F396135

General Info

Members Datasets Scaffolds Average Seq Length
301 154 602 274

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0017833|Ga0496111_0017833_3885_4880
Length 319
Sequence LEPIQNQGNLNCRERCYYQNQKDRISHRINLPDLKKEINPDKSGFLIMGDYIKVEFEHLNIEQKEIIIALLAEMNYDGFEENDDVLKAFIPSNIYDENKLKALSKDRKLFFSVSKLENKNWINHSIXHTPWVAIRAAFHESISDIKYELIITPKMSFGTGHHATTSMMIKMMSELDFSGKTVLDFGTGTGILAILAEKLGASKIVAIDNDDQSIKNAGENLGSNDCSKIRLLQGSTANVDIKFDIILANIIKGVILDNLAAFTKEMVTDGVILLSGLLADDEREVMEKATGYNLILNKKIEDKNWICLQMTYKSSSFRR

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
116 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
117 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
121 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
148 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
151 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
154 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.65
Nodule 0
Rhizoplane 0.33
Rhizosphere 89.7
Stem 0
Stem Tuber 0
Unclassified 8.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0017833 3300048914 Unclassified 4910
2 rootH1_10125848 3300003316 Bacteria 3347
3 rootH2_10168450 3300003320 Bacteria 1176
4 rootH2_10197471 3300003320 Bacteria 2933
5 rootL2_10097124 3300003322 Unclassified 2320
6 rootL2_10140161 3300003322 Bacteria 1817
7 rootL2_10277332 3300003322 Bacteria 1204
8 rootH1_10277108 3300003323 Bacteria 1871
9 JGI25160J50197_1003110 3300003354 Bacteria 7555
10 Ga0070683_100000329 3300005329 Bacteria 32745
11 Ga0070683_100081163 3300005329 Bacteria 3036
12 Ga0070670_100053200 3300005331 Bacteria 3477
13 Ga0070670_100150728 3300005331 Bacteria 2012
14 Ga0068869_100024126 3300005334 Bacteria 4211
15 Ga0068869_100031526 3300005334 Bacteria 3729
16 Ga0068869_100055895 3300005334 Bacteria 2877
17 Ga0070666_10000043 3300005335 Bacteria 111402
18 Ga0070666_10031370 3300005335 Bacteria 3508
19 Ga0068868_100022584 3300005338 Bacteria 4750
20 Ga0070691_10007717 3300005341 Bacteria 4928
21 Ga0070661_100004831 3300005344 Bacteria 9277
22 Ga0070668_100275096 3300005347 Unclassified 1405
23 Ga0070669_100278882 3300005353 Bacteria 1339
24 Ga0070675_100313413 3300005354 Bacteria 1385
25 Ga0070688_100345312 3300005365 Unclassified 1088
26 Ga0070667_100028595 3300005367 Bacteria 4642
27 Ga0070678_100034523 3300005456 Bacteria 3524
28 Ga0070662_100039341 3300005457 Bacteria 3362
29 Ga0070662_100041094 3300005457 Bacteria 3297
30 Ga0070662_100047930 3300005457 Unclassified 3076
31 Ga0068867_100068162 3300005459 Bacteria 2655
32 Ga0070685_10071691 3300005466 Bacteria 2054
33 Ga0070684_100000768 3300005535 Bacteria 22215
34 Ga0070684_100001060 3300005535 Bacteria 19661
35 Ga0070684_100453788 3300005535 Bacteria 1185
36 Ga0068853_100000520 3300005539 Bacteria 26128
37 Ga0068853_100059557 3300005539 Bacteria 3299
38 Ga0068853_100074904 3300005539 Bacteria 2954
39 Ga0068853_100090645 3300005539 Bacteria 2687
40 Ga0068853_100238521 3300005539 Bacteria 1666
41 Ga0070686_100142662 3300005544 Unclassified 1669
42 Ga0070665_100000016 3300005548 Bacteria 451538
43 Ga0070665_100263449 3300005548 Bacteria 1725
44 Ga0068855_100174465 3300005563 Unclassified 2433
45 Ga0070664_100007325 3300005564 Bacteria 8896
46 Ga0070664_100279457 3300005564 Bacteria 1505
47 Ga0070664_100386011 3300005564 Bacteria 1279
48 Ga0068857_100008614 3300005577 Bacteria 8827
49 Ga0068857_100032917 3300005577 Bacteria 4583
50 Ga0068857_100132177 3300005577 Bacteria 2251
51 Ga0068857_100357987 3300005577 Bacteria 1352
52 Ga0068854_100003899 3300005578 Bacteria 9349
53 Ga0068854_100043746 3300005578 Bacteria 3176
54 Ga0068854_100390590 3300005578 Bacteria 1149
55 Ga0068856_100113099 3300005614 Bacteria 2713
56 Ga0068856_100360980 3300005614 Bacteria 1471
57 Ga0068852_100003948 3300005616 Bacteria 10424
58 Ga0068852_100358506 3300005616 Bacteria 1426
59 Ga0068852_100426275 3300005616 Bacteria 1309
60 Ga0068859_100000012 3300005617 Bacteria 300376
61 Ga0068859_100016918 3300005617 Bacteria 7320
62 Ga0068859_100180962 3300005617 Bacteria 2191
63 Ga0068864_100010946 3300005618 Bacteria 7499
64 Ga0068864_100030323 3300005618 Bacteria 4583
65 Ga0068864_100064925 3300005618 Bacteria 3167
66 Ga0068864_100083935 3300005618 Bacteria 2798
67 Ga0068866_10190177 3300005718 Bacteria 1219
68 Ga0068863_100025383 3300005841 Bacteria 5650
69 Ga0068858_100001362 3300005842 Bacteria 25148
70 Ga0068858_100047034 3300005842 Bacteria 4001
71 Ga0068860_100000026 3300005843 Bacteria 270483
72 Ga0068860_100002209 3300005843 Bacteria 20481
73 Ga0068860_100010129 3300005843 Bacteria 9342
74 Ga0068860_100072785 3300005843 Bacteria 3267
75 Ga0081539_10029290 3300005985 Bacteria 3442
76 Ga0081539_10053064 3300005985 Bacteria 2272
77 Ga0070715_10006819 3300006163 Bacteria 3899
78 Ga0075366_10069948 3300006195 Bacteria 2089
79 Ga0075366_10076952 3300006195 Bacteria 1991
80 Ga0097621_100085134 3300006237 Bacteria 2636
81 Ga0097621_100194998 3300006237 Bacteria 1756
82 Ga0097621_100225857 3300006237 Bacteria 1633
83 Ga0097621_100404986 3300006237 Bacteria 1222
84 Ga0068871_100112386 3300006358 Bacteria 2292
85 Ga0097620_100000012 3300006931 Bacteria 300376
86 Ga0097620_100016919 3300006931 Bacteria 7320
87 Ga0097620_100180977 3300006931 Bacteria 2191
88 Ga0105240_10000258 3300009093 Bacteria 105011
89 Ga0105240_10004553 3300009093 Bacteria 21043
90 Ga0105240_10004621 3300009093 Bacteria 20878
91 Ga0105240_10039801 3300009093 Bacteria 6017
92 Ga0105240_10054842 3300009093 Bacteria 4993
93 Ga0105240_10060026 3300009093 Bacteria 4742
94 Ga0105245_10410015 3300009098 Bacteria 1356
95 Ga0105247_10001409 3300009101 Bacteria 17436
96 Ga0105247_10234417 3300009101 Bacteria 1248
97 Ga0105241_10000533 3300009174 Bacteria 28600
98 Ga0105241_10000721 3300009174 Bacteria 25017
99 Ga0105241_10204702 3300009174 Bacteria 1650
100 Ga0105241_10546049 3300009174 Bacteria 1040
101 Ga0105237_10000654 3300009545 Bacteria 48395
102 Ga0105237_10005490 3300009545 Bacteria 14294
103 Ga0105237_10005694 3300009545 Bacteria 14017
104 Ga0105237_10022472 3300009545 Bacteria 6471
105 Ga0105237_10064862 3300009545 Bacteria 3648
106 Ga0105237_10126957 3300009545 Unclassified 2545
107 Ga0105238_10006981 3300009551 Bacteria 11286
108 Ga0105238_10078160 3300009551 Bacteria 3300
109 Ga0105249_10001958 3300009553 Bacteria 17861
110 Ga0105249_10041170 3300009553 Bacteria 4198
111 Ga0105249_10114738 3300009553 Bacteria 2551
112 Ga0105249_10330591 3300009553 Bacteria 1538
113 Ga0105239_10001037 3300010375 Bacteria 38729
114 Ga0105239_10011083 3300010375 Bacteria 10062
115 Ga0105239_10017966 3300010375 Bacteria 7820
116 Ga0105239_10043883 3300010375 Bacteria 4903
117 Ga0105239_10127719 3300010375 Bacteria 2826
118 Ga0105239_10179998 3300010375 Bacteria 2365
119 Ga0157373_10110592 3300013100 Unclassified 1932
120 Ga0157373_10111730 3300013100 Unclassified 1921
121 Ga0157371_10011331 3300013102 Bacteria 6878
122 Ga0157371_10137041 3300013102 Bacteria 1743
123 Ga0157371_10189740 3300013102 Bacteria 1471
124 Ga0157370_10005886 3300013104 Bacteria 13672
125 Ga0157369_10059170 3300013105 Bacteria 4132
126 Ga0157374_10006478 3300013296 Bacteria 9936
127 Ga0157374_10015281 3300013296 Bacteria 6732
128 Ga0157374_10098848 3300013296 Bacteria 2794
129 Ga0157374_10154491 3300013296 Bacteria 2232
130 Ga0157378_10023595 3300013297 Bacteria 5411
131 Ga0163162_10000279 3300013306 Bacteria 46872
132 Ga0163162_10004205 3300013306 Bacteria 13837
133 Ga0163162_10006285 3300013306 Bacteria 11505
134 Ga0163162_10038399 3300013306 Bacteria 4778
135 Ga0163162_10163930 3300013306 Bacteria 2346
136 Ga0157372_10002704 3300013307 Bacteria 19172
137 Ga0157372_10010252 3300013307 Bacteria 9953
138 Ga0157372_10199261 3300013307 Bacteria 2319
139 Ga0157372_10356888 3300013307 Bacteria 1703
140 Ga0157372_10398541 3300013307 Unclassified 1604
141 Ga0157375_10039491 3300013308 Bacteria 4543
142 Ga0157375_10064756 3300013308 Bacteria 3641
143 Ga0157375_10449600 3300013308 Bacteria 1454
144 Ga0157375_10501896 3300013308 Bacteria 1377
145 Ga0163163_10002122 3300014325 Bacteria 16737
146 Ga0163163_10009925 3300014325 Bacteria 8537
147 Ga0163163_10020274 3300014325 Bacteria 6258
148 Ga0163163_10456616 3300014325 Bacteria 1338
149 Ga0157377_10057265 3300014745 Unclassified 2215
150 Ga0157377_10147275 3300014745 Bacteria 1453
151 Ga0157379_10123471 3300014968 Bacteria 2330
152 Ga0157379_10132198 3300014968 Bacteria 2246
153 Ga0157379_10246416 3300014968 Bacteria 1621
154 Ga0157376_10004908 3300014969 Bacteria 9323
155 Ga0157376_10007359 3300014969 Bacteria 7849
156 Ga0157376_10453389 3300014969 Unclassified 1252
157 Ga0163161_10048384 3300017792 Bacteria 3070
158 Ga0163161_10058903 3300017792 Bacteria 2792
159 Ga0163161_10104760 3300017792 Bacteria 2109
160 Ga0207426_1000052 3300025302 Bacteria 389825
161 Ga0207642_10212280 3300025899 Bacteria 1076
162 Ga0207680_10000371 3300025903 Bacteria 21501
163 Ga0207647_10004784 3300025904 Bacteria 10024
164 Ga0207647_10019112 3300025904 Bacteria 4613
165 Ga0207647_10076717 3300025904 Bacteria 2010
166 Ga0207685_10010434 3300025905 Bacteria 2743
167 Ga0207645_10017285 3300025907 Unclassified 4765
168 Ga0207654_10001646 3300025911 Bacteria 11680
169 Ga0207654_10025628 3300025911 Bacteria 3183
170 Ga0207654_10121429 3300025911 Bacteria 1641
171 Ga0207695_10000486 3300025913 Bacteria 84856
172 Ga0207695_10003818 3300025913 Bacteria 20882
173 Ga0207695_10008726 3300025913 Bacteria 12639
174 Ga0207695_10038067 3300025913 Bacteria 5184
175 Ga0207695_10152595 3300025913 Unclassified 2248
176 Ga0207695_10182706 3300025913 Bacteria 2018
177 Ga0207671_10001742 3300025914 Bacteria 24460
178 Ga0207671_10003349 3300025914 Bacteria 16082
179 Ga0207671_10004018 3300025914 Bacteria 14291
180 Ga0207671_10006632 3300025914 Bacteria 10262
181 Ga0207671_10344928 3300025914 Unclassified 1180
182 Ga0207657_10209074 3300025919 Bacteria 1567
183 Ga0207657_10283833 3300025919 Bacteria 1314
184 Ga0207649_10006464 3300025920 Bacteria 6364
185 Ga0207650_10134753 3300025925 Bacteria 1936
186 Ga0207659_10508575 3300025926 Bacteria 1020
187 Ga0207644_10340004 3300025931 Bacteria 1217
188 Ga0207690_10084126 3300025932 Bacteria 2229
189 Ga0207706_10003803 3300025933 Bacteria 14383
190 Ga0207706_10023224 3300025933 Bacteria 5570
191 Ga0207706_10031025 3300025933 Bacteria 4763
192 Ga0207670_10012704 3300025936 Bacteria 4936
193 Ga0207691_10012396 3300025940 Bacteria 8172
194 Ga0207689_10000329 3300025942 Bacteria 44014
195 Ga0207689_10010393 3300025942 Bacteria 8016
196 Ga0207689_10021416 3300025942 Bacteria 5435
197 Ga0207689_10044691 3300025942 Bacteria 3663
198 Ga0207661_10020712 3300025944 Bacteria 4920
199 Ga0207661_10043012 3300025944 Bacteria 3564
200 Ga0207661_10370528 3300025944 Bacteria 1295
201 Ga0207679_10000751 3300025945 Bacteria 21527
202 Ga0207679_10001121 3300025945 Bacteria 17095
203 Ga0207667_10009409 3300025949 Bacteria 11510
204 Ga0207667_10061201 3300025949 Bacteria 3939
205 Ga0207651_10399085 3300025960 Bacteria 1169
206 Ga0207651_10455062 3300025960 Unclassified 1099
207 Ga0207651_10483931 3300025960 Bacteria 1067
208 Ga0207712_10001475 3300025961 Bacteria 16057
209 Ga0207712_10012015 3300025961 Bacteria 5526
210 Ga0207712_10211933 3300025961 Bacteria 1543
211 Ga0207668_10219684 3300025972 Unclassified 1525
212 Ga0207640_10017218 3300025981 Bacteria 4223
213 Ga0207640_10081591 3300025981 Bacteria 2212
214 Ga0207658_10051028 3300025986 Bacteria 3047
215 Ga0207677_10007895 3300026023 Bacteria 5915
216 Ga0207677_10481829 3300026023 Unclassified 1069
217 Ga0207703_10002961 3300026035 Bacteria 14396
218 Ga0207639_10019883 3300026041 Bacteria 4798
219 Ga0207639_10026659 3300026041 Bacteria 4200
220 Ga0207678_10078813 3300026067 Bacteria 2821
221 Ga0207641_10000152 3300026088 Bacteria 98311
222 Ga0207641_10051955 3300026088 Bacteria 3470
223 Ga0207648_10108632 3300026089 Bacteria 2435
224 Ga0207648_10218055 3300026089 Unclassified 1695
225 Ga0207676_10013981 3300026095 Bacteria 5762
226 Ga0207676_10053123 3300026095 Bacteria 3170
227 Ga0207676_10062678 3300026095 Bacteria 2950
228 Ga0207676_10163905 3300026095 Bacteria 1929
229 Ga0207674_10006492 3300026116 Bacteria 13755
230 Ga0207674_10012911 3300026116 Bacteria 9316
231 Ga0207674_10030052 3300026116 Bacteria 5715
232 Ga0207675_100082906 3300026118 Bacteria 3007
233 Ga0207683_10031869 3300026121 Bacteria 4577
234 Ga0207698_10008700 3300026142 Bacteria 6434
235 Ga0207698_10023196 3300026142 Bacteria 4330
236 Ga0207698_10049762 3300026142 Bacteria 3192
237 Ga0207698_10309727 3300026142 Bacteria 1474
238 Ga0268266_10000034 3300028379 Bacteria 354251
239 Ga0268266_10300190 3300028379 Bacteria 1498
240 Ga0268264_10000117 3300028381 Bacteria 195037
241 Ga0268264_10024882 3300028381 Bacteria 4892
242 Ga0268264_10090261 3300028381 Bacteria 2640
243 Ga0268264_10103812 3300028381 Unclassified 2476
244 Ga0307517_10108469 3300028786 Bacteria 2131
245 Ga0265327_10000196 3300031251 Bacteria 127325
246 Ga0265327_10043802 3300031251 Bacteria 2391
247 Ga0307508_10000937 3300031616 Bacteria 33974
248 Ga0307510_10000191 3300033180 Bacteria 53108
249 Ga0373927_0084001 3300035695 Bacteria 2065
250 Ga0395900_0578914 3300037418 Unclassified 1065
251 Ga0395898_0084334 3300037466 Bacteria 3063
252 Ga0395901_0105083 3300038443 Bacteria 2964
253 Ga0400489_24444 3300039093 Bacteria 5765
254 Ga0439436_0000773 3300041404 Bacteria 8667
255 Ga0439465_0013898 3300041413 Bacteria 2507
256 Ga0451853_2746119 3300041512 Bacteria 1676
257 Ga0439449_0131099 3300042007 Bacteria 932
258 Ga0439457_000175 3300042014 Bacteria 16689
259 Ga0439457_020754 3300042014 Bacteria 1457
260 Ga0439462_0036364 3300042015 Bacteria 1310
261 Ga0466972_0000782 3300044658 Bacteria 15085
262 Ga0453684_0038732 3300044712 Bacteria 6509
263 Ga0453684_0814383 3300044712 Bacteria 1006
264 Ga0466957_0010988 3300044842 Bacteria 5208
265 Ga0495592_0125910 3300046454 Bacteria 1798
266 Ga0495638_0072586 3300046460 Unclassified 2103
267 Ga0495653_0078610 3300046463 Bacteria 2446
268 Ga0495608_0156085 3300046511 Bacteria 1453
269 Ga0495630_0019380 3300046517 Bacteria 5000
270 Ga0495648_0002156 3300046524 Bacteria 18542
271 Ga0495587_0097319 3300046536 Bacteria 1697
272 Ga0495668_0001368 3300046616 Bacteria 23908
273 Ga0495611_0000358 3300046648 Bacteria 29739
274 Ga0495611_0095110 3300046648 Unclassified 1379
275 Ga0495625_0275681 3300046660 Bacteria 1084
276 Ga0495657_0025035 3300046675 Bacteria 4241
277 Ga0495649_0070579 3300046694 Bacteria 1873
278 Ga0495604_0130662 3300047317 Bacteria 1806
279 Ga0495687_000079 3300047443 Bacteria 147704
280 Ga0495686_0000041 3300047472 Bacteria 297599
281 Ga0495686_0249040 3300047472 Bacteria 999
282 Ga0501047_0237673 3300049581 Bacteria 1673
283 Ga0501047_0316072 3300049581 Bacteria 1402
284 Ga0501257_032622 3300049686 Bacteria 1260
285 Ga0501225_0002625 3300049705 Bacteria 5520
286 Ga0501044_0006672 3300049823 Bacteria 12724
287 Ga0495619_0061916 3300053085 Bacteria 2491
288 Ga0500578_0000017 3300053086 Bacteria 178494
289 Ga0500578_0031997 3300053086 Bacteria 3382
290 Ga0500646_0047096 3300053090 Bacteria 1232
291 Ga0500650_0006567 3300053098 Bacteria 4454
292 Ga0500555_010394 3300053103 Bacteria 2668
293 Ga0500556_0087245 3300053104 Bacteria 1187
294 Ga0500642_0022129 3300053130 Bacteria 2530
295 Ga0500588_0004743 3300053146 Bacteria 2965
296 Ga0500588_0044468 3300053146 Bacteria 1355
297 Ga0500588_0060549 3300053146 Unclassified 1212
298 Ga0500622_0001151 3300053156 Bacteria 22018
299 Ga0500611_000018 3300053727 Bacteria 111023
300 Ga0500611_020008 3300053727 Bacteria 1257
301 2738729416 2738541278 Bacteria 9755573
302 Ga0496111_0017833
303 rootH1_10125848
304 rootH2_10168450
305 rootH2_10197471
306 rootL2_10097124
307 rootL2_10140161
308 rootL2_10277332
309 rootH1_10277108
310 JGI25160J50197_1003110
311 Ga0070683_100000329
312 Ga0070683_100081163
313 Ga0070670_100053200
314 Ga0070670_100150728
315 Ga0068869_100024126
316 Ga0068869_100031526
317 Ga0068869_100055895
318 Ga0070666_10000043
319 Ga0070666_10031370
320 Ga0068868_100022584
321 Ga0070691_10007717
322 Ga0070661_100004831
323 Ga0070668_100275096
324 Ga0070669_100278882
325 Ga0070675_100313413
326 Ga0070688_100345312
327 Ga0070667_100028595
328 Ga0070678_100034523
329 Ga0070662_100039341
330 Ga0070662_100041094
331 Ga0070662_100047930
332 Ga0068867_100068162
333 Ga0070685_10071691
334 Ga0070684_100000768
335 Ga0070684_100001060
336 Ga0070684_100453788
337 Ga0068853_100000520
338 Ga0068853_100059557
339 Ga0068853_100074904
340 Ga0068853_100090645
341 Ga0068853_100238521
342 Ga0070686_100142662
343 Ga0070665_100000016
344 Ga0070665_100263449
345 Ga0068855_100174465
346 Ga0070664_100007325
347 Ga0070664_100279457
348 Ga0070664_100386011
349 Ga0068857_100008614
350 Ga0068857_100032917
351 Ga0068857_100132177
352 Ga0068857_100357987
353 Ga0068854_100003899
354 Ga0068854_100043746
355 Ga0068854_100390590
356 Ga0068856_100113099
357 Ga0068856_100360980
358 Ga0068852_100003948
359 Ga0068852_100358506
360 Ga0068852_100426275
361 Ga0068859_100000012
362 Ga0068859_100016918
363 Ga0068859_100180962
364 Ga0068864_100010946
365 Ga0068864_100030323
366 Ga0068864_100064925
367 Ga0068864_100083935
368 Ga0068866_10190177
369 Ga0068863_100025383
370 Ga0068858_100001362
371 Ga0068858_100047034
372 Ga0068860_100000026
373 Ga0068860_100002209
374 Ga0068860_100010129
375 Ga0068860_100072785
376 Ga0081539_10029290
377 Ga0081539_10053064
378 Ga0070715_10006819
379 Ga0075366_10069948
380 Ga0075366_10076952
381 Ga0097621_100085134
382 Ga0097621_100194998
383 Ga0097621_100225857
384 Ga0097621_100404986
385 Ga0068871_100112386
386 Ga0097620_100000012
387 Ga0097620_100016919
388 Ga0097620_100180977
389 Ga0105240_10000258
390 Ga0105240_10004553
391 Ga0105240_10004621
392 Ga0105240_10039801
393 Ga0105240_10054842
394 Ga0105240_10060026
395 Ga0105245_10410015
396 Ga0105247_10001409
397 Ga0105247_10234417
398 Ga0105241_10000533
399 Ga0105241_10000721
400 Ga0105241_10204702
401 Ga0105241_10546049
402 Ga0105237_10000654
403 Ga0105237_10005490
404 Ga0105237_10005694
405 Ga0105237_10022472
406 Ga0105237_10064862
407 Ga0105237_10126957
408 Ga0105238_10006981
409 Ga0105238_10078160
410 Ga0105249_10001958
411 Ga0105249_10041170
412 Ga0105249_10114738
413 Ga0105249_10330591
414 Ga0105239_10001037
415 Ga0105239_10011083
416 Ga0105239_10017966
417 Ga0105239_10043883
418 Ga0105239_10127719
419 Ga0105239_10179998
420 Ga0157373_10110592
421 Ga0157373_10111730
422 Ga0157371_10011331
423 Ga0157371_10137041
424 Ga0157371_10189740
425 Ga0157370_10005886
426 Ga0157369_10059170
427 Ga0157374_10006478
428 Ga0157374_10015281
429 Ga0157374_10098848
430 Ga0157374_10154491
431 Ga0157378_10023595
432 Ga0163162_10000279
433 Ga0163162_10004205
434 Ga0163162_10006285
435 Ga0163162_10038399
436 Ga0163162_10163930
437 Ga0157372_10002704
438 Ga0157372_10010252
439 Ga0157372_10199261
440 Ga0157372_10356888
441 Ga0157372_10398541
442 Ga0157375_10039491
443 Ga0157375_10064756
444 Ga0157375_10449600
445 Ga0157375_10501896
446 Ga0163163_10002122
447 Ga0163163_10009925
448 Ga0163163_10020274
449 Ga0163163_10456616
450 Ga0157377_10057265
451 Ga0157377_10147275
452 Ga0157379_10123471
453 Ga0157379_10132198
454 Ga0157379_10246416
455 Ga0157376_10004908
456 Ga0157376_10007359
457 Ga0157376_10453389
458 Ga0163161_10048384
459 Ga0163161_10058903
460 Ga0163161_10104760
461 Ga0207426_1000052
462 Ga0207642_10212280
463 Ga0207680_10000371
464 Ga0207647_10004784
465 Ga0207647_10019112
466 Ga0207647_10076717
467 Ga0207685_10010434
468 Ga0207645_10017285
469 Ga0207654_10001646
470 Ga0207654_10025628
471 Ga0207654_10121429
472 Ga0207695_10000486
473 Ga0207695_10003818
474 Ga0207695_10008726
475 Ga0207695_10038067
476 Ga0207695_10152595
477 Ga0207695_10182706
478 Ga0207671_10001742
479 Ga0207671_10003349
480 Ga0207671_10004018
481 Ga0207671_10006632
482 Ga0207671_10344928
483 Ga0207657_10209074
484 Ga0207657_10283833
485 Ga0207649_10006464
486 Ga0207650_10134753
487 Ga0207659_10508575
488 Ga0207644_10340004
489 Ga0207690_10084126
490 Ga0207706_10003803
491 Ga0207706_10023224
492 Ga0207706_10031025
493 Ga0207670_10012704
494 Ga0207691_10012396
495 Ga0207689_10000329
496 Ga0207689_10010393
497 Ga0207689_10021416
498 Ga0207689_10044691
499 Ga0207661_10020712
500 Ga0207661_10043012
501 Ga0207661_10370528
502 Ga0207679_10000751
503 Ga0207679_10001121
504 Ga0207667_10009409
505 Ga0207667_10061201
506 Ga0207651_10399085
507 Ga0207651_10455062
508 Ga0207651_10483931
509 Ga0207712_10001475
510 Ga0207712_10012015
511 Ga0207712_10211933
512 Ga0207668_10219684
513 Ga0207640_10017218
514 Ga0207640_10081591
515 Ga0207658_10051028
516 Ga0207677_10007895
517 Ga0207677_10481829
518 Ga0207703_10002961
519 Ga0207639_10019883
520 Ga0207639_10026659
521 Ga0207678_10078813
522 Ga0207641_10000152
523 Ga0207641_10051955
524 Ga0207648_10108632
525 Ga0207648_10218055
526 Ga0207676_10013981
527 Ga0207676_10053123
528 Ga0207676_10062678
529 Ga0207676_10163905
530 Ga0207674_10006492
531 Ga0207674_10012911
532 Ga0207674_10030052
533 Ga0207675_100082906
534 Ga0207683_10031869
535 Ga0207698_10008700
536 Ga0207698_10023196
537 Ga0207698_10049762
538 Ga0207698_10309727
539 Ga0268266_10000034
540 Ga0268266_10300190
541 Ga0268264_10000117
542 Ga0268264_10024882
543 Ga0268264_10090261
544 Ga0268264_10103812
545 Ga0307517_10108469
546 Ga0265327_10000196
547 Ga0265327_10043802
548 Ga0307508_10000937
549 Ga0307510_10000191
550 Ga0373927_0084001
551 Ga0395900_0578914
552 Ga0395898_0084334
553 Ga0395901_0105083
554 Ga0400489_24444
555 Ga0439436_0000773
556 Ga0439465_0013898
557 Ga0451853_2746119
558 Ga0439449_0131099
559 Ga0439457_000175
560 Ga0439457_020754
561 Ga0439462_0036364
562 Ga0466972_0000782
563 Ga0453684_0038732
564 Ga0453684_0814383
565 Ga0466957_0010988
566 Ga0495592_0125910
567 Ga0495638_0072586
568 Ga0495653_0078610
569 Ga0495608_0156085
570 Ga0495630_0019380
571 Ga0495648_0002156
572 Ga0495587_0097319
573 Ga0495668_0001368
574 Ga0495611_0000358
575 Ga0495611_0095110
576 Ga0495625_0275681
577 Ga0495657_0025035
578 Ga0495649_0070579
579 Ga0495604_0130662
580 Ga0495687_000079
581 Ga0495686_0000041
582 Ga0495686_0249040
583 Ga0501047_0237673
584 Ga0501047_0316072
585 Ga0501257_032622
586 Ga0501225_0002625
587 Ga0501044_0006672
588 Ga0495619_0061916
589 Ga0500578_0000017
590 Ga0500578_0031997
591 Ga0500646_0047096
592 Ga0500650_0006567
593 Ga0500555_010394
594 Ga0500556_0087245
595 Ga0500642_0022129
596 Ga0500588_0004743
597 Ga0500588_0044468
598 Ga0500588_0060549
599 Ga0500622_0001151
600 Ga0500611_000018
601 Ga0500611_020008
602 2738729416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

150

312

0.88

PF08241

Methyltransf_11

Methyltransferase domain

183

268

0.84

PF13649

Methyltransf_25

Methyltransferase domain

182

268

0.84

PF13847

Methyltransf_31

Methyltransferase domain

176

302

0.83

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

36

313

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9334 80 269
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9329 80 269
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9148 80 269
4lwo-assembly2.cif.gz_G crystal structure of prmt6 0.9138 133 189
4lwp-assembly1.cif.gz_A crystal structure of prmt6-sah 0.912 133 190
ID Description Score Start End Superfamily
af_Q2FXZ4_114_311_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9619 79 269 3.40.50.150
3grzA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9592 117 269 3.40.50.150
4m36A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9415 137 204 3.40.50.150
3grzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9334 80 269 3.40.50.150
2nxjB03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.933 119 269 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6H9LJW5-F1-model_v4 deleted 0.9833 110 269
AF-A0A2M7RW94-F1-model_v4 50S ribosomal protein L11 methyltransferase 0.9785 198 269 GO:0005840
GO:0008168
GO:0032259
AF-A0A090W7D0-F1-model_v4 Ribosomal protein L11 methyltransferase 0.9784 84 269 GO:0005840
GO:0008276
GO:0032259
AF-A0A090W7D0-F1-model_v4 Ribosomal protein L11 methyltransferase 0.9732 84 269 GO:0005840
GO:0008276
GO:0032259
AF-F9MS34-F1-model_v4 deleted 0.971 112 268

Map