F396176

General Info

Members Datasets Scaffolds Average Seq Length
301 170 602 406

Family's Representative Sequence

Representative Sequence 3300049703|Ga0501219_000047|Ga0501219_000047_12778_14103
Length 441
Sequence MNQASKNDIACIIFKKEITFPSFMKSFAIYSLALCCLTGTAIAQPKPGTAETEAILRKVADNIIRSTSFQFVNSKTGETFTSTKGRDTSIHVKAESKFNKWQYVNGVLAVGMVRMAEVLNDKAYTDYPRKNFNFIFDNLDYFKKQYDAGTTSVEYRPVFRMGSLDDCGSMAAGLLDVYAFDKRPDFLAYLNRVGNHIINVQSKFPDGTLARNGPRKMTLWADDLYMSVPYLARMGKLTGDNKYFDFAIKQVELYNRYIYDSTTGLYFHTFYNDENTNGVAHWGRCNGWVALAQVELLNNLPPHHPKRPELIRLLQRQIIGFSRYQDIDGMWHQLIDKPDSYAEASVTSMFVYAVAKAVNEGWINKRFISIAQNGWEALAKKVTADGQVEDICIGTSVEEDIRYYYTRPKETNDTHGLGAFLMAGAEMVRAKDKLVDIGKRR

Samples

Sample ID Description Type Environment
1 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
163 2738543023 Pedobacter sp. OK628 Isolate Unclassified
164 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
165 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
166 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
167 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
168 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
169 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
170 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.68
Metatranscriptomes 0
Isolates 3.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.65
Nodule 0
Rhizoplane 0.33
Rhizosphere 85.38
Stem 0
Stem Tuber 0
Unclassified 9.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501219_000047 3300049703 Bacteria 19832
2 JGI24740J21852_10014526 3300001979 Unclassified 2900
3 JGI24739J22299_10000730 3300001989 Bacteria 11919
4 JGI25162J39368_1000012 3300002737 Bacteria 373191
5 JGI25157J39369_1006179 3300002741 Bacteria 1857
6 rootH1_10034198 3300003316 Bacteria 14655
7 rootH2_10024381 3300003320 Bacteria 14001
8 rootH1_10147378 3300003323 Unclassified 2334
9 rootH1_10243341 3300003323 Unclassified 1641
10 Ga0065714_10121977 3300005288 Bacteria 1337
11 Ga0070683_100118049 3300005329 Bacteria 2505
12 Ga0070670_100113646 3300005331 Bacteria 2334
13 Ga0068869_100051327 3300005334 Bacteria 2992
14 Ga0070666_10000409 3300005335 Bacteria 26703
15 Ga0070666_10059582 3300005335 Bacteria 2582
16 Ga0070680_100006112 3300005336 Bacteria 9124
17 Ga0070682_100007965 3300005337 Bacteria 5963
18 Ga0068868_100078919 3300005338 Bacteria 2636
19 Ga0070660_100032128 3300005339 Bacteria 3948
20 Ga0070660_100103066 3300005339 Bacteria 2262
21 Ga0070660_100168075 3300005339 Bacteria 1770
22 Ga0070660_100208929 3300005339 Unclassified 1584
23 Ga0070691_10016433 3300005341 Bacteria 3399
24 Ga0070687_100016231 3300005343 Bacteria 3390
25 Ga0070668_100082724 3300005347 Bacteria 2518
26 Ga0070671_100170911 3300005355 Unclassified 1838
27 Ga0070674_100006451 3300005356 Bacteria 6847
28 Ga0070659_100000221 3300005366 Bacteria 44165
29 Ga0070659_100002823 3300005366 Bacteria 12361
30 Ga0070659_100298245 3300005366 Bacteria 1343
31 Ga0070667_100020541 3300005367 Bacteria 5483
32 Ga0070701_10051304 3300005438 Bacteria 2140
33 Ga0070663_100019053 3300005455 Bacteria 4513
34 Ga0070681_10048154 3300005458 Bacteria 4260
35 Ga0070679_100024085 3300005530 Bacteria 5963
36 Ga0070684_100027963 3300005535 Bacteria 4766
37 Ga0068853_100001216 3300005539 Bacteria 18362
38 Ga0068853_100020121 3300005539 Bacteria 5548
39 Ga0068853_100020950 3300005539 Bacteria 5440
40 Ga0068853_100025573 3300005539 Bacteria 4955
41 Ga0068853_100054352 3300005539 Unclassified 3450
42 Ga0070686_100095656 3300005544 Bacteria 1996
43 Ga0070693_100010884 3300005547 Bacteria 4569
44 Ga0070665_100000016 3300005548 Bacteria 451538
45 Ga0068855_100015456 3300005563 Bacteria 9188
46 Ga0068855_100022488 3300005563 Bacteria 7555
47 Ga0068855_100030411 3300005563 Bacteria 6460
48 Ga0070664_100018241 3300005564 Bacteria 5759
49 Ga0068857_100024373 3300005577 Bacteria 5325
50 Ga0068854_100019851 3300005578 Bacteria 4536
51 Ga0068856_100272087 3300005614 Bacteria 1710
52 Ga0068852_100004997 3300005616 Bacteria 9431
53 Ga0068852_100079842 3300005616 Bacteria 2899
54 Ga0068852_100092124 3300005616 Unclassified 2714
55 Ga0068859_100000030 3300005617 Bacteria 175435
56 Ga0068859_100010094 3300005617 Bacteria 9518
57 Ga0068864_100007767 3300005618 Bacteria 8839
58 Ga0068863_100058717 3300005841 Bacteria 3640
59 Ga0068863_100117232 3300005841 Bacteria 2537
60 Ga0068858_100004418 3300005842 Bacteria 13798
61 Ga0068860_100000006 3300005843 Bacteria 461966
62 Ga0068860_100005696 3300005843 Bacteria 12579
63 Ga0068860_100008359 3300005843 Bacteria 10305
64 Ga0068860_100012027 3300005843 Bacteria 8523
65 Ga0075366_10014318 3300006195 Bacteria 4530
66 Ga0075366_10026823 3300006195 Bacteria 3376
67 Ga0068871_100024664 3300006358 Unclassified 4666
68 Ga0075434_100039952 3300006871 Bacteria 4647
69 Ga0097620_100000030 3300006931 Bacteria 175435
70 Ga0097620_100010094 3300006931 Bacteria 9518
71 Ga0105240_10000095 3300009093 Bacteria 180935
72 Ga0105240_10000155 3300009093 Bacteria 140485
73 Ga0105240_10001144 3300009093 Bacteria 46441
74 Ga0105240_10003839 3300009093 Bacteria 23226
75 Ga0105240_10004890 3300009093 Bacteria 20166
76 Ga0105240_10055456 3300009093 Unclassified 4962
77 Ga0105240_10072356 3300009093 Unclassified 4261
78 Ga0105240_10093271 3300009093 Unclassified 3675
79 Ga0111539_10064911 3300009094 Bacteria 4317
80 Ga0105245_10144158 3300009098 Bacteria 2246
81 Ga0105247_10006144 3300009101 Bacteria 7462
82 Ga0105241_10006020 3300009174 Bacteria 8948
83 Ga0105241_10008297 3300009174 Bacteria 7646
84 Ga0105241_10175999 3300009174 Bacteria 1771
85 Ga0105241_10197138 3300009174 Bacteria 1680
86 Ga0105237_10000061 3300009545 Bacteria 146107
87 Ga0105237_10001473 3300009545 Bacteria 31011
88 Ga0105237_10002012 3300009545 Bacteria 25888
89 Ga0105237_10003775 3300009545 Bacteria 17831
90 Ga0105237_10021016 3300009545 Bacteria 6718
91 Ga0105237_10021815 3300009545 Bacteria 6578
92 Ga0105237_10024383 3300009545 Bacteria 6189
93 Ga0105237_10053004 3300009545 Bacteria 4070
94 Ga0105237_10171372 3300009545 Bacteria 2170
95 Ga0105238_10159143 3300009551 Bacteria 2234
96 Ga0105238_10208029 3300009551 Bacteria 1932
97 Ga0105249_10008673 3300009553 Bacteria 8856
98 Ga0105249_10036381 3300009553 Unclassified 4465
99 Ga0105239_10000083 3300010375 Bacteria 132046
100 Ga0105239_10000117 3300010375 Bacteria 112291
101 Ga0105239_10001081 3300010375 Bacteria 37802
102 Ga0105239_10002792 3300010375 Bacteria 21866
103 Ga0105239_10004125 3300010375 Bacteria 17450
104 Ga0105239_10018439 3300010375 Bacteria 7708
105 Ga0105239_10176197 3300010375 Bacteria 2392
106 Ga0157373_10000018 3300013100 Bacteria 169293
107 Ga0157373_10000623 3300013100 Bacteria 27754
108 Ga0157373_10023312 3300013100 Unclassified 4488
109 Ga0157371_10006378 3300013102 Bacteria 9748
110 Ga0157371_10007930 3300013102 Bacteria 8520
111 Ga0157371_10022855 3300013102 Bacteria 4575
112 Ga0157371_10045830 3300013102 Bacteria 3111
113 Ga0157370_10002316 3300013104 Bacteria 23062
114 Ga0157370_10022079 3300013104 Bacteria 6338
115 Ga0157370_10051035 3300013104 Bacteria 3952
116 Ga0157370_10189161 3300013104 Bacteria 1911
117 Ga0157369_10000439 3300013105 Bacteria 55404
118 Ga0157369_10104257 3300013105 Unclassified 3020
119 Ga0157374_10000003 3300013296 Bacteria 854471
120 Ga0157378_10019043 3300013297 Bacteria 6031
121 Ga0157378_10064924 3300013297 Bacteria 3266
122 Ga0157378_10149460 3300013297 Unclassified 2175
123 Ga0163162_10000348 3300013306 Bacteria 42027
124 Ga0163162_10003875 3300013306 Bacteria 14359
125 Ga0163162_10457850 3300013306 Unclassified 1407
126 Ga0157372_10004624 3300013307 Bacteria 14635
127 Ga0157372_10011035 3300013307 Bacteria 9617
128 Ga0157372_10029068 3300013307 Bacteria 6031
129 Ga0157372_10040735 3300013307 Bacteria 5133
130 Ga0157372_10048028 3300013307 Bacteria 4745
131 Ga0157372_10049288 3300013307 Bacteria 4683
132 Ga0157372_10083162 3300013307 Bacteria 3626
133 Ga0157372_10297532 3300013307 Unclassified 1877
134 Ga0157375_10065486 3300013308 Bacteria 3623
135 Ga0157375_10369351 3300013308 Bacteria 1601
136 Ga0163163_10013361 3300014325 Bacteria 7515
137 Ga0157377_10020262 3300014745 Bacteria 3482
138 Ga0157379_10114302 3300014968 Bacteria 2426
139 Ga0157376_10000351 3300014969 Bacteria 30762
140 Ga0157376_10004571 3300014969 Bacteria 9634
141 Ga0163161_10021228 3300017792 Bacteria 4565
142 Ga0213876_10003818 3300021384 Bacteria 8537
143 Ga0209437_100041 3300025233 Bacteria 444465
144 Ga0209026_1000258 3300025250 Bacteria 65976
145 Ga0209026_1000351 3300025250 Bacteria 43657
146 Ga0207680_10000347 3300025903 Bacteria 22173
147 Ga0207647_10067586 3300025904 Unclassified 2166
148 Ga0207645_10085045 3300025907 Bacteria 2030
149 Ga0207705_10001471 3300025909 Bacteria 18764
150 Ga0207654_10001099 3300025911 Bacteria 14634
151 Ga0207654_10004240 3300025911 Bacteria 7231
152 Ga0207654_10027891 3300025911 Unclassified 3074
153 Ga0207707_10000456 3300025912 Bacteria 42593
154 Ga0207695_10000043 3300025913 Bacteria 444585
155 Ga0207695_10000165 3300025913 Bacteria 195908
156 Ga0207695_10001728 3300025913 Bacteria 34859
157 Ga0207695_10004377 3300025913 Bacteria 19314
158 Ga0207695_10014714 3300025913 Bacteria 9252
159 Ga0207695_10023776 3300025913 Bacteria 6915
160 Ga0207695_10027715 3300025913 Bacteria 6304
161 Ga0207671_10001123 3300025914 Bacteria 32266
162 Ga0207671_10002347 3300025914 Bacteria 20399
163 Ga0207671_10003997 3300025914 Bacteria 14337
164 Ga0207671_10004806 3300025914 Bacteria 12724
165 Ga0207671_10007500 3300025914 Bacteria 9463
166 Ga0207671_10009672 3300025914 Bacteria 8030
167 Ga0207671_10015957 3300025914 Bacteria 5856
168 Ga0207660_10019460 3300025917 Bacteria 4539
169 Ga0207657_10015234 3300025919 Bacteria 7458
170 Ga0207649_10078463 3300025920 Bacteria 2131
171 Ga0207652_10000746 3300025921 Bacteria 31343
172 Ga0207652_10003953 3300025921 Bacteria 12121
173 Ga0207694_10049866 3300025924 Unclassified 3241
174 Ga0207694_10105731 3300025924 Bacteria 2235
175 Ga0207650_10018939 3300025925 Bacteria 4836
176 Ga0207690_10005853 3300025932 Bacteria 7276
177 Ga0207669_10213559 3300025937 Unclassified 1410
178 Ga0207689_10080925 3300025942 Unclassified 2670
179 Ga0207689_10218535 3300025942 Bacteria 1574
180 Ga0207661_10217164 3300025944 Unclassified 1688
181 Ga0207679_10087227 3300025945 Unclassified 2402
182 Ga0207667_10026165 3300025949 Bacteria 6379
183 Ga0207667_10063747 3300025949 Bacteria 3851
184 Ga0207712_10003431 3300025961 Bacteria 10014
185 Ga0207712_10051274 3300025961 Unclassified 2885
186 Ga0207658_10020122 3300025986 Bacteria 4621
187 Ga0207677_10017279 3300026023 Bacteria 4296
188 Ga0207703_10002529 3300026035 Bacteria 15802
189 Ga0207639_10010785 3300026041 Bacteria 6334
190 Ga0207639_10011457 3300026041 Bacteria 6161
191 Ga0207678_10277370 3300026067 Bacteria 1438
192 Ga0207641_10000530 3300026088 Bacteria 42749
193 Ga0207648_10144083 3300026089 Bacteria 2101
194 Ga0207648_10205471 3300026089 Unclassified 1748
195 Ga0207676_10012887 3300026095 Bacteria 6003
196 Ga0207676_10056922 3300026095 Unclassified 3077
197 Ga0207674_10020490 3300026116 Bacteria 7143
198 Ga0207674_10108332 3300026116 Bacteria 2755
199 Ga0207698_10004370 3300026142 Bacteria 8605
200 Ga0207698_10030157 3300026142 Bacteria 3896
201 Ga0207698_10060319 3300026142 Bacteria 2950
202 Ga0268266_10000149 3300028379 Bacteria 134809
203 Ga0268264_10000640 3300028381 Bacteria 41542
204 Ga0268264_10002522 3300028381 Bacteria 16094
205 Ga0268264_10006328 3300028381 Bacteria 9978
206 Ga0268264_10160237 3300028381 Bacteria 2026
207 Ga0265336_10007232 3300028666 Bacteria 3959
208 Ga0307517_10000129 3300028786 Bacteria 114359
209 Ga0307515_10000001 3300028794 Bacteria 4259510
210 Ga0307515_10000071 3300028794 Bacteria 238152
211 Ga0307515_10001828 3300028794 Bacteria 47434
212 Ga0307515_10239992 3300028794 Bacteria 1586
213 Ga0307511_10000138 3300030521 Bacteria 67742
214 Ga0307513_10257062 3300031456 Bacteria 1539
215 Ga0307509_10027374 3300031507 Bacteria 6343
216 Ga0307509_10038372 3300031507 Bacteria 5226
217 Ga0307509_10311944 3300031507 Bacteria 1315
218 Ga0307508_10000407 3300031616 Bacteria 51637
219 Ga0307508_10000413 3300031616 Bacteria 50697
220 Ga0307516_10001145 3300031730 Bacteria 37050
221 Ga0316577_10016809 3300031733 Bacteria 4037
222 Ga0307414_10068597 3300032004 Bacteria 2545
223 Ga0307510_10000107 3300033180 Bacteria 65945
224 Ga0307510_10005978 3300033180 Bacteria 14521
225 Ga0316584_0000659 3300036712 Bacteria 18848
226 Ga0395899_0001991 3300037312 Bacteria 16810
227 Ga0395899_0005106 3300037312 Bacteria 10215
228 Ga0395899_0050045 3300037312 Bacteria 3103
229 Ga0395900_0012647 3300037418 Bacteria 8628
230 Ga0395900_0054960 3300037418 Bacteria 4099
231 Ga0395898_0010470 3300037466 Bacteria 9694
232 Ga0395905_0004847 3300037471 Bacteria 13872
233 Ga0395905_0037393 3300037471 Bacteria 4558
234 Ga0395905_0084632 3300037471 Bacteria 2972
235 Ga0395901_0029670 3300038443 Bacteria 5632
236 Ga0395901_0035958 3300038443 Bacteria 5117
237 Ga0436365_0386921 3300039437 Bacteria 9429
238 Ga0451577_0020708 3300042876 Bacteria 6030
239 Ga0466972_0001765 3300044658 Bacteria 10603
240 Ga0466966_0034710 3300044684 Unclassified 3261
241 Ga0466961_0005031 3300044693 Bacteria 8315
242 Ga0466961_0013847 3300044693 Bacteria 5169
243 Ga0453684_0007855 3300044712 Bacteria 19419
244 Ga0453684_0024168 3300044712 Bacteria 8898
245 Ga0453684_0116476 3300044712 Bacteria 3235
246 Ga0466971_0008318 3300044719 Bacteria 4527
247 Ga0466968_0016458 3300044735 Bacteria 2945
248 Ga0466959_0004463 3300045049 Bacteria 9373
249 Ga0495638_0097643 3300046460 Bacteria 1761
250 Ga0495650_0000003 3300046471 Bacteria 900730
251 Ga0495585_0000281 3300046492 Bacteria 50967
252 Ga0495585_0000677 3300046492 Bacteria 31155
253 Ga0495596_0017098 3300046500 Bacteria 3007
254 Ga0495606_0000002 3300046507 Bacteria 554637
255 Ga0495606_0014501 3300046507 Bacteria 6144
256 Ga0495610_0000957 3300046512 Bacteria 26712
257 Ga0495616_0013761 3300046513 Bacteria 4554
258 Ga0495616_0015503 3300046513 Bacteria 4238
259 Ga0495648_0004123 3300046524 Bacteria 12513
260 Ga0495648_0008194 3300046524 Bacteria 8246
261 Ga0495609_0009375 3300046538 Bacteria 4738
262 Ga0495609_0014305 3300046538 Bacteria 3734
263 Ga0495633_0000043 3300046558 Bacteria 172356
264 Ga0495633_0015177 3300046558 Bacteria 4002
265 Ga0495668_0000127 3300046616 Bacteria 114097
266 Ga0495634_0186688 3300046642 Bacteria 1295
267 Ga0495611_0000025 3300046648 Bacteria 118583
268 Ga0495625_0000005 3300046660 Bacteria 596135
269 Ga0495625_0000175 3300046660 Bacteria 99386
270 Ga0495625_0003685 3300046660 Bacteria 14994
271 Ga0495625_0005040 3300046660 Bacteria 12253
272 Ga0495649_0000003 3300046694 Bacteria 880817
273 Ga0495687_000325 3300047443 Bacteria 61961
274 Ga0495687_049153 3300047443 Bacteria 1804
275 Ga0495686_0014210 3300047472 Bacteria 5488
276 Ga0495686_0026038 3300047472 Unclassified 3829
277 Ga0495614_0006688 3300048089 Bacteria 5162
278 Ga0495682_0037729 3300049460 Bacteria 1777
279 Ga0501043_0024312 3300049579 Bacteria 4755
280 Ga0501284_00011 3300050005 Bacteria 131008
281 nmdc:mga0k408_2762_c1 3300050493 Bacteria 9330
282 nmdc:mga0k408_29817_c1 3300050493 Bacteria 3107
283 nmdc:mga0k408_607_c1 3300050493 Bacteria 14438
284 Ga0500562_000033 3300053108 Bacteria 86295
285 Ga0500608_012909 3300053122 Bacteria 3683
286 Ga0500618_000036 3300053125 Bacteria 118803
287 Ga0500622_0000377 3300053156 Bacteria 43003
288 Ga0500622_0000396 3300053156 Bacteria 41848
289 Ga0500622_0000864 3300053156 Bacteria 25792
290 Ga0500611_000002 3300053727 Bacteria 345991
291 Ga0466962_0006062 3300061719 Bacteria 5814
292 2599477911 2599185184 Bacteria 6430550
293 2739302053 2738543023 Bacteria 6767879
294 2739304546 2738543023 Bacteria 6767879
295 2852630749 2852627209 Bacteria 5896285
296 2919188913 2919186247 Bacteria 6244071
297 2919438842 2919437846 Bacteria 6199444
298 2928079872 2928078545 Bacteria 6534839
299 2928147675 2928147474 Bacteria 6512076
300 2929158281 2929154850 Bacteria 6753285
301 2939666932 2939664404 Bacteria 6364494
302 Ga0501219_000047
303 JGI24740J21852_10014526
304 JGI24739J22299_10000730
305 JGI25162J39368_1000012
306 JGI25157J39369_1006179
307 rootH1_10034198
308 rootH2_10024381
309 rootH1_10147378
310 rootH1_10243341
311 Ga0065714_10121977
312 Ga0070683_100118049
313 Ga0070670_100113646
314 Ga0068869_100051327
315 Ga0070666_10000409
316 Ga0070666_10059582
317 Ga0070680_100006112
318 Ga0070682_100007965
319 Ga0068868_100078919
320 Ga0070660_100032128
321 Ga0070660_100103066
322 Ga0070660_100168075
323 Ga0070660_100208929
324 Ga0070691_10016433
325 Ga0070687_100016231
326 Ga0070668_100082724
327 Ga0070671_100170911
328 Ga0070674_100006451
329 Ga0070659_100000221
330 Ga0070659_100002823
331 Ga0070659_100298245
332 Ga0070667_100020541
333 Ga0070701_10051304
334 Ga0070663_100019053
335 Ga0070681_10048154
336 Ga0070679_100024085
337 Ga0070684_100027963
338 Ga0068853_100001216
339 Ga0068853_100020121
340 Ga0068853_100020950
341 Ga0068853_100025573
342 Ga0068853_100054352
343 Ga0070686_100095656
344 Ga0070693_100010884
345 Ga0070665_100000016
346 Ga0068855_100015456
347 Ga0068855_100022488
348 Ga0068855_100030411
349 Ga0070664_100018241
350 Ga0068857_100024373
351 Ga0068854_100019851
352 Ga0068856_100272087
353 Ga0068852_100004997
354 Ga0068852_100079842
355 Ga0068852_100092124
356 Ga0068859_100000030
357 Ga0068859_100010094
358 Ga0068864_100007767
359 Ga0068863_100058717
360 Ga0068863_100117232
361 Ga0068858_100004418
362 Ga0068860_100000006
363 Ga0068860_100005696
364 Ga0068860_100008359
365 Ga0068860_100012027
366 Ga0075366_10014318
367 Ga0075366_10026823
368 Ga0068871_100024664
369 Ga0075434_100039952
370 Ga0097620_100000030
371 Ga0097620_100010094
372 Ga0105240_10000095
373 Ga0105240_10000155
374 Ga0105240_10001144
375 Ga0105240_10003839
376 Ga0105240_10004890
377 Ga0105240_10055456
378 Ga0105240_10072356
379 Ga0105240_10093271
380 Ga0111539_10064911
381 Ga0105245_10144158
382 Ga0105247_10006144
383 Ga0105241_10006020
384 Ga0105241_10008297
385 Ga0105241_10175999
386 Ga0105241_10197138
387 Ga0105237_10000061
388 Ga0105237_10001473
389 Ga0105237_10002012
390 Ga0105237_10003775
391 Ga0105237_10021016
392 Ga0105237_10021815
393 Ga0105237_10024383
394 Ga0105237_10053004
395 Ga0105237_10171372
396 Ga0105238_10159143
397 Ga0105238_10208029
398 Ga0105249_10008673
399 Ga0105249_10036381
400 Ga0105239_10000083
401 Ga0105239_10000117
402 Ga0105239_10001081
403 Ga0105239_10002792
404 Ga0105239_10004125
405 Ga0105239_10018439
406 Ga0105239_10176197
407 Ga0157373_10000018
408 Ga0157373_10000623
409 Ga0157373_10023312
410 Ga0157371_10006378
411 Ga0157371_10007930
412 Ga0157371_10022855
413 Ga0157371_10045830
414 Ga0157370_10002316
415 Ga0157370_10022079
416 Ga0157370_10051035
417 Ga0157370_10189161
418 Ga0157369_10000439
419 Ga0157369_10104257
420 Ga0157374_10000003
421 Ga0157378_10019043
422 Ga0157378_10064924
423 Ga0157378_10149460
424 Ga0163162_10000348
425 Ga0163162_10003875
426 Ga0163162_10457850
427 Ga0157372_10004624
428 Ga0157372_10011035
429 Ga0157372_10029068
430 Ga0157372_10040735
431 Ga0157372_10048028
432 Ga0157372_10049288
433 Ga0157372_10083162
434 Ga0157372_10297532
435 Ga0157375_10065486
436 Ga0157375_10369351
437 Ga0163163_10013361
438 Ga0157377_10020262
439 Ga0157379_10114302
440 Ga0157376_10000351
441 Ga0157376_10004571
442 Ga0163161_10021228
443 Ga0213876_10003818
444 Ga0209437_100041
445 Ga0209026_1000258
446 Ga0209026_1000351
447 Ga0207680_10000347
448 Ga0207647_10067586
449 Ga0207645_10085045
450 Ga0207705_10001471
451 Ga0207654_10001099
452 Ga0207654_10004240
453 Ga0207654_10027891
454 Ga0207707_10000456
455 Ga0207695_10000043
456 Ga0207695_10000165
457 Ga0207695_10001728
458 Ga0207695_10004377
459 Ga0207695_10014714
460 Ga0207695_10023776
461 Ga0207695_10027715
462 Ga0207671_10001123
463 Ga0207671_10002347
464 Ga0207671_10003997
465 Ga0207671_10004806
466 Ga0207671_10007500
467 Ga0207671_10009672
468 Ga0207671_10015957
469 Ga0207660_10019460
470 Ga0207657_10015234
471 Ga0207649_10078463
472 Ga0207652_10000746
473 Ga0207652_10003953
474 Ga0207694_10049866
475 Ga0207694_10105731
476 Ga0207650_10018939
477 Ga0207690_10005853
478 Ga0207669_10213559
479 Ga0207689_10080925
480 Ga0207689_10218535
481 Ga0207661_10217164
482 Ga0207679_10087227
483 Ga0207667_10026165
484 Ga0207667_10063747
485 Ga0207712_10003431
486 Ga0207712_10051274
487 Ga0207658_10020122
488 Ga0207677_10017279
489 Ga0207703_10002529
490 Ga0207639_10010785
491 Ga0207639_10011457
492 Ga0207678_10277370
493 Ga0207641_10000530
494 Ga0207648_10144083
495 Ga0207648_10205471
496 Ga0207676_10012887
497 Ga0207676_10056922
498 Ga0207674_10020490
499 Ga0207674_10108332
500 Ga0207698_10004370
501 Ga0207698_10030157
502 Ga0207698_10060319
503 Ga0268266_10000149
504 Ga0268264_10000640
505 Ga0268264_10002522
506 Ga0268264_10006328
507 Ga0268264_10160237
508 Ga0265336_10007232
509 Ga0307517_10000129
510 Ga0307515_10000001
511 Ga0307515_10000071
512 Ga0307515_10001828
513 Ga0307515_10239992
514 Ga0307511_10000138
515 Ga0307513_10257062
516 Ga0307509_10027374
517 Ga0307509_10038372
518 Ga0307509_10311944
519 Ga0307508_10000407
520 Ga0307508_10000413
521 Ga0307516_10001145
522 Ga0316577_10016809
523 Ga0307414_10068597
524 Ga0307510_10000107
525 Ga0307510_10005978
526 Ga0316584_0000659
527 Ga0395899_0001991
528 Ga0395899_0005106
529 Ga0395899_0050045
530 Ga0395900_0012647
531 Ga0395900_0054960
532 Ga0395898_0010470
533 Ga0395905_0004847
534 Ga0395905_0037393
535 Ga0395905_0084632
536 Ga0395901_0029670
537 Ga0395901_0035958
538 Ga0436365_0386921
539 Ga0451577_0020708
540 Ga0466972_0001765
541 Ga0466966_0034710
542 Ga0466961_0005031
543 Ga0466961_0013847
544 Ga0453684_0007855
545 Ga0453684_0024168
546 Ga0453684_0116476
547 Ga0466971_0008318
548 Ga0466968_0016458
549 Ga0466959_0004463
550 Ga0495638_0097643
551 Ga0495650_0000003
552 Ga0495585_0000281
553 Ga0495585_0000677
554 Ga0495596_0017098
555 Ga0495606_0000002
556 Ga0495606_0014501
557 Ga0495610_0000957
558 Ga0495616_0013761
559 Ga0495616_0015503
560 Ga0495648_0004123
561 Ga0495648_0008194
562 Ga0495609_0009375
563 Ga0495609_0014305
564 Ga0495633_0000043
565 Ga0495633_0015177
566 Ga0495668_0000127
567 Ga0495634_0186688
568 Ga0495611_0000025
569 Ga0495625_0000005
570 Ga0495625_0000175
571 Ga0495625_0003685
572 Ga0495625_0005040
573 Ga0495649_0000003
574 Ga0495687_000325
575 Ga0495687_049153
576 Ga0495686_0014210
577 Ga0495686_0026038
578 Ga0495614_0006688
579 Ga0495682_0037729
580 Ga0501043_0024312
581 Ga0501284_00011
582 nmdc:mga0k408_2762_c1
583 nmdc:mga0k408_29817_c1
584 nmdc:mga0k408_607_c1
585 Ga0500562_000033
586 Ga0500608_012909
587 Ga0500618_000036
588 Ga0500622_0000377
589 Ga0500622_0000396
590 Ga0500622_0000864
591 Ga0500611_000002
592 Ga0466962_0006062
593 2599477911
594 2739302053
595 2739304546
596 2852630749
597 2919188913
598 2919438842
599 2928079872
600 2928147675
601 2929158281
602 2939666932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07470

Glyco_hydro_88

Glycosyl Hydrolase Family 88

77

431

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k11-assembly1.cif.gz_A crystal structure of putative glycosyl hydrolase (np_813087.1) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution 0.9354 23 403
3k11-assembly1.cif.gz_A crystal structure of putative glycosyl hydrolase (np_813087.1) from bacteroides thetaiotaomicron vpi-5482 at 1.80 a resolution 0.8698 23 403
1nc5-assembly1.cif.gz_A structure of protein of unknown function of yter from bacillus subtilis 0.8661 23 405
2gh4-assembly1.cif.gz_A yter/d143n/dgala-rha 0.8621 23 405
1nc5-assembly1.cif.gz_A structure of protein of unknown function of yter from bacillus subtilis 0.8547 23 405
ID Description Score Start End Superfamily
3k11A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.9232 22 402 1.50.10.10
2gh4A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8621 23 405 1.50.10.10
2gh4A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8507 23 405 1.50.10.10
3k11A00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8478 22 402 1.50.10.10
3pmmA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8375 17 402 1.50.10.10
ID Description Score Start End GO Terms
AF-A0A4R8DS78-F1-model_v4 Glucose/arabinose dehydrogenase 0.9954 21 403 GO:0005975
AF-A0A3N5JWK5-F1-model_v4 Glycosyl hydrolase 0.9908 164 400 GO:0005975
GO:0016787
AF-W4UW28-F1-model_v4 Rhamnogalacturonides degradation protein RhiN 0.9877 199 399 GO:0005975
AF-A0A5B8VUN0-F1-model_v4 Glycoside hydrolase family 88 protein 0.9827 14 404 GO:0005975
GO:0016787
AF-A0A1F3GYZ6-F1-model_v4 Uncharacterized protein 0.9808 264 403 GO:0005975

Map