F396134

General Info

Members Datasets Scaffolds Average Seq Length
301 133 602 339

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0045342|Ga0496110_0045342_919_2034
Length 371
Sequence LRRKLISWLLQEALVLTPRRVLILASALMLTAVGDIVFAADPPRISKPKPAPPDLAPDVPPLPPATFDNTLAIGGQDVKARALDTRLSVDVHVNGRGPYRFVVDSGADTSAVGLRIAHDLELPLGEPAVLNGMTSRDVVDRVKVAKLTLGPTTVANLEVPALREIDLGGDGLVGIDALVQQRLMMDFEKRLIKVEDARVPIKIEPGEIVIIAHKKRGQLILTEVRAARQHLDAVIDTGSEITIGNLALRDKLVAKNRAKFYEVEAIGVTGVHVKMQIARIDELQLGPVTLRDVPIAFADVPPFKLFGLADEPALLLGTDILETFRRVSLDFRARRVRFQLRTCQTDGVALNTAPTDMFTRISATTMEACRR

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
107 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
108 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
115 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.98
Rhizosphere 95.02
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0045342 3300048913 Bacteria 3843
2 JGI24737J22298_10001897 3300001990 Bacteria 7471
3 JGI24737J22298_10002292 3300001990 Bacteria 6802
4 JGI24737J22298_10040315 3300001990 Bacteria 1434
5 Ga0065712_10105866 3300005290 Bacteria 1930
6 Ga0070658_10019197 3300005327 Bacteria 5476
7 Ga0070658_10020954 3300005327 Bacteria 5236
8 Ga0070658_10043330 3300005327 Bacteria 3635
9 Ga0070658_10089991 3300005327 Bacteria 2528
10 Ga0070658_10231130 3300005327 Bacteria 1566
11 Ga0070676_10004534 3300005328 Bacteria 7316
12 Ga0070670_100003109 3300005331 Bacteria 13741
13 Ga0070670_100086087 3300005331 Bacteria 2700
14 Ga0070670_100086782 3300005331 Bacteria 2689
15 Ga0070670_100094969 3300005331 Bacteria 2564
16 Ga0070670_100132960 3300005331 Bacteria 2149
17 Ga0068869_100042537 3300005334 Bacteria 3257
18 Ga0068869_100053788 3300005334 Unclassified 2928
19 Ga0068869_100084888 3300005334 Bacteria 2371
20 Ga0068868_100069357 3300005338 Bacteria 2809
21 Ga0070660_100024367 3300005339 Bacteria 4487
22 Ga0070660_100080244 3300005339 Bacteria 2560
23 Ga0070660_100082370 3300005339 Bacteria 2526
24 Ga0070660_100108542 3300005339 Bacteria 2206
25 Ga0070661_100004695 3300005344 Bacteria 9409
26 Ga0070661_100039383 3300005344 Bacteria 3444
27 Ga0070661_100091516 3300005344 Bacteria 2253
28 Ga0070692_10009335 3300005345 Unclassified 4421
29 Ga0070668_100005187 3300005347 Bacteria 9663
30 Ga0070668_100062577 3300005347 Bacteria 2883
31 Ga0070668_100079538 3300005347 Bacteria 2567
32 Ga0070668_100240229 3300005347 Bacteria 1500
33 Ga0070669_100017497 3300005353 Bacteria 5113
34 Ga0070669_100070137 3300005353 Bacteria 2590
35 Ga0070669_100297224 3300005353 Unclassified 1298
36 Ga0070675_100002370 3300005354 Bacteria 14027
37 Ga0070675_100074676 3300005354 Bacteria 2817
38 Ga0070671_100001282 3300005355 Bacteria 18862
39 Ga0070671_100017578 3300005355 Bacteria 5795
40 Ga0070671_100019803 3300005355 Bacteria 5481
41 Ga0070671_100108696 3300005355 Bacteria 2328
42 Ga0070671_100207784 3300005355 Bacteria 1660
43 Ga0070673_100005919 3300005364 Bacteria 7899
44 Ga0070673_100127470 3300005364 Bacteria 2131
45 Ga0070673_100129236 3300005364 Bacteria 2117
46 Ga0070659_100005003 3300005366 Bacteria 9496
47 Ga0070659_100017839 3300005366 Bacteria 5347
48 Ga0070667_100009422 3300005367 Bacteria 8100
49 Ga0070667_100144662 3300005367 Bacteria 2084
50 Ga0070662_100001855 3300005457 Bacteria 12956
51 Ga0070662_100005641 3300005457 Bacteria 8004
52 Ga0070662_100034503 3300005457 Bacteria 3568
53 Ga0068867_100032664 3300005459 Bacteria 3765
54 Ga0070672_100004830 3300005543 Bacteria 8857
55 Ga0070672_100057636 3300005543 Unclassified 3050
56 Ga0070672_100083088 3300005543 Bacteria 2570
57 Ga0070672_100159251 3300005543 Bacteria 1872
58 Ga0070672_100193883 3300005543 Bacteria 1697
59 Ga0070696_100003169 3300005546 Bacteria 10950
60 Ga0070665_100010366 3300005548 Bacteria 9430
61 Ga0070665_100044595 3300005548 Unclassified 4453
62 Ga0068855_100016864 3300005563 Bacteria 8783
63 Ga0068855_100099166 3300005563 Bacteria 3356
64 Ga0070664_100062588 3300005564 Bacteria 3172
65 Ga0068857_100031759 3300005577 Bacteria 4667
66 Ga0068857_100034758 3300005577 Bacteria 4458
67 Ga0068857_100214756 3300005577 Bacteria 1756
68 Ga0068852_100000333 3300005616 Bacteria 31986
69 Ga0068852_100039542 3300005616 Bacteria 3972
70 Ga0068859_100000104 3300005617 Bacteria 78653
71 Ga0068859_100387218 3300005617 Bacteria 1494
72 Ga0068864_100000118 3300005618 Bacteria 77800
73 Ga0068864_100002622 3300005618 Bacteria 14849
74 Ga0068864_100058126 3300005618 Bacteria 3341
75 Ga0068864_100087805 3300005618 Bacteria 2738
76 Ga0068866_10074348 3300005718 Bacteria 1806
77 Ga0068863_100000152 3300005841 Bacteria 72823
78 Ga0068863_100025778 3300005841 Bacteria 5608
79 Ga0068863_100074549 3300005841 Bacteria 3210
80 Ga0068863_100197888 3300005841 Bacteria 1932
81 Ga0068858_100000778 3300005842 Bacteria 33328
82 Ga0068858_100120452 3300005842 Bacteria 2454
83 Ga0068860_100000674 3300005843 Bacteria 39467
84 Ga0068860_100003124 3300005843 Bacteria 17106
85 Ga0068862_100026715 3300005844 Bacteria 4854
86 Ga0097620_100000104 3300006931 Bacteria 78653
87 Ga0097620_100387217 3300006931 Bacteria 1494
88 Ga0105250_10010180 3300009092 Bacteria 3925
89 Ga0111539_10109719 3300009094 Bacteria 3238
90 Ga0105245_10053737 3300009098 Bacteria 3616
91 Ga0105248_10000295 3300009177 Bacteria 59247
92 Ga0105248_10011959 3300009177 Bacteria 9570
93 Ga0105248_10015460 3300009177 Bacteria 8412
94 Ga0105248_10178616 3300009177 Bacteria 2392
95 Ga0105248_10181497 3300009177 Bacteria 2372
96 Ga0105248_10240130 3300009177 Bacteria 2039
97 Ga0105249_10000973 3300009553 Bacteria 25384
98 Ga0105239_10039368 3300010375 Bacteria 5180
99 Ga0157371_10024941 3300013102 Bacteria 4363
100 Ga0157371_10224927 3300013102 Bacteria 1348
101 Ga0157370_10122003 3300013104 Bacteria 2433
102 Ga0157369_10222149 3300013105 Bacteria 1977
103 Ga0163162_10012756 3300013306 Bacteria 8208
104 Ga0163162_10072250 3300013306 Bacteria 3505
105 Ga0163162_10409111 3300013306 Bacteria 1489
106 Ga0157375_10021836 3300013308 Bacteria 5881
107 Ga0163163_10000478 3300014325 Bacteria 36339
108 Ga0163163_10013155 3300014325 Bacteria 7561
109 Ga0163163_10089604 3300014325 Bacteria 3089
110 Ga0157377_10008892 3300014745 Bacteria 4914
111 Ga0206353_11105041 3300020082 Bacteria 3296
112 Ga0207697_10014430 3300025315 Bacteria 3276
113 Ga0207697_10054669 3300025315 Bacteria 1654
114 Ga0207696_1011567 3300025711 Bacteria 3168
115 Ga0207642_10087897 3300025899 Bacteria 1527
116 Ga0207688_10003108 3300025901 Bacteria 9066
117 Ga0207647_10000895 3300025904 Bacteria 23093
118 Ga0207645_10003106 3300025907 Bacteria 12724
119 Ga0207645_10084690 3300025907 Bacteria 2035
120 Ga0207705_10161196 3300025909 Bacteria 1685
121 Ga0207660_10056500 3300025917 Bacteria 2808
122 Ga0207657_10007415 3300025919 Bacteria 11248
123 Ga0207657_10016374 3300025919 Bacteria 7153
124 Ga0207657_10062029 3300025919 Bacteria 3202
125 Ga0207649_10008737 3300025920 Bacteria 5530
126 Ga0207649_10084765 3300025920 Bacteria 2061
127 Ga0207681_10015780 3300025923 Bacteria 4715
128 Ga0207681_10251921 3300025923 Bacteria 1379
129 Ga0207650_10033350 3300025925 Bacteria 3729
130 Ga0207650_10101509 3300025925 Bacteria 2215
131 Ga0207659_10019718 3300025926 Bacteria 4445
132 Ga0207659_10113286 3300025926 Bacteria 2065
133 Ga0207664_10021157 3300025929 Bacteria 4832
134 Ga0207644_10000052 3300025931 Bacteria 91473
135 Ga0207644_10023865 3300025931 Bacteria 4194
136 Ga0207644_10049180 3300025931 Bacteria 3017
137 Ga0207644_10135296 3300025931 Bacteria 1891
138 Ga0207644_10195727 3300025931 Bacteria 1592
139 Ga0207644_10216774 3300025931 Bacteria 1515
140 Ga0207690_10003330 3300025932 Bacteria 9617
141 Ga0207690_10020702 3300025932 Bacteria 4069
142 Ga0207690_10090734 3300025932 Bacteria 2158
143 Ga0207690_10228270 3300025932 Bacteria 1428
144 Ga0207706_10006300 3300025933 Bacteria 11025
145 Ga0207706_10011368 3300025933 Bacteria 8112
146 Ga0207706_10182396 3300025933 Bacteria 1843
147 Ga0207691_10005139 3300025940 Bacteria 12634
148 Ga0207691_10031667 3300025940 Bacteria 4935
149 Ga0207691_10032890 3300025940 Unclassified 4832
150 Ga0207691_10112457 3300025940 Bacteria 2420
151 Ga0207691_10225952 3300025940 Bacteria 1622
152 Ga0207711_10000153 3300025941 Bacteria 73814
153 Ga0207711_10009533 3300025941 Bacteria 8098
154 Ga0207711_10034808 3300025941 Bacteria 4265
155 Ga0207711_10079458 3300025941 Bacteria 2863
156 Ga0207711_10141650 3300025941 Bacteria 2164
157 Ga0207689_10043592 3300025942 Bacteria 3709
158 Ga0207689_10049572 3300025942 Bacteria 3463
159 Ga0207679_10092085 3300025945 Bacteria 2348
160 Ga0207667_10046509 3300025949 Unclassified 4595
161 Ga0207667_10072811 3300025949 Bacteria 3571
162 Ga0207651_10054713 3300025960 Bacteria 2736
163 Ga0207651_10087115 3300025960 Bacteria 2272
164 Ga0207651_10330472 3300025960 Bacteria 1277
165 Ga0207712_10000426 3300025961 Bacteria 36034
166 Ga0207668_10000050 3300025972 Bacteria 98767
167 Ga0207640_10008885 3300025981 Bacteria 5597
168 Ga0207640_10125935 3300025981 Bacteria 1844
169 Ga0207658_10000453 3300025986 Bacteria 38410
170 Ga0207658_10026090 3300025986 Bacteria 4094
171 Ga0207658_10249134 3300025986 Bacteria 1508
172 Ga0207658_10279361 3300025986 Bacteria 1431
173 Ga0207677_10097336 3300026023 Bacteria 2155
174 Ga0207703_10005219 3300026035 Bacteria 10497
175 Ga0207703_10371932 3300026035 Bacteria 1320
176 Ga0207702_10336434 3300026078 Bacteria 1441
177 Ga0207641_10000205 3300026088 Bacteria 78692
178 Ga0207641_10014675 3300026088 Bacteria 6424
179 Ga0207641_10038250 3300026088 Bacteria 4010
180 Ga0207641_10068776 3300026088 Bacteria 3037
181 Ga0207648_10000477 3300026089 Bacteria 44735
182 Ga0207676_10000702 3300026095 Bacteria 26358
183 Ga0207676_10072889 3300026095 Bacteria 2762
184 Ga0207674_10000086 3300026116 Bacteria 100722
185 Ga0207674_10018863 3300026116 Bacteria 7481
186 Ga0207674_10029037 3300026116 Bacteria 5830
187 Ga0207683_10076146 3300026121 Bacteria 2971
188 Ga0207698_10006936 3300026142 Bacteria 7089
189 Ga0268266_10005532 3300028379 Bacteria 11761
190 Ga0268266_10016900 3300028379 Bacteria 6233
191 Ga0268265_10027289 3300028380 Bacteria 4074
192 Ga0268264_10000268 3300028381 Bacteria 91477
193 Ga0268264_10002572 3300028381 Bacteria 15903
194 Ga0268264_10009057 3300028381 Bacteria 8260
195 Ga0307408_100068806 3300031548 Bacteria 2608
196 Ga0307405_10100675 3300031731 Bacteria 1937
197 Ga0307413_10003571 3300031824 Bacteria 6579
198 Ga0307410_10001493 3300031852 Bacteria 10607
199 Ga0307410_10016215 3300031852 Bacteria 4438
200 Ga0307406_10100214 3300031901 Bacteria 1971
201 Ga0307406_10310722 3300031901 Unclassified 1215
202 Ga0307407_10003434 3300031903 Bacteria 6496
203 Ga0307407_10010447 3300031903 Bacteria 4379
204 Ga0307412_10040117 3300031911 Bacteria 3028
205 Ga0307409_100028004 3300031995 Bacteria 4005
206 Ga0307409_100040491 3300031995 Bacteria 3470
207 Ga0307409_100161458 3300031995 Bacteria 1960
208 Ga0307416_100008074 3300032002 Bacteria 6749
209 Ga0307416_100132792 3300032002 Bacteria 2245
210 Ga0307414_10007687 3300032004 Bacteria 6069
211 Ga0307414_10017621 3300032004 Bacteria 4375
212 Ga0307411_10003932 3300032005 Bacteria 7012
213 Ga0307411_10069293 3300032005 Bacteria 2381
214 Ga0307415_100003198 3300032126 Bacteria 8312
215 Ga0307415_100036754 3300032126 Bacteria 3212
216 Ga0395899_0048344 3300037312 Bacteria 3166
217 Ga0395899_0073985 3300037312 Bacteria 2490
218 Ga0395899_0085970 3300037312 Bacteria 2285
219 Ga0395899_0131416 3300037312 Bacteria 1787
220 Ga0395900_0002260 3300037418 Bacteria 21395
221 Ga0395900_0012145 3300037418 Bacteria 8801
222 Ga0395900_0022480 3300037418 Bacteria 6449
223 Ga0395900_0049692 3300037418 Bacteria 4321
224 Ga0395900_0058258 3300037418 Bacteria 3976
225 Ga0395900_0063278 3300037418 Bacteria 3803
226 Ga0395900_0115838 3300037418 Bacteria 2750
227 Ga0395900_0195970 3300037418 Bacteria 2046
228 Ga0395900_0299915 3300037418 Bacteria 1593
229 Ga0395900_0333751 3300037418 Bacteria 1493
230 Ga0395898_0007823 3300037466 Bacteria 11347
231 Ga0395898_0030494 3300037466 Bacteria 5396
232 Ga0395898_0041637 3300037466 Bacteria 4536
233 Ga0395898_0045925 3300037466 Bacteria 4292
234 Ga0395898_0199610 3300037466 Bacteria 1910
235 Ga0395898_0281191 3300037466 Bacteria 1587
236 Ga0395898_0291430 3300037466 Bacteria 1557
237 Ga0395905_0000570 3300037471 Bacteria 49997
238 Ga0395905_0002474 3300037471 Bacteria 20465
239 Ga0395905_0005541 3300037471 Bacteria 12881
240 Ga0395905_0008456 3300037471 Bacteria 10150
241 Ga0395905_0009821 3300037471 Bacteria 9327
242 Ga0395905_0011996 3300037471 Bacteria 8358
243 Ga0395905_0031784 3300037471 Bacteria 4967
244 Ga0395905_0052082 3300037471 Bacteria 3833
245 Ga0395905_0055991 3300037471 Bacteria 3690
246 Ga0395905_0058944 3300037471 Bacteria 3589
247 Ga0395905_0070898 3300037471 Bacteria 3266
248 Ga0395905_0138906 3300037471 Bacteria 2286
249 Ga0395901_0000086 3300038443 Bacteria 125359
250 Ga0395901_0012462 3300038443 Bacteria 8629
251 Ga0395901_0030540 3300038443 Bacteria 5552
252 Ga0395901_0033156 3300038443 Bacteria 5330
253 Ga0395901_0081355 3300038443 Bacteria 3383
254 Ga0395901_0179539 3300038443 Bacteria 2220
255 Ga0395901_0327077 3300038443 Bacteria 1585
256 Ga0395901_0334661 3300038443 Bacteria 1564
257 Ga0450905_011708 3300042142 Bacteria 1229
258 Ga0439458_0000532 3300042157 Bacteria 9821
259 Ga0439464_0000510 3300042439 Bacteria 7949
260 Ga0466957_0001225 3300044842 Bacteria 13386
261 Ga0466967_0034054 3300045976 Bacteria 4319
262 Ga0466967_0087224 3300045976 Bacteria 2829
263 Ga0495585_0088076 3300046492 Bacteria 1675
264 Ga0495663_0004400 3300046525 Bacteria 3966
265 Ga0495663_0010673 3300046525 Bacteria 2556
266 Ga0495663_0021587 3300046525 Bacteria 1855
267 Ga0495642_0062862 3300046528 Bacteria 1542
268 Ga0495598_0005567 3300046537 Bacteria 2801
269 Ga0495621_0005429 3300046539 Bacteria 3665
270 Ga0495633_0013814 3300046558 Bacteria 4239
271 Ga0495668_0012523 3300046616 Bacteria 5030
272 Ga0495668_0015758 3300046616 Bacteria 4406
273 Ga0495669_0000689 3300046684 Bacteria 14750
274 Ga0495669_0001170 3300046684 Bacteria 10906
275 Ga0495669_0005086 3300046684 Bacteria 5473
276 Ga0495669_0009824 3300046684 Bacteria 4042
277 Ga0495669_0015105 3300046684 Bacteria 3303
278 Ga0495669_0030963 3300046684 Bacteria 2348
279 Ga0495669_0081367 3300046684 Bacteria 1486
280 Ga0495670_0017543 3300046691 Bacteria 3523
281 Ga0495677_0011909 3300047445 Bacteria 3174
282 Ga0495677_0013076 3300047445 Bacteria 3020
283 Ga0495677_0091362 3300047445 Bacteria 1147
284 Ga0495685_078080 3300047447 Bacteria 1104
285 Ga0496104_0206692 3300048907 Bacteria 1875
286 Ga0496106_0047973 3300048909 Bacteria 3215
287 Ga0496107_0034615 3300048910 Bacteria 3618
288 Ga0496108_0016535 3300048911 Bacteria 6021
289 Ga0496109_0042327 3300048912 Bacteria 4125
290 Ga0496109_0482863 3300048912 Bacteria 1170
291 Ga0496110_0005805 3300048913 Bacteria 9702
292 Ga0496110_0030737 3300048913 Bacteria 4631
293 Ga0496111_0001247 3300048914 Bacteria 14238
294 Ga0496112_0068996 3300048915 Bacteria 3492
295 Ga0496112_0172155 3300048915 Bacteria 2130
296 Ga0496113_0005257 3300048916 Bacteria 8061
297 Ga0496113_0158225 3300048916 Bacteria 1790
298 Ga0496114_0000016 3300048917 Bacteria 274656
299 Ga0501074_0269066 3300049590 Bacteria 1211
300 Ga0501080_0056878 3300049742 Bacteria 3642
301 nmdc:mga0n895_230190_c1 3300050512 Unclassified 1881
302 Ga0496110_0045342
303 JGI24737J22298_10001897
304 JGI24737J22298_10002292
305 JGI24737J22298_10040315
306 Ga0065712_10105866
307 Ga0070658_10019197
308 Ga0070658_10020954
309 Ga0070658_10043330
310 Ga0070658_10089991
311 Ga0070658_10231130
312 Ga0070676_10004534
313 Ga0070670_100003109
314 Ga0070670_100086087
315 Ga0070670_100086782
316 Ga0070670_100094969
317 Ga0070670_100132960
318 Ga0068869_100042537
319 Ga0068869_100053788
320 Ga0068869_100084888
321 Ga0068868_100069357
322 Ga0070660_100024367
323 Ga0070660_100080244
324 Ga0070660_100082370
325 Ga0070660_100108542
326 Ga0070661_100004695
327 Ga0070661_100039383
328 Ga0070661_100091516
329 Ga0070692_10009335
330 Ga0070668_100005187
331 Ga0070668_100062577
332 Ga0070668_100079538
333 Ga0070668_100240229
334 Ga0070669_100017497
335 Ga0070669_100070137
336 Ga0070669_100297224
337 Ga0070675_100002370
338 Ga0070675_100074676
339 Ga0070671_100001282
340 Ga0070671_100017578
341 Ga0070671_100019803
342 Ga0070671_100108696
343 Ga0070671_100207784
344 Ga0070673_100005919
345 Ga0070673_100127470
346 Ga0070673_100129236
347 Ga0070659_100005003
348 Ga0070659_100017839
349 Ga0070667_100009422
350 Ga0070667_100144662
351 Ga0070662_100001855
352 Ga0070662_100005641
353 Ga0070662_100034503
354 Ga0068867_100032664
355 Ga0070672_100004830
356 Ga0070672_100057636
357 Ga0070672_100083088
358 Ga0070672_100159251
359 Ga0070672_100193883
360 Ga0070696_100003169
361 Ga0070665_100010366
362 Ga0070665_100044595
363 Ga0068855_100016864
364 Ga0068855_100099166
365 Ga0070664_100062588
366 Ga0068857_100031759
367 Ga0068857_100034758
368 Ga0068857_100214756
369 Ga0068852_100000333
370 Ga0068852_100039542
371 Ga0068859_100000104
372 Ga0068859_100387218
373 Ga0068864_100000118
374 Ga0068864_100002622
375 Ga0068864_100058126
376 Ga0068864_100087805
377 Ga0068866_10074348
378 Ga0068863_100000152
379 Ga0068863_100025778
380 Ga0068863_100074549
381 Ga0068863_100197888
382 Ga0068858_100000778
383 Ga0068858_100120452
384 Ga0068860_100000674
385 Ga0068860_100003124
386 Ga0068862_100026715
387 Ga0097620_100000104
388 Ga0097620_100387217
389 Ga0105250_10010180
390 Ga0111539_10109719
391 Ga0105245_10053737
392 Ga0105248_10000295
393 Ga0105248_10011959
394 Ga0105248_10015460
395 Ga0105248_10178616
396 Ga0105248_10181497
397 Ga0105248_10240130
398 Ga0105249_10000973
399 Ga0105239_10039368
400 Ga0157371_10024941
401 Ga0157371_10224927
402 Ga0157370_10122003
403 Ga0157369_10222149
404 Ga0163162_10012756
405 Ga0163162_10072250
406 Ga0163162_10409111
407 Ga0157375_10021836
408 Ga0163163_10000478
409 Ga0163163_10013155
410 Ga0163163_10089604
411 Ga0157377_10008892
412 Ga0206353_11105041
413 Ga0207697_10014430
414 Ga0207697_10054669
415 Ga0207696_1011567
416 Ga0207642_10087897
417 Ga0207688_10003108
418 Ga0207647_10000895
419 Ga0207645_10003106
420 Ga0207645_10084690
421 Ga0207705_10161196
422 Ga0207660_10056500
423 Ga0207657_10007415
424 Ga0207657_10016374
425 Ga0207657_10062029
426 Ga0207649_10008737
427 Ga0207649_10084765
428 Ga0207681_10015780
429 Ga0207681_10251921
430 Ga0207650_10033350
431 Ga0207650_10101509
432 Ga0207659_10019718
433 Ga0207659_10113286
434 Ga0207664_10021157
435 Ga0207644_10000052
436 Ga0207644_10023865
437 Ga0207644_10049180
438 Ga0207644_10135296
439 Ga0207644_10195727
440 Ga0207644_10216774
441 Ga0207690_10003330
442 Ga0207690_10020702
443 Ga0207690_10090734
444 Ga0207690_10228270
445 Ga0207706_10006300
446 Ga0207706_10011368
447 Ga0207706_10182396
448 Ga0207691_10005139
449 Ga0207691_10031667
450 Ga0207691_10032890
451 Ga0207691_10112457
452 Ga0207691_10225952
453 Ga0207711_10000153
454 Ga0207711_10009533
455 Ga0207711_10034808
456 Ga0207711_10079458
457 Ga0207711_10141650
458 Ga0207689_10043592
459 Ga0207689_10049572
460 Ga0207679_10092085
461 Ga0207667_10046509
462 Ga0207667_10072811
463 Ga0207651_10054713
464 Ga0207651_10087115
465 Ga0207651_10330472
466 Ga0207712_10000426
467 Ga0207668_10000050
468 Ga0207640_10008885
469 Ga0207640_10125935
470 Ga0207658_10000453
471 Ga0207658_10026090
472 Ga0207658_10249134
473 Ga0207658_10279361
474 Ga0207677_10097336
475 Ga0207703_10005219
476 Ga0207703_10371932
477 Ga0207702_10336434
478 Ga0207641_10000205
479 Ga0207641_10014675
480 Ga0207641_10038250
481 Ga0207641_10068776
482 Ga0207648_10000477
483 Ga0207676_10000702
484 Ga0207676_10072889
485 Ga0207674_10000086
486 Ga0207674_10018863
487 Ga0207674_10029037
488 Ga0207683_10076146
489 Ga0207698_10006936
490 Ga0268266_10005532
491 Ga0268266_10016900
492 Ga0268265_10027289
493 Ga0268264_10000268
494 Ga0268264_10002572
495 Ga0268264_10009057
496 Ga0307408_100068806
497 Ga0307405_10100675
498 Ga0307413_10003571
499 Ga0307410_10001493
500 Ga0307410_10016215
501 Ga0307406_10100214
502 Ga0307406_10310722
503 Ga0307407_10003434
504 Ga0307407_10010447
505 Ga0307412_10040117
506 Ga0307409_100028004
507 Ga0307409_100040491
508 Ga0307409_100161458
509 Ga0307416_100008074
510 Ga0307416_100132792
511 Ga0307414_10007687
512 Ga0307414_10017621
513 Ga0307411_10003932
514 Ga0307411_10069293
515 Ga0307415_100003198
516 Ga0307415_100036754
517 Ga0395899_0048344
518 Ga0395899_0073985
519 Ga0395899_0085970
520 Ga0395899_0131416
521 Ga0395900_0002260
522 Ga0395900_0012145
523 Ga0395900_0022480
524 Ga0395900_0049692
525 Ga0395900_0058258
526 Ga0395900_0063278
527 Ga0395900_0115838
528 Ga0395900_0195970
529 Ga0395900_0299915
530 Ga0395900_0333751
531 Ga0395898_0007823
532 Ga0395898_0030494
533 Ga0395898_0041637
534 Ga0395898_0045925
535 Ga0395898_0199610
536 Ga0395898_0281191
537 Ga0395898_0291430
538 Ga0395905_0000570
539 Ga0395905_0002474
540 Ga0395905_0005541
541 Ga0395905_0008456
542 Ga0395905_0009821
543 Ga0395905_0011996
544 Ga0395905_0031784
545 Ga0395905_0052082
546 Ga0395905_0055991
547 Ga0395905_0058944
548 Ga0395905_0070898
549 Ga0395905_0138906
550 Ga0395901_0000086
551 Ga0395901_0012462
552 Ga0395901_0030540
553 Ga0395901_0033156
554 Ga0395901_0081355
555 Ga0395901_0179539
556 Ga0395901_0327077
557 Ga0395901_0334661
558 Ga0450905_011708
559 Ga0439458_0000532
560 Ga0439464_0000510
561 Ga0466957_0001225
562 Ga0466967_0034054
563 Ga0466967_0087224
564 Ga0495585_0088076
565 Ga0495663_0004400
566 Ga0495663_0010673
567 Ga0495663_0021587
568 Ga0495642_0062862
569 Ga0495598_0005567
570 Ga0495621_0005429
571 Ga0495633_0013814
572 Ga0495668_0012523
573 Ga0495668_0015758
574 Ga0495669_0000689
575 Ga0495669_0001170
576 Ga0495669_0005086
577 Ga0495669_0009824
578 Ga0495669_0015105
579 Ga0495669_0030963
580 Ga0495669_0081367
581 Ga0495670_0017543
582 Ga0495677_0011909
583 Ga0495677_0013076
584 Ga0495677_0091362
585 Ga0495685_078080
586 Ga0496104_0206692
587 Ga0496106_0047973
588 Ga0496107_0034615
589 Ga0496108_0016535
590 Ga0496109_0042327
591 Ga0496109_0482863
592 Ga0496110_0005805
593 Ga0496110_0030737
594 Ga0496111_0001247
595 Ga0496112_0068996
596 Ga0496112_0172155
597 Ga0496113_0005257
598 Ga0496113_0158225
599 Ga0496114_0000016
600 Ga0501074_0269066
601 Ga0501080_0056878
602 nmdc:mga0n895_230190_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13650

Asp_protease_2

Aspartyl protease

222

320

0.94

PF13975

gag-asp_proteas

gag-polyprotein putative aspartyl protease

89

180

0.94

PF13650

Asp_protease_2

Aspartyl protease

89

177

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obk-assembly1.cif.gz_B crystal structure of inactive hiv-1 protease in complex with the p1-p6 substrate variant (l449f/s451n) 0.7742 190 289
5c9b-assembly1.cif.gz_A crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.7737 179 310
5c9b-assembly1.cif.gz_D crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.7673 179 310
5c9f-assembly1.cif.gz_B crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.765 179 310
3nwx-assembly1.cif.gz_A x-ray structure of ester chemical analogue [o-ile50,o-ile50']hiv-1 protease complexed with kvs-1 inhibitor 0.7597 190 289
ID Description Score Start End Superfamily
af_Q9BQI9_157_277_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7686 56 150 2.40.70.10
5c9fB00 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.765 179 310 2.40.70.10
af_Q7KWM0_146_263_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7475 57 149 2.40.70.10
af_A0A2R8Q7F5_344_478_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7246 46 163 2.40.70.10
af_A0A0R0HH69_7_132_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7233 57 167 2.40.70.10
ID Description Score Start End GO Terms
AF-A0A059WYY3-F1-model_v4 Aspartyl protease 0.9631 70 342 GO:0006508
GO:0008233
AF-A0A059WYY3-F1-model_v4 Aspartyl protease 0.9462 70 342 GO:0006508
GO:0008233
AF-A0A850HDV7-F1-model_v4 Aspartyl protease family protein 0.9264 57 314 GO:0004190
GO:0006508
AF-A0A4Y8ZK31-F1-model_v4 Peptidase A2 domain-containing protein 0.921 154 342 GO:0004190
GO:0006508
AF-A0A6H9HQG2-F1-model_v4 Peptidase A2 domain-containing protein 0.9197 57 312 GO:0004190
GO:0006508

Map