga0501081_0008303 Ga0501081_0008303_4673_5737 353
111 3300050514 nmdc:mga08x19_21374_c1 nmdc:mga08x19_21374_c1_2578_3645 353
112 3300059424 Ga0590075_009303 Ga0590075_009303_571_1650 353
113 3300005434 Ga0070709_10000676 Ga0070709_1000067615 354
114 3300005436 Ga0070713_100001620 Ga0070713_1000016202 354
115 3300005471 Ga0070698_100026832 Ga0070698_1000268325 354
116 3300005549 Ga0070704_100001151 Ga0070704_10000115113 354
117 3300006871 Ga0075434_100170817 Ga0075434_1001708172 354
118 3300009147 Ga0114129_10014859 Ga0114129_100148592 354
119 3300009545 Ga0105237_10110126 Ga0105237_101101262 354
120 3300010375 Ga0105239_10008971 Ga0105239_100089712 354
121 3300025903 Ga0207680_10134031 Ga0207680_101340312 354
122 3300025906 Ga0207699_10000024 Ga0207699_100000248 354
123 3300025928 Ga0207700_10004712 Ga0207700_100047128 354
124 3300025929 Ga0207664_10122830 Ga0207664_101228302 354
125 3300050507 nmdc:mga05p37_254252_c1 nmdc:mga05p37_254252_c1_467_1543 354
126 3300050507 nmdc:mga05p37_2819_c1 nmdc:mga05p37_2819_c1_5789_6862 354
127 3300005331 Ga0070670_100173502 Ga0070670_1001735022 355
128 3300005618 Ga0068864_100167595 Ga0068864_1001675952 355
129 3300025893 Ga0207682_10051532 Ga0207682_100515322 355
130 3300025940 Ga0207691_10022583 Ga0207691_100225834 355
131 3300026089 Ga0207648_10221117 Ga0207648_102211172 355
132 3300005338 Ga0068868_100196358 Ga0068868_1001963582 356
133 3300005367 Ga0070667_100185879 Ga0070667_1001858791 356
134 3300005440 Ga0070705_100003270 Ga0070705_1000032702 356
135 3300005440 Ga0070705_100035526 Ga0070705_1000355261 356
136 3300005444 Ga0070694_100064303 Ga0070694_1000643032 356
137 3300005518 Ga0070699_100092148 Ga0070699_1000921483 356
138 3300005536 Ga0070697_100096034 Ga0070697_1000960342 356
139 3300005539 Ga0068853_100141463 Ga0068853_1001414632 356
140 3300005547 Ga0070693_100002427 Ga0070693_1000024274 356
141 3300005549 Ga0070704_100006295 Ga0070704_1000062954 356
142 3300005563 Ga0068855_100077388 Ga0068855_1000773882 356
143 3300005718 Ga0068866_10004628 Ga0068866_100046285 356
144 3300005843 Ga0068860_100006456 Ga0068860_1000064567 356
145 3300005844 Ga0068862_100235757 Ga0068862_1002357572 356
146 3300006028 Ga0070717_10254919 Ga0070717_102549192 356
147 3300006173 Ga0070716_100010732 Ga0070716_1000107324 356
148 3300006175 Ga0070712_100112196 Ga0070712_1001121962 356
149 3300006881 Ga0068865_100033969 Ga0068865_1000339693 356
150 3300009093 Ga0105240_10457928 Ga0105240_104579282 356
151 3300009094 Ga0111539_10035355 Ga0111539_100353554 356
152 3300009101 Ga0105247_10024012 Ga0105247_100240122 356
153 3300009176 Ga0105242_10070088 Ga0105242_100700882 356
154 3300009177 Ga0105248_10023119 Ga0105248_100231192 356
155 3300009553 Ga0105249_10029917 Ga0105249_100299174 356
156 3300010375 Ga0105239_10039240 Ga0105239_100392403 356
157 3300010375 Ga0105239_10045220 Ga0105239_100452203 356
158 3300013297 Ga0157378_10000620 Ga0157378_1000062013 356
159 3300013297 Ga0157378_10184959 Ga0157378_101849591 356
160 3300013306 Ga0163162_10012393 Ga0163162_100123936 356
161 3300013306 Ga0163162_10039172 Ga0163162_100391722 356
162 3300013308 Ga0157375_10101033 Ga0157375_101010333 356
163 3300025904 Ga0207647_10096867 Ga0207647_100968672 356
164 3300025905 Ga0207685_10078991 Ga0207685_100789912 356
165 3300025915 Ga0207693_10011915 Ga0207693_100119154 356
166 3300025922 Ga0207646_10120944 Ga0207646_101209443 356
167 3300025939 Ga0207665_10027247 Ga0207665_100272472 356
168 3300025941 Ga0207711_10042412 Ga0207711_100424124 356
169 3300025941 Ga0207711_10046677 Ga0207711_100466772 356
170 3300025942 Ga0207689_10072117 Ga0207689_100721173 356
171 3300025986 Ga0207658_10183318 Ga0207658_101833181 356
172 3300026023 Ga0207677_10060463 Ga0207677_100604632 356
173 3300026041 Ga0207639_10123937 Ga0207639_101239372 356
174 3300028381 Ga0268264_10016812 Ga0268264_100168123 356
175 3300039437 Ga0436365_1872027 Ga0436365_1872027_2616_3692 356
176 3300048905 Ga0496102_0004753 Ga0496102_0004753_5026_6102 356
177 3300048906 Ga0496103_0010848 Ga0496103_0010848_1094_2170 356
178 3300048907 Ga0496104_0325592 Ga0496104_0325592_203_1279 356
179 3300048909 Ga0496106_0052433 Ga0496106_0052433_1373_2449 356
180 3300048909 Ga0496106_0068802 Ga0496106_0068802_1469_2545 356
181 3300009545 Ga0105237_10030217 Ga0105237_100302172 357
182 3300028800 Ga0265338_10000900 Ga0265338_1000090018 357
183 3300049669 Ga0501235_022428 Ga0501235_022428_286_1386 357
184 3300000549 LJQas_1000187 LJQas_10001874 358
185 3300005289 Ga0065704_10099405 Ga0065704_100994052 358
186 3300005289 Ga0065704_10180138 Ga0065704_101801381 358
187 3300005290 Ga0065712_10185473 Ga0065712_101854731 358
188 3300005293 Ga0065715_10103257 Ga0065715_101032572 358
189 3300005327 Ga0070658_10001907 Ga0070658_100019074 358
190 3300005330 Ga0070690_100003749 Ga0070690_1000037492 358
191 3300005331 Ga0070670_100033249 Ga0070670_1000332492 358
192 3300005331 Ga0070670_100154103 Ga0070670_1001541032 358
193 3300005334 Ga0068869_100034323 Ga0068869_1000343232 358
194 3300005354 Ga0070675_100059005 Ga0070675_1000590052 358
195 3300005354 Ga0070675_100155567 Ga0070675_1001555672 358
196 3300005355 Ga0070671_100009699 Ga0070671_1000096998 358
197 3300005356 Ga0070674_100055214 Ga0070674_1000552142 358
198 3300005365 Ga0070688_100001873 Ga0070688_1000018733 358
199 3300005367 Ga0070667_100032859 Ga0070667_1000328593 358
200 3300005459 Ga0068867_100268776 Ga0068867_1002687761 358
201 3300005467 Ga0070706_100012603 Ga0070706_1000126034 358
202 3300005616 Ga0068852_100129075 Ga0068852_1001290752 358
203 3300005616 Ga0068852_100202376 Ga0068852_1002023762 358
204 3300005617 Ga0068859_100016204 Ga0068859_1000162043 358
205 3300005617 Ga0068859_100039200 Ga0068859_1000392003 358
206 3300005617 Ga0068859_100174815 Ga0068859_1001748152 358
207 3300005618 Ga0068864_100007581 Ga0068864_1000075812 358
208 3300005618 Ga0068864_100085045 Ga0068864_1000850453 358
209 3300005718 Ga0068866_10131672 Ga0068866_101316722 358
210 3300005719 Ga0068861_100417809 Ga0068861_1004178091 358
211 3300005834 Ga0068851_10047588 Ga0068851_100475882 358
212 3300005841 Ga0068863_100024860 Ga0068863_1000248602 358
213 3300005841 Ga0068863_100094214 Ga0068863_1000942143 358
214 3300005841 Ga0068863_100112518 Ga0068863_1001125182 358
215 3300005843 Ga0068860_100016635 Ga0068860_1000166353 358
216 3300005843 Ga0068860_100021084 Ga0068860_1000210845 358
217 3300005844 Ga0068862_100021124 Ga0068862_1000211243 358
218 3300005844 Ga0068862_100037265 Ga0068862_1000372653 358
219 3300005844 Ga0068862_100106722 Ga0068862_1001067222 358
220 3300005985 Ga0081539_10000533 Ga0081539_1000053334 358
221 3300005985 Ga0081539_10000749 Ga0081539_1000074954 358
222 3300006358 Ga0068871_100095502 Ga0068871_1000955022 358
223 3300006358 Ga0068871_100116173 Ga0068871_1001161732 358
224 3300006931 Ga0097620_100016203 Ga0097620_1000162033 358
225 3300006931 Ga0097620_100039200 Ga0097620_1000392003 358
226 3300006931 Ga0097620_100174816 Ga0097620_1001748162 358
227 3300009176 Ga0105242_10027871 Ga0105242_100278713 358
228 3300009177 Ga0105248_10017698 Ga0105248_100176985 358
229 3300009177 Ga0105248_10056994 Ga0105248_100569943 358
230 3300009177 Ga0105248_10189463 Ga0105248_101894632 358
231 3300009177 Ga0105248_10402064 Ga0105248_104020641 358
232 3300009553 Ga0105249_10014207 Ga0105249_100142074 358
233 3300009553 Ga0105249_10015300 Ga0105249_100153004 358
234 3300009553 Ga0105249_10029199 Ga0105249_100291992 358
235 3300013297 Ga0157378_10002849 Ga0157378_100028499 358
236 3300013306 Ga0163162_10059719 Ga0163162_100597192 358
237 3300013306 Ga0163162_10234044 Ga0163162_102340442 358
238 3300013307 Ga0157372_10243545 Ga0157372_102435452 358
239 3300013308 Ga0157375_10017212 Ga0157375_100172122 358
240 3300013308 Ga0157375_10025022 Ga0157375_100250223 358
241 3300013308 Ga0157375_10115128 Ga0157375_101151281 358
242 3300014326 Ga0157380_10004657 Ga0157380_100046577 358
243 3300014968 Ga0157379_10007580 Ga0157379_100075805 358
244 3300017792 Ga0163161_10087405 Ga0163161_100874052 358
245 3300021384 Ga0213876_10000507 Ga0213876_100005077 358
246 3300021384 Ga0213876_10038813 Ga0213876_100388132 358
247 3300025910 Ga0207684_10029161 Ga0207684_100291615 358
248 3300025914 Ga0207671_10017454 Ga0207671_100174543 358
249 3300025925 Ga0207650_10019373 Ga0207650_100193732 358
250 3300025925 Ga0207650_10150114 Ga0207650_101501141 358
251 3300025931 Ga0207644_10221248 Ga0207644_102212482 358
252 3300025936 Ga0207670_10005023 Ga0207670_100050238 358
253 3300025936 Ga0207670_10035993 Ga0207670_100359931 358
254 3300025941 Ga0207711_10010238 Ga0207711_100102389 358
255 3300025941 Ga0207711_10044088 Ga0207711_100440882 358
256 3300025941 Ga0207711_10192021 Ga0207711_101920212 358
257 3300025942 Ga0207689_10153686 Ga0207689_101536861 358
258 3300025961 Ga0207712_10008480 Ga0207712_100084802 358
259 3300025961 Ga0207712_10022227 Ga0207712_100222273 358
260 3300025961 Ga0207712_10207657 Ga0207712_102076571 358
261 3300025986 Ga0207658_10006381 Ga0207658_100063812 358
262 3300025986 Ga0207658_10072593 Ga0207658_100725933 358
263 3300026023 Ga0207677_10237846 Ga0207677_102378462 358
264 3300026035 Ga0207703_10004686 Ga0207703_100046862 358
265 3300026067 Ga0207678_10120045 Ga0207678_101200452 358
266 3300026088 Ga0207641_10002083 Ga0207641_100020838 358
267 3300026088 Ga0207641_10064584 Ga0207641_100645842 358
268 3300026095 Ga0207676_10001676 Ga0207676_100016769 358
269 3300026095 Ga0207676_10066854 Ga0207676_100668542 358
270 3300028380 Ga0268265_10007369 Ga0268265_100073694 358
271 3300028380 Ga0268265_10037476 Ga0268265_100374762 358
272 3300028381 Ga0268264_10001959 Ga0268264_100019593 358
273 3300028381 Ga0268264_10240313 Ga0268264_102403132 358
274 3300031456 Ga0307513_10001585 Ga0307513_1000158524 358
275 3300031824 Ga0307413_10003032 Ga0307413_100030323 358
276 3300031824 Ga0307413_10157775 Ga0307413_101577752 358
277 3300031824 Ga0307413_10159322 Ga0307413_101593221 358
278 3300031852 Ga0307410_10001391 Ga0307410_100013912 358
279 3300031901 Ga0307406_10004787 Ga0307406_100047876 358
280 3300031903 Ga0307407_10001554 Ga0307407_100015542 358
281 3300031903 Ga0307407_10201245 Ga0307407_102012451 358
282 3300031911 Ga0307412_10009679 Ga0307412_100096794 358
283 3300031995 Ga0307409_100065107 Ga0307409_1000651073 358
284 3300031995 Ga0307409_100257754 Ga0307409_1002577542 358
285 3300032126 Ga0307415_100031615 Ga0307415_1000316153 358
286 3300037466 Ga0395898_0080394 Ga0395898_0080394_880_1977 358
287 3300037471 Ga0395905_0006359 Ga0395905_0006359_9028_10125 358
288 3300037471 Ga0395905_0283727 Ga0395905_0283727_345_1442 358
289 3300039437 Ga0436365_0069585 Ga0436365_0069585_860_1957 358
290 3300039437 Ga0436365_0378929 Ga0436365_0378929_8406_9503 358
291 3300039437 Ga0436365_0731184 Ga0436365_0731184_6706_7956 358
292 3300045976 Ga0466967_0323937 Ga0466967_0323937_274_1350 358
293 3300046537 Ga0495598_0009903 Ga0495598_0009903_97_1173 358
294 3300048917 Ga0496114_0044540 Ga0496114_0044540_2562_3638 358
295 3300049584 Ga0501068_0101504 Ga0501068_0101504_595_1680 358
296 3300049588 Ga0501072_0001756 Ga0501072_0001756_14624_15700 358
297 3300049590 Ga0501074_0013669 Ga0501074_0013669_483_1568 358
298 3300049590 Ga0501074_0248422 Ga0501074_0248422_35_1111 358
299 3300049742 Ga0501080_0017388 Ga0501080_0017388_3942_5027 358
300 3300053142 Ga0500577_0000211 Ga0500577_0000211_11282_12358 358
301 3300053153 Ga0500616_0003002 Ga0500616_0003002_4284_5381 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01791

DeoC

DeoC/LacD family aldolase

72

319

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qjg-assembly2.cif.gz_I m. jannaschii adh synthase complexed with f1,6p 0.911 43 346
2qjg-assembly1.cif.gz_C m. jannaschii adh synthase complexed with f1,6p 0.901 44 350
2qjg-assembly2.cif.gz_T m. jannaschii adh synthase complexed with f1,6p 0.9005 43 351
2qjg-assembly1.cif.gz_K m. jannaschii adh synthase complexed with f1,6p 0.899 43 346
2qji-assembly2.cif.gz_T m. jannaschii adh synthase complexed with dihydroxyacetone phosphate and glycerol 0.8983 43 351
ID Description Score Start End Superfamily
af_P0A991_40_348_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9913 47 356 3.20.20.70
af_P0A991_40_348_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9786 47 356 3.20.20.70
2qjgK00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.899 43 346 3.20.20.70
1ok6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8419 56 350 3.20.20.70
2qjgK00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8314 43 346 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6D0IF93-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9929 156 358 GO:0004332
AF-P0A992-F1-model_v4 Fructose-bisphosphate aldolase class 1 (EC 4.1.2.13) (Fructose-bisphosphate aldolase class I) (FBP aldolase) 0.9926 8 358 GO:0004332
GO:0005737
GO:0006096
AF-A0A6H0K889-F1-model_v4 deleted 0.9926 8 358
AF-S3JRH4-F1-model_v4 fructose-bisphosphate aldolase (EC 4.1.2.13) 0.9925 8 358 GO:0004332
AF-A0A828AJA0-F1-model_v4 deleted 0.9922 26 358

Feature Viewer

pLDDT pTM Quality
92.49 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map