F396019

General Info

Members Datasets Scaffolds Average Seq Length
301 210 602 219

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0074389|Ga0373944_0074389_21_788
Length 255
Sequence MFRVSTGTRKKQAGEAGGFCTAAPMRRRANPAQGGSTMSLRINDEAPNFTAETTQGKLNLHDWIGNGWAVLFSHPKDFTPVCTTELGYMAGLMPEFEKRNTKIIGLSVDPVGDHTRWSKDIEETQGHRVTYPLIGDPELKVAKLYDMLPAEAGDTSAGRTPANNATVRSVFVIGPDKKIKTMLTYPMTTGRNFDEVLRILDSVQLTAKHPVATPVNWKPGGDVIIAGSVSDEEAQKRYPGFRAPKPYLRYTAQPR

Samples

Sample ID Description Type Environment
1 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
81 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 4.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 96.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373944_0074389 3300035089 Bacteria 1112
2 LJNas_1006739 3300000546 Bacteria 1245
3 Ga0058863_11725926 3300004799 Bacteria 700
4 Ga0070658_10006638 3300005327 Bacteria 9373
5 Ga0070683_100000001 3300005329 Bacteria 529385
6 Ga0068869_100039621 3300005334 Bacteria 3365
7 Ga0070666_10071080 3300005335 Bacteria 2368
8 Ga0070680_100283017 3300005336 Bacteria 1405
9 Ga0068868_100727701 3300005338 Bacteria 890
10 Ga0070660_100009054 3300005339 Bacteria 6986
11 Ga0070689_100230220 3300005340 Bacteria 1523
12 Ga0070675_100003759 3300005354 Bacteria 11527
13 Ga0070673_100145502 3300005364 Bacteria 2003
14 Ga0070673_100485489 3300005364 Bacteria 1116
15 Ga0070659_100016387 3300005366 Bacteria 5564
16 Ga0070659_100311784 3300005366 Bacteria 1314
17 Ga0070709_10089344 3300005434 Bacteria 2028
18 Ga0070714_100110330 3300005435 Bacteria 2435
19 Ga0070714_100171495 3300005435 Bacteria 1969
20 Ga0070714_100398307 3300005435 Bacteria 1301
21 Ga0070713_100087695 3300005436 Bacteria 2670
22 Ga0070713_100143395 3300005436 Bacteria 2118
23 Ga0070713_100186607 3300005436 Bacteria 1866
24 Ga0070710_10221998 3300005437 Bacteria 1203
25 Ga0070711_100034153 3300005439 Bacteria 3391
26 Ga0070711_100913939 3300005439 Bacteria 749
27 Ga0070700_100103166 3300005441 Bacteria 1883
28 Ga0070694_100008753 3300005444 Bacteria 6201
29 Ga0070708_100000068 3300005445 Bacteria 68300
30 Ga0070708_100030487 3300005445 Bacteria 4661
31 Ga0070663_100124533 3300005455 Bacteria 1951
32 Ga0070681_10003585 3300005458 Bacteria 14558
33 Ga0070681_10041672 3300005458 Bacteria 4602
34 Ga0070681_10201746 3300005458 Bacteria 1907
35 Ga0070681_10571779 3300005458 Bacteria 1044
36 Ga0070706_100002578 3300005467 Bacteria 18213
37 Ga0070706_100064902 3300005467 Bacteria 3375
38 Ga0070706_100198649 3300005467 Bacteria 1873
39 Ga0070707_100000319 3300005468 Bacteria 47285
40 Ga0070707_100019993 3300005468 Bacteria 6312
41 Ga0070698_100000255 3300005471 Bacteria 53335
42 Ga0070698_100004510 3300005471 Bacteria 15307
43 Ga0070698_100024956 3300005471 Bacteria 6231
44 Ga0070698_100025950 3300005471 Bacteria 6104
45 Ga0070699_100001387 3300005518 Bacteria 22279
46 Ga0070679_100321432 3300005530 Bacteria 1497
47 Ga0070679_100502441 3300005530 Bacteria 1156
48 Ga0070684_100000006 3300005535 Bacteria 227715
49 Ga0070697_100002296 3300005536 Bacteria 14683
50 Ga0070697_100165979 3300005536 Bacteria 1867
51 Ga0070697_100490409 3300005536 Bacteria 1074
52 Ga0070697_101081565 3300005536 Bacteria 714
53 Ga0068853_100000105 3300005539 Bacteria 56438
54 Ga0070672_100171470 3300005543 Bacteria 1805
55 Ga0070686_100040735 3300005544 Bacteria 2899
56 Ga0070665_100093590 3300005548 Bacteria 3010
57 Ga0068855_100021374 3300005563 Bacteria 7760
58 Ga0068855_100092152 3300005563 Bacteria 3495
59 Ga0068855_100286822 3300005563 Bacteria 1826
60 Ga0070664_100089249 3300005564 Bacteria 2667
61 Ga0068854_100000022 3300005578 Bacteria 127908
62 Ga0068856_100047530 3300005614 Bacteria 4227
63 Ga0068856_100199980 3300005614 Bacteria 2013
64 Ga0068856_100778507 3300005614 Bacteria 977
65 Ga0068863_100000571 3300005841 Bacteria 37496
66 Ga0068863_100003423 3300005841 Bacteria 15638
67 Ga0068858_100000862 3300005842 Bacteria 31408
68 Ga0068858_100250513 3300005842 Bacteria 1682
69 Ga0068860_100095431 3300005843 Bacteria 2835
70 Ga0070717_10270042 3300006028 Bacteria 1506
71 Ga0070716_100100506 3300006173 Bacteria 1772
72 Ga0070712_100044736 3300006175 Bacteria 3054
73 Ga0070712_100121721 3300006175 Bacteria 1964
74 Ga0097621_100011302 3300006237 Bacteria 6572
75 Ga0068871_100346425 3300006358 Bacteria 1313
76 Ga0075428_100087680 3300006844 Bacteria 3395
77 Ga0075431_100744111 3300006847 Bacteria 956
78 Ga0075433_10001006 3300006852 Bacteria 20056
79 Ga0075434_100000206 3300006871 Bacteria 40043
80 Ga0075434_100101261 3300006871 Bacteria 2887
81 Ga0075434_100227743 3300006871 Bacteria 1883
82 Ga0075436_100022339 3300006914 Bacteria 4345
83 Ga0075435_100010935 3300007076 Bacteria 6650
84 Ga0075435_100026568 3300007076 Bacteria 4519
85 Ga0099795_10101529 3300007788 Bacteria 1129
86 Ga0105250_10025289 3300009092 Bacteria 2393
87 Ga0105240_10011542 3300009093 Bacteria 12297
88 Ga0105240_10053440 3300009093 Bacteria 5070
89 Ga0105240_10219566 3300009093 Bacteria 2215
90 Ga0105240_10465321 3300009093 Bacteria 1412
91 Ga0111539_10469312 3300009094 Bacteria 1465
92 Ga0111539_10499738 3300009094 Bacteria 1416
93 Ga0105247_10000970 3300009101 Bacteria 21642
94 Ga0114129_10000398 3300009147 Bacteria 50789
95 Ga0105242_10157635 3300009176 Bacteria 1984
96 Ga0105248_10049633 3300009177 Bacteria 4707
97 Ga0105248_10262899 3300009177 Bacteria 1942
98 Ga0105237_10165549 3300009545 Bacteria 2210
99 Ga0105238_10133860 3300009551 Bacteria 2457
100 Ga0105249_10546211 3300009553 Bacteria 1209
101 Ga0099796_10006992 3300010159 Bacteria 2923
102 Ga0099796_10092142 3300010159 Bacteria 1128
103 Ga0157370_10034311 3300013104 Bacteria 4942
104 Ga0157370_10071417 3300013104 Bacteria 3275
105 Ga0157369_10062225 3300013105 Bacteria 4022
106 Ga0157369_10287843 3300013105 Bacteria 1711
107 Ga0157374_10075351 3300013296 Bacteria 3188
108 Ga0157374_10096020 3300013296 Bacteria 2835
109 Ga0157374_10646424 3300013296 Bacteria 1069
110 Ga0157378_10056666 3300013297 Bacteria 3492
111 Ga0157378_10066672 3300013297 Bacteria 3224
112 Ga0163162_10304083 3300013306 Bacteria 1727
113 Ga0157372_10100521 3300013307 Bacteria 3300
114 Ga0157375_10799966 3300013308 Bacteria 1092
115 Ga0157380_10174378 3300014326 Bacteria 1882
116 Ga0157377_10025326 3300014745 Bacteria 3163
117 Ga0157379_10077595 3300014968 Bacteria 2974
118 Ga0157376_10142277 3300014969 Bacteria 2153
119 Ga0157376_10178898 3300014969 Bacteria 1937
120 Ga0182007_10133318 3300015262 Bacteria 837
121 Ga0197907_10456435 3300020069 Bacteria 1215
122 Ga0206356_11109720 3300020070 Bacteria 1320
123 Ga0206355_1311596 3300020076 Bacteria 1503
124 Ga0206352_10594573 3300020078 Bacteria 862
125 Ga0206350_11137683 3300020080 Bacteria 926
126 Ga0206350_11151789 3300020080 Bacteria 826
127 Ga0206354_11426302 3300020081 Bacteria 926
128 Ga0154015_1182721 3300020610 Bacteria 849
129 Ga0213873_10019473 3300021358 Bacteria 1575
130 Ga0213873_10053945 3300021358 Bacteria 1072
131 Ga0224712_10023508 3300022467 Bacteria 2141
132 Ga0224712_10186194 3300022467 Bacteria 938
133 Ga0207692_10159592 3300025898 Bacteria 1298
134 Ga0207642_10020816 3300025899 Bacteria 2570
135 Ga0207710_10002089 3300025900 Bacteria 9454
136 Ga0207688_10041713 3300025901 Bacteria 2554
137 Ga0207680_10210955 3300025903 Bacteria 1328
138 Ga0207705_10111085 3300025909 Bacteria 2025
139 Ga0207684_10000081 3300025910 Bacteria 178619
140 Ga0207707_10010321 3300025912 Bacteria 8103
141 Ga0207707_10011132 3300025912 Bacteria 7823
142 Ga0207695_10007745 3300025913 Bacteria 13607
143 Ga0207695_10054480 3300025913 Bacteria 4176
144 Ga0207695_10073834 3300025913 Bacteria 3474
145 Ga0207693_10039556 3300025915 Bacteria 3714
146 Ga0207693_10055963 3300025915 Bacteria 3093
147 Ga0207693_10257577 3300025915 Bacteria 1368
148 Ga0207663_10098595 3300025916 Bacteria 1957
149 Ga0207660_10223849 3300025917 Bacteria 1477
150 Ga0207660_10327930 3300025917 Bacteria 1223
151 Ga0207662_10167175 3300025918 Bacteria 1409
152 Ga0207662_10592172 3300025918 Bacteria 771
153 Ga0207657_10021819 3300025919 Bacteria 6016
154 Ga0207652_10016813 3300025921 Bacteria 5978
155 Ga0207646_10000591 3300025922 Bacteria 47189
156 Ga0207646_10012265 3300025922 Bacteria 8244
157 Ga0207694_10003660 3300025924 Bacteria 12167
158 Ga0207694_10385240 3300025924 Bacteria 1164
159 Ga0207659_10023997 3300025926 Bacteria 4080
160 Ga0207687_10132501 3300025927 Bacteria 1881
161 Ga0207700_10015272 3300025928 Bacteria 5058
162 Ga0207700_10222382 3300025928 Bacteria 1601
163 Ga0207700_10228822 3300025928 Bacteria 1580
164 Ga0207700_10761678 3300025928 Bacteria 865
165 Ga0207664_10041568 3300025929 Bacteria 3582
166 Ga0207664_10120307 3300025929 Bacteria 2196
167 Ga0207644_10961443 3300025931 Bacteria 716
168 Ga0207690_10020295 3300025932 Bacteria 4104
169 Ga0207670_10518313 3300025936 Bacteria 970
170 Ga0207669_10238643 3300025937 Bacteria 1346
171 Ga0207665_10136839 3300025939 Bacteria 1744
172 Ga0207711_10041793 3300025941 Bacteria 3905
173 Ga0207689_10052984 3300025942 Bacteria 3342
174 Ga0207661_10000005 3300025944 Bacteria 557888
175 Ga0207679_10445735 3300025945 Bacteria 1147
176 Ga0207667_10074288 3300025949 Bacteria 3532
177 Ga0207667_10520194 3300025949 Bacteria 1205
178 Ga0207651_10113742 3300025960 Bacteria 2037
179 Ga0207651_10448156 3300025960 Bacteria 1107
180 Ga0207712_10064193 3300025961 Bacteria 2617
181 Ga0207640_10000030 3300025981 Bacteria 127918
182 Ga0207677_10405837 3300026023 Bacteria 1157
183 Ga0207703_10004030 3300026035 Bacteria 12147
184 Ga0207639_10000363 3300026041 Bacteria 31350
185 Ga0207639_10089556 3300026041 Bacteria 2459
186 Ga0207708_10646588 3300026075 Bacteria 900
187 Ga0207702_10229900 3300026078 Bacteria 1733
188 Ga0207702_10270500 3300026078 Bacteria 1603
189 Ga0207702_10929382 3300026078 Bacteria 862
190 Ga0207641_10000812 3300026088 Bacteria 33288
191 Ga0207641_10163323 3300026088 Bacteria 2026
192 Ga0207674_10819234 3300026116 Bacteria 898
193 Ga0209179_1036713 3300027512 Bacteria 1022
194 Ga0209999_1031327 3300027543 Bacteria 987
195 Ga0209982_1006765 3300027552 Bacteria 1671
196 Ga0268266_10051671 3300028379 Bacteria 3528
197 Ga0268265_10689708 3300028380 Bacteria 986
198 Ga0268264_10008023 3300028381 Bacteria 8779
199 Ga0268264_10067865 3300028381 Bacteria 3011
200 Ga0268264_10327263 3300028381 Bacteria 1451
201 Ga0265338_10022550 3300028800 Bacteria 6512
202 Ga0265338_10393789 3300028800 Bacteria 988
203 Ga0265760_10034379 3300031090 Bacteria 1499
204 Ga0265332_10162212 3300031238 Bacteria 934
205 Ga0265325_10162512 3300031241 Bacteria 1050
206 Ga0265339_10000653 3300031249 Bacteria 26815
207 Ga0265339_10009405 3300031249 Bacteria 6145
208 Ga0265316_10002226 3300031344 Bacteria 20351
209 Ga0265314_10001261 3300031711 Bacteria 28854
210 Ga0373926_0030657 3300035083 Bacteria 1894
211 Ga0373928_0089363 3300035084 Bacteria 789
212 Ga0373936_0173449 3300035113 Bacteria 944
213 Ga0373953_0068471 3300035117 Bacteria 1461
214 Ga0373954_0000025 3300035118 Bacteria 57365
215 Ga0373931_0046924 3300035691 Bacteria 2285
216 Ga0373935_0067941 3300035692 Bacteria 2293
217 Ga0373935_0710373 3300035692 Bacteria 739
218 Ga0373927_0097514 3300035695 Bacteria 1911
219 Ga0373933_0149985 3300035724 Bacteria 1476
220 Ga0373947_0037531 3300035725 Bacteria 2875
221 Ga0373947_0540440 3300035725 Bacteria 793
222 Ga0373937_0001823 3300036401 Bacteria 17875
223 Ga0373937_0275544 3300036401 Bacteria 1588
224 Ga0373937_0303686 3300036401 Bacteria 1509
225 Ga0373925_0067394 3300037068 Bacteria 2699
226 Ga0373925_0069329 3300037068 Bacteria 2663
227 Ga0373925_0599218 3300037068 Bacteria 907
228 Ga0395901_0327961 3300038443 Bacteria 1583
229 Ga0436365_0432212 3300039437 Bacteria 1293
230 Ga0436361_0793823 3300039447 Bacteria 2280
231 Ga0436363_0029113 3300039450 Bacteria 1218
232 Ga0436362_0416739 3300039453 Bacteria 4120
233 Ga0436362_1014264 3300039453 Bacteria 2896
234 Ga0466969_0013199 3300044656 Bacteria 4352
235 Ga0466972_0033145 3300044658 Bacteria 2534
236 Ga0466966_0009428 3300044684 Bacteria 6465
237 Ga0466961_0026909 3300044693 Bacteria 3698
238 Ga0466963_0005734 3300044694 Bacteria 7303
239 Ga0466964_0003648 3300044706 Bacteria 5627
240 Ga0466971_0000160 3300044719 Bacteria 25173
241 Ga0466970_0000837 3300044765 Bacteria 14804
242 Ga0466957_0097690 3300044842 Bacteria 1847
243 Ga0466959_0002175 3300045049 Bacteria 12469
244 Ga0466959_0019575 3300045049 Bacteria 4978
245 Ga0495641_0056159 3300046461 Bacteria 1785
246 Ga0495651_0122215 3300046462 Bacteria 1911
247 Ga0495580_0000638 3300046472 Bacteria 29751
248 Ga0495580_0053066 3300046472 Bacteria 2862
249 Ga0495582_0001345 3300046473 Bacteria 13807
250 Ga0495582_0020678 3300046473 Bacteria 3603
251 Ga0495630_0532169 3300046517 Bacteria 901
252 Ga0495622_0233864 3300046557 Bacteria 811
253 Ga0495657_0098911 3300046675 Bacteria 1861
254 Ga0495658_0039903 3300046683 Bacteria 2608
255 Ga0496108_0024282 3300048911 Bacteria 4991
256 Ga0496112_0021385 3300048915 Bacteria 6152
257 Ga0496112_0277210 3300048915 Bacteria 1624
258 Ga0496113_0718924 3300048916 Bacteria 796
259 Ga0496115_0330795 3300048918 Bacteria 1245
260 Ga0496121_0005496 3300048924 Bacteria 16226
261 Ga0496124_0023594 3300048927 Bacteria 5613
262 Ga0496125_0006536 3300048928 Bacteria 12563
263 Ga0496126_0413231 3300048929 Bacteria 1092
264 Ga0501033_0065843 3300049570 Bacteria 2665
265 Ga0501037_0335933 3300049573 Bacteria 1044
266 Ga0501039_0156502 3300049575 Bacteria 1790
267 Ga0501041_0009999 3300049577 Bacteria 5590
268 Ga0501042_0072514 3300049578 Bacteria 2464
269 Ga0501042_0107427 3300049578 Bacteria 2009
270 Ga0501043_0313993 3300049579 Bacteria 1196
271 Ga0501046_0002713 3300049580 Bacteria 16476
272 Ga0501046_0310290 3300049580 Bacteria 1151
273 Ga0501047_0714790 3300049581 Bacteria 819
274 Ga0501048_0094064 3300049582 Bacteria 2114
275 Ga0501048_0162400 3300049582 Bacteria 1581
276 Ga0501067_0055236 3300049583 Bacteria 2201
277 Ga0501068_0098830 3300049584 Bacteria 1808
278 Ga0501071_0084081 3300049587 Bacteria 2332
279 Ga0501071_0091958 3300049587 Bacteria 2229
280 Ga0501072_0073615 3300049588 Bacteria 2700
281 Ga0501076_0068431 3300049592 Bacteria 2836
282 Ga0501077_0019896 3300049593 Bacteria 4247
283 Ga0501201_008023 3300049651 Bacteria 1015
284 Ga0501079_0537208 3300049741 Bacteria 919
285 Ga0501045_0013254 3300049824 Bacteria 5818
286 Ga0501045_0077155 3300049824 Bacteria 2455
287 nmdc:mga05p37_377_c1 3300050507 Bacteria 48005
288 nmdc:mga08y16_389692_c1 3300050511 Bacteria 1427
289 nmdc:mga08y16_617830_c1 3300050511 Bacteria 1091
290 nmdc:mga0n895_1948_c1 3300050512 Bacteria 15852
291 nmdc:mga0n895_224084_c1 3300050512 Bacteria 1908
292 nmdc:mga0n895_45083_c1 3300050512 Bacteria 4302
293 nmdc:mga0n895_516265_c1 3300050512 Bacteria 1203
294 nmdc:mga0rr50_2277_c1 3300050513 Bacteria 10765
295 nmdc:mga0rr50_6079_c1 3300050513 Bacteria 7296
296 nmdc:mga08x19_105395_c1 3300050514 Bacteria 1875
297 nmdc:mga08x19_194471_c1 3300050514 Bacteria 1389
298 nmdc:mga0a205_76164_c1 3300050515 Bacteria 3242
299 Ga0587094_023998 3300059513 Bacteria 906
300 Ga0501082_0005715 3300060353 Bacteria 10788
301 Ga0466962_0004576 3300061719 Bacteria 6640
302 Ga0373944_0074389
303 LJNas_1006739
304 Ga0058863_11725926
305 Ga0070658_10006638
306 Ga0070683_100000001
307 Ga0068869_100039621
308 Ga0070666_10071080
309 Ga0070680_100283017
310 Ga0068868_100727701
311 Ga0070660_100009054
312 Ga0070689_100230220
313 Ga0070675_100003759
314 Ga0070673_100145502
315 Ga0070673_100485489
316 Ga0070659_100016387
317 Ga0070659_100311784
318 Ga0070709_10089344
319 Ga0070714_100110330
320 Ga0070714_100171495
321 Ga0070714_100398307
322 Ga0070713_100087695
323 Ga0070713_100143395
324 Ga0070713_100186607
325 Ga0070710_10221998
326 Ga0070711_100034153
327 Ga0070711_100913939
328 Ga0070700_100103166
329 Ga0070694_100008753
330 Ga0070708_100000068
331 Ga0070708_100030487
332 Ga0070663_100124533
333 Ga0070681_10003585
334 Ga0070681_10041672
335 Ga0070681_10201746
336 Ga0070681_10571779
337 Ga0070706_100002578
338 Ga0070706_100064902
339 Ga0070706_100198649
340 Ga0070707_100000319
341 Ga0070707_100019993
342 Ga0070698_100000255
343 Ga0070698_100004510
344 Ga0070698_100024956
345 Ga0070698_100025950
346 Ga0070699_100001387
347 Ga0070679_100321432
348 Ga0070679_100502441
349 Ga0070684_100000006
350 Ga0070697_100002296
351 Ga0070697_100165979
352 Ga0070697_100490409
353 Ga0070697_101081565
354 Ga0068853_100000105
355 Ga0070672_100171470
356 Ga0070686_100040735
357 Ga0070665_100093590
358 Ga0068855_100021374
359 Ga0068855_100092152
360 Ga0068855_100286822
361 Ga0070664_100089249
362 Ga0068854_100000022
363 Ga0068856_100047530
364 Ga0068856_100199980
365 Ga0068856_100778507
366 Ga0068863_100000571
367 Ga0068863_100003423
368 Ga0068858_100000862
369 Ga0068858_100250513
370 Ga0068860_100095431
371 Ga0070717_10270042
372 Ga0070716_100100506
373 Ga0070712_100044736
374 Ga0070712_100121721
375 Ga0097621_100011302
376 Ga0068871_100346425
377 Ga0075428_100087680
378 Ga0075431_100744111
379 Ga0075433_10001006
380 Ga0075434_100000206
381 Ga0075434_100101261
382 Ga0075434_100227743
383 Ga0075436_100022339
384 Ga0075435_100010935
385 Ga0075435_100026568
386 Ga0099795_10101529
387 Ga0105250_10025289
388 Ga0105240_10011542
389 Ga0105240_10053440
390 Ga0105240_10219566
391 Ga0105240_10465321
392 Ga0111539_10469312
393 Ga0111539_10499738
394 Ga0105247_10000970
395 Ga0114129_10000398
396 Ga0105242_10157635
397 Ga0105248_10049633
398 Ga0105248_10262899
399 Ga0105237_10165549
400 Ga0105238_10133860
401 Ga0105249_10546211
402 Ga0099796_10006992
403 Ga0099796_10092142
404 Ga0157370_10034311
405 Ga0157370_10071417
406 Ga0157369_10062225
407 Ga0157369_10287843
408 Ga0157374_10075351
409 Ga0157374_10096020
410 Ga0157374_10646424
411 Ga0157378_10056666
412 Ga0157378_10066672
413 Ga0163162_10304083
414 Ga0157372_10100521
415 Ga0157375_10799966
416 Ga0157380_10174378
417 Ga0157377_10025326
418 Ga0157379_10077595
419 Ga0157376_10142277
420 Ga0157376_10178898
421 Ga0182007_10133318
422 Ga0197907_10456435
423 Ga0206356_11109720
424 Ga0206355_1311596
425 Ga0206352_10594573
426 Ga0206350_11137683
427 Ga0206350_11151789
428 Ga0206354_11426302
429 Ga0154015_1182721
430 Ga0213873_10019473
431 Ga0213873_10053945
432 Ga0224712_10023508
433 Ga0224712_10186194
434 Ga0207692_10159592
435 Ga0207642_10020816
436 Ga0207710_10002089
437 Ga0207688_10041713
438 Ga0207680_10210955
439 Ga0207705_10111085
440 Ga0207684_10000081
441 Ga0207707_10010321
442 Ga0207707_10011132
443 Ga0207695_10007745
444 Ga0207695_10054480
445 Ga0207695_10073834
446 Ga0207693_10039556
447 Ga0207693_10055963
448 Ga0207693_10257577
449 Ga0207663_10098595
450 Ga0207660_10223849
451 Ga0207660_10327930
452 Ga0207662_10167175
453 Ga0207662_10592172
454 Ga0207657_10021819
455 Ga0207652_10016813
456 Ga0207646_10000591
457 Ga0207646_10012265
458 Ga0207694_10003660
459 Ga0207694_10385240
460 Ga0207659_10023997
461 Ga0207687_10132501
462 Ga0207700_10015272
463 Ga0207700_10222382
464 Ga0207700_10228822
465 Ga0207700_10761678
466 Ga0207664_10041568
467 Ga0207664_10120307
468 Ga0207644_10961443
469 Ga0207690_10020295
470 Ga0207670_10518313
471 Ga0207669_10238643
472 Ga0207665_10136839
473 Ga0207711_10041793
474 Ga0207689_10052984
475 Ga0207661_10000005
476 Ga0207679_10445735
477 Ga0207667_10074288
478 Ga0207667_10520194
479 Ga0207651_10113742
480 Ga0207651_10448156
481 Ga0207712_10064193
482 Ga0207640_10000030
483 Ga0207677_10405837
484 Ga0207703_10004030
485 Ga0207639_10000363
486 Ga0207639_10089556
487 Ga0207708_10646588
488 Ga0207702_10229900
489 Ga0207702_10270500
490 Ga0207702_10929382
491 Ga0207641_10000812
492 Ga0207641_10163323
493 Ga0207674_10819234
494 Ga0209179_1036713
495 Ga0209999_1031327
496 Ga0209982_1006765
497 Ga0268266_10051671
498 Ga0268265_10689708
499 Ga0268264_10008023
500 Ga0268264_10067865
501 Ga0268264_10327263
502 Ga0265338_10022550
503 Ga0265338_10393789
504 Ga0265760_10034379
505 Ga0265332_10162212
506 Ga0265325_10162512
507 Ga0265339_10000653
508 Ga0265339_10009405
509 Ga0265316_10002226
510 Ga0265314_10001261
511 Ga0373926_0030657
512 Ga0373928_0089363
513 Ga0373936_0173449
514 Ga0373953_0068471
515 Ga0373954_0000025
516 Ga0373931_0046924
517 Ga0373935_0067941
518 Ga0373935_0710373
519 Ga0373927_0097514
520 Ga0373933_0149985
521 Ga0373947_0037531
522 Ga0373947_0540440
523 Ga0373937_0001823
524 Ga0373937_0275544
525 Ga0373937_0303686
526 Ga0373925_0067394
527 Ga0373925_0069329
528 Ga0373925_0599218
529 Ga0395901_0327961
530 Ga0436365_0432212
531 Ga0436361_0793823
532 Ga0436363_0029113
533 Ga0436362_0416739
534 Ga0436362_1014264
535 Ga0466969_0013199
536 Ga0466972_0033145
537 Ga0466966_0009428
538 Ga0466961_0026909
539 Ga0466963_0005734
540 Ga0466964_0003648
541 Ga0466971_0000160
542 Ga0466970_0000837
543 Ga0466957_0097690
544 Ga0466959_0002175
545 Ga0466959_0019575
546 Ga0495641_0056159
547 Ga0495651_0122215
548 Ga0495580_0000638
549 Ga0495580_0053066
550 Ga0495582_0001345
551 Ga0495582_0020678
552 Ga0495630_0532169
553 Ga0495622_0233864
554 Ga0495657_0098911
555 Ga0495658_0039903
556 Ga0496108_0024282
557 Ga0496112_0021385
558 Ga0496112_0277210
559 Ga0496113_0718924
560 Ga0496115_0330795
561 Ga0496121_0005496
562 Ga0496124_0023594
563 Ga0496125_0006536
564 Ga0496126_0413231
565 Ga0501033_0065843
566 Ga0501037_0335933
567 Ga0501039_0156502
568 Ga0501041_0009999
569 Ga0501042_0072514
570 Ga0501042_0107427
571 Ga0501043_0313993
572 Ga0501046_0002713
573 Ga0501046_0310290
574 Ga0501047_0714790
575 Ga0501048_0094064
576 Ga0501048_0162400
577 Ga0501067_0055236
578 Ga0501068_0098830
579 Ga0501071_0084081
580 Ga0501071_0091958
581 Ga0501072_0073615
582 Ga0501076_0068431
583 Ga0501077_0019896
584 Ga0501201_008023
585 Ga0501079_0537208
586 Ga0501045_0013254
587 Ga0501045_0077155
588 nmdc:mga05p37_377_c1
589 nmdc:mga08y16_389692_c1
590 nmdc:mga08y16_617830_c1
591 nmdc:mga0n895_1948_c1
592 nmdc:mga0n895_224084_c1
593 nmdc:mga0n895_45083_c1
594 nmdc:mga0n895_516265_c1
595 nmdc:mga0rr50_2277_c1
596 nmdc:mga0rr50_6079_c1
597 nmdc:mga08x19_105395_c1
598 nmdc:mga08x19_194471_c1
599 nmdc:mga0a205_76164_c1
600 Ga0587094_023998
601 Ga0501082_0005715
602 Ga0466962_0004576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

42

182

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

202

240

0.96

PF08534

Redoxin

Redoxin

41

200

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.941 3 216
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9406 3 216
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9361 3 216
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.932 3 216
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.918 3 213
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9733 153 215 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9688 153 213 3.30.1020.10
af_O08709_156_224_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9597 153 215 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9593 7 106 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9442 153 215 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A659YRX5-F1-model_v4 deleted 0.982 1 103
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.982 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A3M6WLM4-F1-model_v4 Thioredoxin domain-containing protein 0.9817 1 112 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-C3KLK5-F1-model_v4 Peroxiredoxin 6 (EC 1.11.1.-) 0.9792 1 216 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A534YD48-F1-model_v4 Peroxiredoxin 0.9758 1 182 GO:0005829
GO:0045454
GO:0051920

Map