F396198
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 204 | 287 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300053077|Ga0495601_0068528|Ga0495601_0068528_22_1218 |
| Length | 398 |
| Sequence | VSLDRFRIGFVPLVDAALPILAHELGFAEEQGVAVDLVRDVTWAAVRDRLLYGHTDAAHMVAPLAIATALGRDRPAVPMAVPFVLGLNGNAITFSTALGEACGLGEGLGDPIAVGAALREVAARQRLRFGVVHRHSSHNYMLRYWLAGVGIRPDMDVDIVVTSPPFAADALAAGEVDGICVGEPWNSIAVDRGVGRIALATAQIWRRGVEKVLAMRSDQAEERRDAVLRLIRALHAAAAHFIDPETVEQSAEILSRTAYLDAPVGAILRAITDRIRVVPGGEPVHYPDFMFQYREAANFPWRSQAGWLYAQMVRWEGLSFSNADAATAQGVFRPDLYRAALAGSGAPLPGASSKLEGALVEPIGAGSTQGRLVLGSDPFFDGRAFDPDDIPGYLKELP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 2 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 3 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 4 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 5 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 6 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 7 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 8 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 9 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 10 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 11 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 12 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 13 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 14 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 129 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 159 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 162 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 163 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 164 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 165 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 166 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 169 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 177 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 180 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 183 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 186 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 187 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 188 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 190 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 191 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 192 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 193 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 194 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 196 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 197 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 198 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 199 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 200 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 201 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 202 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 203 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 204 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.35 |
| Metatranscriptomes | 0 |
| Isolates | 4.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.66 |
| Bulb | 0 |
| Endosphere | 16.28 |
| Nodule | 0 |
| Rhizoplane | 4.32 |
| Rhizosphere | 68.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000661 | 3300001915 | Bacteria | 10421 |
| 2 | JGI24740J21852_10001652 | 3300001979 | Bacteria | 10234 |
| 3 | JGI24739J22299_10014010 | 3300001989 | Bacteria | 2920 |
| 4 | JGI25153J46596_10000075 | 3300003215 | Bacteria | 114168 |
| 5 | Ga0055525_1000058 | 3300003759 | Bacteria | 210367 |
| 6 | Ga0055542_1000842 | 3300003762 | Bacteria | 21677 |
| 7 | Ga0055529_1000040 | 3300003763 | Bacteria | 230562 |
| 8 | Ga0055530_10000093 | 3300003791 | Bacteria | 77624 |
| 9 | Ga0055530_10000104 | 3300003791 | Bacteria | 72163 |
| 10 | Ga0055531_10000854 | 3300003794 | Bacteria | 25073 |
| 11 | Ga0070658_10000486 | 3300005327 | Bacteria | 34470 |
| 12 | Ga0070658_10004780 | 3300005327 | Bacteria | 11020 |
| 13 | Ga0070676_10041780 | 3300005328 | Bacteria | 2660 |
| 14 | Ga0070666_10070893 | 3300005335 | Bacteria | 2371 |
| 15 | Ga0070666_10100993 | 3300005335 | Bacteria | 1988 |
| 16 | Ga0070660_100023830 | 3300005339 | Bacteria | 4537 |
| 17 | Ga0070661_100010094 | 3300005344 | Bacteria | 6558 |
| 18 | Ga0070668_100006192 | 3300005347 | Bacteria | 8860 |
| 19 | Ga0070668_100007888 | 3300005347 | Bacteria | 7903 |
| 20 | Ga0070669_100000659 | 3300005353 | Bacteria | 25480 |
| 21 | Ga0070669_100001143 | 3300005353 | Bacteria | 19370 |
| 22 | Ga0070675_100199005 | 3300005354 | Bacteria | 1738 |
| 23 | Ga0070671_100000040 | 3300005355 | Bacteria | 92357 |
| 24 | Ga0070671_100001027 | 3300005355 | Bacteria | 20510 |
| 25 | Ga0070671_100007178 | 3300005355 | Bacteria | 8906 |
| 26 | Ga0070674_100005747 | 3300005356 | Bacteria | 7197 |
| 27 | Ga0070674_100009123 | 3300005356 | Bacteria | 5933 |
| 28 | Ga0070667_100001272 | 3300005367 | Bacteria | 22834 |
| 29 | Ga0070667_100011008 | 3300005367 | Bacteria | 7480 |
| 30 | Ga0070663_100088802 | 3300005455 | Bacteria | 2286 |
| 31 | Ga0070663_100186363 | 3300005455 | Bacteria | 1613 |
| 32 | Ga0070678_100042153 | 3300005456 | Bacteria | 3242 |
| 33 | Ga0070662_100051588 | 3300005457 | Bacteria | 2971 |
| 34 | Ga0068853_100109657 | 3300005539 | Bacteria | 2450 |
| 35 | Ga0070665_100000169 | 3300005548 | Bacteria | 118043 |
| 36 | Ga0070665_100263263 | 3300005548 | Bacteria | 1725 |
| 37 | Ga0068855_100005354 | 3300005563 | Bacteria | 15653 |
| 38 | Ga0068855_100097859 | 3300005563 | Bacteria | 3380 |
| 39 | Ga0070664_100003863 | 3300005564 | Bacteria | 12097 |
| 40 | Ga0068854_100000459 | 3300005578 | Bacteria | 25127 |
| 41 | Ga0068854_100001010 | 3300005578 | Bacteria | 16921 |
| 42 | Ga0068854_100033461 | 3300005578 | Bacteria | 3584 |
| 43 | Ga0068854_100096540 | 3300005578 | Bacteria | 2208 |
| 44 | Ga0068854_100209636 | 3300005578 | Bacteria | 1536 |
| 45 | Ga0068856_100011271 | 3300005614 | Bacteria | 8677 |
| 46 | Ga0068852_100000231 | 3300005616 | Bacteria | 37728 |
| 47 | Ga0068859_100030291 | 3300005617 | Bacteria | 5430 |
| 48 | Ga0068859_100077259 | 3300005617 | Bacteria | 3371 |
| 49 | Ga0068859_100088781 | 3300005617 | Bacteria | 3141 |
| 50 | Ga0068851_10017063 | 3300005834 | Bacteria | 3483 |
| 51 | Ga0068863_100000131 | 3300005841 | Bacteria | 79059 |
| 52 | Ga0068863_100121763 | 3300005841 | Bacteria | 2488 |
| 53 | Ga0068858_100035149 | 3300005842 | Bacteria | 4648 |
| 54 | Ga0068858_100340856 | 3300005842 | Bacteria | 1435 |
| 55 | Ga0068860_100002824 | 3300005843 | Bacteria | 18062 |
| 56 | Ga0068860_100053350 | 3300005843 | Bacteria | 3844 |
| 57 | Ga0068860_100156545 | 3300005843 | Bacteria | 2196 |
| 58 | Ga0068860_100176421 | 3300005843 | Bacteria | 2065 |
| 59 | Ga0068862_100004950 | 3300005844 | Bacteria | 11216 |
| 60 | Ga0068862_100016090 | 3300005844 | Bacteria | 6220 |
| 61 | Ga0075363_100002516 | 3300006048 | Bacteria | 7517 |
| 62 | Ga0075364_10001358 | 3300006051 | Bacteria | 13201 |
| 63 | Ga0075364_10054807 | 3300006051 | Bacteria | 2608 |
| 64 | Ga0075362_10000042 | 3300006177 | Bacteria | 45768 |
| 65 | Ga0075367_10088114 | 3300006178 | Bacteria | 1886 |
| 66 | Ga0075366_10011165 | 3300006195 | Bacteria | 5064 |
| 67 | Ga0075370_10000026 | 3300006353 | Bacteria | 51806 |
| 68 | Ga0097620_100030291 | 3300006931 | Bacteria | 5430 |
| 69 | Ga0097620_100077259 | 3300006931 | Bacteria | 3371 |
| 70 | Ga0097620_100088781 | 3300006931 | Bacteria | 3141 |
| 71 | Ga0105251_10013183 | 3300009011 | Bacteria | 4634 |
| 72 | Ga0105240_10013931 | 3300009093 | Bacteria | 11008 |
| 73 | Ga0105240_10317611 | 3300009093 | Bacteria | 1776 |
| 74 | Ga0105247_10011698 | 3300009101 | Bacteria | 5281 |
| 75 | Ga0105241_10000452 | 3300009174 | Bacteria | 30921 |
| 76 | Ga0105242_10249420 | 3300009176 | Bacteria | 1599 |
| 77 | Ga0105248_10009758 | 3300009177 | Bacteria | 10578 |
| 78 | Ga0105248_10124408 | 3300009177 | Bacteria | 2909 |
| 79 | Ga0105237_10228679 | 3300009545 | Bacteria | 1861 |
| 80 | Ga0105237_10304411 | 3300009545 | Bacteria | 1597 |
| 81 | Ga0105249_10157944 | 3300009553 | Bacteria | 2189 |
| 82 | Ga0105239_10146287 | 3300010375 | Bacteria | 2636 |
| 83 | Ga0157371_10000148 | 3300013102 | Bacteria | 101711 |
| 84 | Ga0157370_10252404 | 3300013104 | Bacteria | 1631 |
| 85 | Ga0157370_10284659 | 3300013104 | Bacteria | 1527 |
| 86 | Ga0157369_10054717 | 3300013105 | Bacteria | 4309 |
| 87 | Ga0163162_10198164 | 3300013306 | Bacteria | 2137 |
| 88 | Ga0157376_10075905 | 3300014969 | Bacteria | 2870 |
| 89 | Ga0163161_10002387 | 3300017792 | Bacteria | 13456 |
| 90 | Ga0163161_10109339 | 3300017792 | Bacteria | 2065 |
| 91 | Ga0209674_105442 | 3300025226 | Bacteria | 1880 |
| 92 | Ga0209563_100024 | 3300025230 | Bacteria | 601155 |
| 93 | Ga0209677_101534 | 3300025253 | Bacteria | 9867 |
| 94 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 95 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 96 | Ga0209675_1000188 | 3300025291 | Bacteria | 68178 |
| 97 | Ga0209676_1000070 | 3300025292 | Bacteria | 312074 |
| 98 | Ga0209676_1000593 | 3300025292 | Bacteria | 54046 |
| 99 | Ga0209025_1027965 | 3300025294 | Bacteria | 2778 |
| 100 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 101 | Ga0209050_1000115 | 3300025298 | Bacteria | 204622 |
| 102 | Ga0209257_1000160 | 3300025304 | Bacteria | 177175 |
| 103 | Ga0207656_10022343 | 3300025321 | Bacteria | 2537 |
| 104 | Ga0207713_1001058 | 3300025735 | Bacteria | 23840 |
| 105 | Ga0207647_10005855 | 3300025904 | Bacteria | 8959 |
| 106 | Ga0207647_10016969 | 3300025904 | Bacteria | 4957 |
| 107 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 108 | Ga0207705_10000127 | 3300025909 | Bacteria | 83788 |
| 109 | Ga0207695_10023787 | 3300025913 | Bacteria | 6914 |
| 110 | Ga0207695_10224743 | 3300025913 | Bacteria | 1784 |
| 111 | Ga0207695_10224789 | 3300025913 | Bacteria | 1784 |
| 112 | Ga0207671_10008129 | 3300025914 | Bacteria | 8952 |
| 113 | Ga0207657_10035661 | 3300025919 | Bacteria | 4459 |
| 114 | Ga0207649_10001574 | 3300025920 | Bacteria | 13298 |
| 115 | Ga0207681_10000393 | 3300025923 | Bacteria | 30649 |
| 116 | Ga0207681_10001400 | 3300025923 | Bacteria | 15582 |
| 117 | Ga0207681_10094471 | 3300025923 | Bacteria | 2143 |
| 118 | Ga0207694_10006451 | 3300025924 | Bacteria | 8938 |
| 119 | Ga0207659_10156350 | 3300025926 | Bacteria | 1786 |
| 120 | Ga0207644_10000005 | 3300025931 | Bacteria | 441948 |
| 121 | Ga0207644_10000148 | 3300025931 | Bacteria | 50390 |
| 122 | Ga0207644_10001680 | 3300025931 | Bacteria | 14272 |
| 123 | Ga0207690_10000965 | 3300025932 | Bacteria | 18393 |
| 124 | Ga0207690_10068983 | 3300025932 | Bacteria | 2431 |
| 125 | Ga0207709_10000109 | 3300025935 | Bacteria | 128086 |
| 126 | Ga0207669_10000059 | 3300025937 | Bacteria | 54857 |
| 127 | Ga0207669_10000384 | 3300025937 | Bacteria | 19532 |
| 128 | Ga0207711_10005031 | 3300025941 | Bacteria | 11212 |
| 129 | Ga0207711_10356780 | 3300025941 | Bacteria | 1354 |
| 130 | Ga0207679_10022618 | 3300025945 | Bacteria | 4283 |
| 131 | Ga0207667_10000074 | 3300025949 | Bacteria | 171635 |
| 132 | Ga0207667_10005425 | 3300025949 | Bacteria | 15550 |
| 133 | Ga0207667_10372121 | 3300025949 | Bacteria | 1456 |
| 134 | Ga0207712_10030818 | 3300025961 | Bacteria | 3608 |
| 135 | Ga0207668_10003853 | 3300025972 | Bacteria | 8839 |
| 136 | Ga0207668_10003931 | 3300025972 | Bacteria | 8761 |
| 137 | Ga0207668_10083125 | 3300025972 | Bacteria | 2329 |
| 138 | Ga0207640_10000508 | 3300025981 | Bacteria | 23527 |
| 139 | Ga0207640_10000554 | 3300025981 | Bacteria | 22430 |
| 140 | Ga0207640_10005413 | 3300025981 | Bacteria | 6961 |
| 141 | Ga0207658_10000955 | 3300025986 | Bacteria | 23859 |
| 142 | Ga0207658_10093116 | 3300025986 | Bacteria | 2342 |
| 143 | Ga0207703_10069077 | 3300026035 | Bacteria | 2912 |
| 144 | Ga0207703_10107982 | 3300026035 | Bacteria | 2370 |
| 145 | Ga0207702_10004366 | 3300026078 | Bacteria | 12605 |
| 146 | Ga0207641_10000004 | 3300026088 | Bacteria | 481088 |
| 147 | Ga0207641_10005938 | 3300026088 | Bacteria | 10349 |
| 148 | Ga0207648_10053104 | 3300026089 | Bacteria | 3543 |
| 149 | Ga0207674_10227772 | 3300026116 | Bacteria | 1812 |
| 150 | Ga0207683_10002089 | 3300026121 | Bacteria | 17609 |
| 151 | Ga0207698_10000058 | 3300026142 | Bacteria | 78048 |
| 152 | Ga0207698_10001783 | 3300026142 | Bacteria | 12574 |
| 153 | Ga0207698_10094578 | 3300026142 | Bacteria | 2457 |
| 154 | Ga0268266_10000480 | 3300028379 | Bacteria | 57568 |
| 155 | Ga0268265_10046379 | 3300028380 | Bacteria | 3248 |
| 156 | Ga0268264_10002511 | 3300028381 | Bacteria | 16129 |
| 157 | Ga0268264_10007130 | 3300028381 | Bacteria | 9367 |
| 158 | Ga0268264_10021902 | 3300028381 | Bacteria | 5216 |
| 159 | Ga0268264_10285020 | 3300028381 | Bacteria | 1549 |
| 160 | Ga0307517_10037580 | 3300028786 | Bacteria | 5401 |
| 161 | Ga0307408_100107602 | 3300031548 | Bacteria | 2135 |
| 162 | Ga0307408_100130029 | 3300031548 | Bacteria | 1963 |
| 163 | Ga0307405_10000949 | 3300031731 | Bacteria | 11579 |
| 164 | Ga0307405_10004639 | 3300031731 | Bacteria | 6524 |
| 165 | Ga0307405_10081083 | 3300031731 | Bacteria | 2120 |
| 166 | Ga0307413_10015035 | 3300031824 | Bacteria | 3954 |
| 167 | Ga0307413_10165396 | 3300031824 | Bacteria | 1559 |
| 168 | Ga0307410_10201457 | 3300031852 | Bacteria | 1520 |
| 169 | Ga0307406_10001389 | 3300031901 | Bacteria | 13476 |
| 170 | Ga0307412_10010786 | 3300031911 | Bacteria | 5273 |
| 171 | Ga0307412_10015951 | 3300031911 | Bacteria | 4463 |
| 172 | Ga0307412_10029158 | 3300031911 | Bacteria | 3461 |
| 173 | Ga0307412_10037976 | 3300031911 | Bacteria | 3097 |
| 174 | Ga0307409_100110052 | 3300031995 | Bacteria | 2308 |
| 175 | Ga0307409_100451939 | 3300031995 | Bacteria | 1240 |
| 176 | Ga0307416_100138572 | 3300032002 | Bacteria | 2206 |
| 177 | Ga0307414_10001704 | 3300032004 | Bacteria | 11449 |
| 178 | Ga0307414_10003444 | 3300032004 | Bacteria | 8446 |
| 179 | Ga0307414_10034920 | 3300032004 | Bacteria | 3339 |
| 180 | Ga0307414_10165624 | 3300032004 | Bacteria | 1761 |
| 181 | Ga0373962_0022834 | 3300035242 | Bacteria | 1662 |
| 182 | Ga0395899_0019969 | 3300037312 | Bacteria | 5083 |
| 183 | Ga0395901_0297922 | 3300038443 | Bacteria | 1672 |
| 184 | Ga0439462_0001193 | 3300042015 | Bacteria | 5682 |
| 185 | Ga0495650_0000058 | 3300046471 | Bacteria | 302308 |
| 186 | Ga0495584_0004747 | 3300046491 | Bacteria | 7275 |
| 187 | Ga0495584_0067451 | 3300046491 | Bacteria | 1798 |
| 188 | Ga0495585_0012409 | 3300046492 | Bacteria | 5020 |
| 189 | Ga0495596_0040387 | 3300046500 | Bacteria | 1842 |
| 190 | Ga0495583_0000673 | 3300046506 | Bacteria | 44600 |
| 191 | Ga0495583_0003905 | 3300046506 | Bacteria | 11037 |
| 192 | Ga0495583_0032183 | 3300046506 | Bacteria | 2533 |
| 193 | Ga0495583_0036559 | 3300046506 | Bacteria | 2334 |
| 194 | Ga0495606_0001811 | 3300046507 | Bacteria | 27176 |
| 195 | Ga0495610_0001553 | 3300046512 | Bacteria | 20242 |
| 196 | Ga0495620_0010179 | 3300046515 | Bacteria | 4967 |
| 197 | Ga0495631_0015276 | 3300046518 | Bacteria | 3682 |
| 198 | Ga0495632_0123161 | 3300046519 | Bacteria | 1210 |
| 199 | Ga0495637_0013938 | 3300046520 | Bacteria | 3804 |
| 200 | Ga0495643_0000557 | 3300046522 | Bacteria | 46202 |
| 201 | Ga0495643_0004800 | 3300046522 | Bacteria | 9321 |
| 202 | Ga0495643_0005754 | 3300046522 | Bacteria | 8294 |
| 203 | Ga0495643_0023176 | 3300046522 | Bacteria | 3531 |
| 204 | Ga0495648_0000498 | 3300046524 | Bacteria | 42255 |
| 205 | Ga0495663_0000325 | 3300046525 | Bacteria | 17863 |
| 206 | Ga0495609_0028181 | 3300046538 | Bacteria | 2564 |
| 207 | Ga0495597_0008130 | 3300046542 | Bacteria | 5277 |
| 208 | Ga0495622_0004213 | 3300046557 | Bacteria | 6706 |
| 209 | Ga0495633_0001087 | 3300046558 | Bacteria | 21944 |
| 210 | Ga0495668_0000098 | 3300046616 | Bacteria | 138553 |
| 211 | Ga0495668_0018815 | 3300046616 | Bacteria | 3991 |
| 212 | Ga0495625_0005013 | 3300046660 | Bacteria | 12283 |
| 213 | Ga0495625_0008659 | 3300046660 | Bacteria | 8651 |
| 214 | Ga0495625_0033817 | 3300046660 | Bacteria | 3776 |
| 215 | Ga0495669_0000026 | 3300046684 | Bacteria | 111814 |
| 216 | Ga0495670_0002829 | 3300046691 | Bacteria | 8587 |
| 217 | Ga0495649_0015220 | 3300046694 | Bacteria | 4379 |
| 218 | Ga0495649_0057746 | 3300046694 | Bacteria | 2092 |
| 219 | Ga0495600_0000389 | 3300046809 | Bacteria | 22709 |
| 220 | Ga0495660_0016883 | 3300046810 | Bacteria | 4206 |
| 221 | Ga0495683_0004258 | 3300047323 | Bacteria | 8166 |
| 222 | Ga0495683_0058507 | 3300047323 | Bacteria | 1914 |
| 223 | Ga0495687_000123 | 3300047443 | Bacteria | 118577 |
| 224 | Ga0495687_000285 | 3300047443 | Bacteria | 66562 |
| 225 | Ga0495681_0001526 | 3300047470 | Bacteria | 17269 |
| 226 | Ga0495681_0068301 | 3300047470 | Bacteria | 1618 |
| 227 | Ga0496101_0092955 | 3300048904 | Bacteria | 2246 |
| 228 | Ga0496101_0169963 | 3300048904 | Bacteria | 1675 |
| 229 | Ga0496102_0000092 | 3300048905 | Bacteria | 125879 |
| 230 | Ga0496103_0000101 | 3300048906 | Bacteria | 93679 |
| 231 | Ga0496103_0007086 | 3300048906 | Bacteria | 6694 |
| 232 | Ga0496104_0009124 | 3300048907 | Bacteria | 8819 |
| 233 | Ga0496105_0001224 | 3300048908 | Bacteria | 17875 |
| 234 | Ga0496106_0002615 | 3300048909 | Bacteria | 13399 |
| 235 | Ga0496107_0025116 | 3300048910 | Bacteria | 4217 |
| 236 | Ga0496111_0006559 | 3300048914 | Bacteria | 7567 |
| 237 | Ga0496113_0002879 | 3300048916 | Bacteria | 10132 |
| 238 | Ga0496114_0004414 | 3300048917 | Bacteria | 10917 |
| 239 | Ga0496115_0000038 | 3300048918 | Bacteria | 125104 |
| 240 | Ga0496116_0000627 | 3300048919 | Bacteria | 46393 |
| 241 | Ga0496116_0009876 | 3300048919 | Bacteria | 8075 |
| 242 | Ga0496117_0000173 | 3300048920 | Bacteria | 133415 |
| 243 | Ga0496118_0000131 | 3300048921 | Bacteria | 133116 |
| 244 | Ga0496119_0009367 | 3300048922 | Bacteria | 8420 |
| 245 | Ga0496119_0026232 | 3300048922 | Bacteria | 4044 |
| 246 | Ga0496120_0004518 | 3300048923 | Bacteria | 11632 |
| 247 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 248 | Ga0496121_0000209 | 3300048924 | Bacteria | 129740 |
| 249 | Ga0496121_0003675 | 3300048924 | Bacteria | 21549 |
| 250 | Ga0496121_0023519 | 3300048924 | Bacteria | 5930 |
| 251 | Ga0496122_0001686 | 3300048925 | Bacteria | 34241 |
| 252 | Ga0496122_0052224 | 3300048925 | Bacteria | 3097 |
| 253 | Ga0496123_0003133 | 3300048926 | Bacteria | 18969 |
| 254 | Ga0496123_0069644 | 3300048926 | Bacteria | 2207 |
| 255 | Ga0496124_0000166 | 3300048927 | Bacteria | 133634 |
| 256 | Ga0496125_0000390 | 3300048928 | Bacteria | 81748 |
| 257 | Ga0496125_0009487 | 3300048928 | Bacteria | 9988 |
| 258 | Ga0496125_0018739 | 3300048928 | Bacteria | 6561 |
| 259 | Ga0496126_0000222 | 3300048929 | Bacteria | 123936 |
| 260 | Ga0496126_0018631 | 3300048929 | Bacteria | 6871 |
| 261 | Ga0501257_000098 | 3300049686 | Bacteria | 20774 |
| 262 | Ga0501280_000355 | 3300049776 | Bacteria | 11410 |
| 263 | Ga0501044_0000121 | 3300049823 | Bacteria | 93902 |
| 264 | nmdc:mga03683_53_c1 | 3300050489 | Bacteria | 47904 |
| 265 | nmdc:mga03n38_2795_c1 | 3300050490 | Bacteria | 5482 |
| 266 | nmdc:mga00v17_5090_c1 | 3300050491 | Bacteria | 6906 |
| 267 | nmdc:mga0k408_499_c1 | 3300050493 | Bacteria | 21537 |
| 268 | nmdc:mga0k408_5_c2 | 3300050493 | Bacteria | 142245 |
| 269 | nmdc:mga07m45_30_c1 | 3300050496 | Bacteria | 85279 |
| 270 | nmdc:mga0sz30_78_c2 | 3300050516 | Bacteria | 28116 |
| 271 | Ga0495601_0068528 | 3300053077 | Bacteria | 2262 |
| 272 | Ga0500610_0000169 | 3300053079 | Bacteria | 19508 |
| 273 | Ga0500643_000139 | 3300053087 | Bacteria | 73348 |
| 274 | Ga0500592_000096 | 3300053116 | Bacteria | 19420 |
| 275 | Ga0500595_000230 | 3300053119 | Bacteria | 37914 |
| 276 | Ga0500608_000224 | 3300053122 | Bacteria | 22253 |
| 277 | Ga0500618_001521 | 3300053125 | Bacteria | 10201 |
| 278 | Ga0500559_0065143 | 3300053136 | Bacteria | 1632 |
| 279 | Ga0500573_0126988 | 3300053140 | Bacteria | 1415 |
| 280 | Ga0500622_0001336 | 3300053156 | Bacteria | 19980 |
| 281 | Ga0500627_0000119 | 3300053158 | Bacteria | 24541 |
| 282 | Ga0500627_0004611 | 3300053158 | Bacteria | 4456 |
| 283 | Ga0500636_0002265 | 3300053177 | Bacteria | 10680 |
| 284 | Ga0500567_000658 | 3300053723 | Bacteria | 12534 |
| 285 | Ga0500625_000037 | 3300053729 | Bacteria | 44475 |
| 286 | Ga0500645_000045 | 3300053730 | Bacteria | 108141 |
| 287 | Ga0500596_002065 | 3300053735 | Bacteria | 4000 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2993693658 | 2993696090 | 348 |
| 2 | 3300046519 | Ga0495632_0123161 | Ga0495632_0123161_14_1105 | 363 |
| 3 | 3300005347 | Ga0070668_100006192 | Ga0070668_1000061924 | 379 |
| 4 | 3300005355 | Ga0070671_100001027 | Ga0070671_10000102714 | 379 |
| 5 | 3300005617 | Ga0068859_100088781 | Ga0068859_1000887814 | 384 |
| 6 | 3300005841 | Ga0068863_100000131 | Ga0068863_10000013184 | 384 |
| 7 | 3300005843 | Ga0068860_100176421 | Ga0068860_1001764212 | 384 |
| 8 | 3300006931 | Ga0097620_100088781 | Ga0097620_1000887811 | 384 |
| 9 | 3300025931 | Ga0207644_10001680 | Ga0207644_1000168013 | 384 |
| 10 | 3300025961 | Ga0207712_10030818 | Ga0207712_100308185 | 384 |
| 11 | 3300025972 | Ga0207668_10003853 | Ga0207668_100038534 | 384 |
| 12 | 3300026088 | Ga0207641_10000004 | Ga0207641_10000004311 | 384 |
| 13 | 3300028381 | Ga0268264_10002511 | Ga0268264_100025112 | 384 |
| 14 | 3300032004 | Ga0307414_10003444 | Ga0307414_100034443 | 385 |
| 15 | 3300005578 | Ga0068854_100001010 | Ga0068854_10000101011 | 386 |
| 16 | 3300025981 | Ga0207640_10000554 | Ga0207640_100005546 | 386 |
| 17 | 3300026142 | Ga0207698_10094578 | Ga0207698_100945782 | 386 |
| 18 | 3300049686 | Ga0501257_000098 | Ga0501257_000098_147_1370 | 391 |
| 19 | 3300049776 | Ga0501280_000355 | Ga0501280_000355_2188_3411 | 391 |
| 20 | 3300046507 | Ga0495606_0001811 | Ga0495606_0001811_25221_26432 | 395 |
| 21 | 3300053158 | Ga0500627_0004611 | Ga0500627_0004611_893_2116 | 395 |
| 22 | 3300001989 | JGI24739J22299_10014010 | JGI24739J22299_100140102 | 397 |
| 23 | 3300005367 | Ga0070667_100011008 | Ga0070667_1000110084 | 397 |
| 24 | 3300005457 | Ga0070662_100051588 | Ga0070662_1000515882 | 397 |
| 25 | 3300017792 | Ga0163161_10109339 | Ga0163161_101093392 | 397 |
| 26 | 3300025904 | Ga0207647_10005855 | Ga0207647_100058553 | 397 |
| 27 | 3300025986 | Ga0207658_10093116 | Ga0207658_100931162 | 397 |
| 28 | 3300046506 | Ga0495583_0036559 | Ga0495583_0036559_799_2010 | 397 |
| 29 | 3300046524 | Ga0495648_0000498 | Ga0495648_0000498_27100_28311 | 397 |
| 30 | 3300046525 | Ga0495663_0000325 | Ga0495663_0000325_16014_17225 | 397 |
| 31 | 3300046694 | Ga0495649_0015220 | Ga0495649_0015220_482_1693 | 397 |
| 32 | 3300047323 | Ga0495683_0004258 | Ga0495683_0004258_2849_4060 | 397 |
| 33 | 3300048925 | Ga0496122_0001686 | Ga0496122_0001686_15432_16643 | 397 |
| 34 | 3300048926 | Ga0496123_0003133 | Ga0496123_0003133_1536_2747 | 397 |
| 35 | 3300048928 | Ga0496125_0000390 | Ga0496125_0000390_34358_35569 | 397 |
| 36 | 3300053077 | Ga0495601_0068528 | Ga0495601_0068528_22_1218 | 398 |
| 37 | iso_pu_bacteria | 2643221588 | 2643951509 | 398 |
| 38 | iso_pu_bacteria | 2852680915 | 2852682990 | 398 |
| 39 | iso_pu_bacteria | 2919138771 | 2919140267 | 398 |
| 40 | iso_pu_bacteria | 2928100450 | 2928104365 | 398 |
| 41 | iso_pu_bacteria | 2928959182 | 2928962968 | 398 |
| 42 | iso_pu_bacteria | 2928027323 | 2928028757 | 399 |
| 43 | iso_pu_bacteria | 2984555340 | 2984555415 | 399 |
| 44 | iso_pu_bacteria | 2984564862 | 2984566448 | 399 |
| 45 | iso_pu_bacteria | 2990265787 | 2990266116 | 399 |
| 46 | iso_pu_bacteria | 2993356040 | 2993357486 | 399 |
| 47 | iso_pu_bacteria | 8057101203 | 8057105867 | 399 |
| 48 | 3300005578 | Ga0068854_100209636 | Ga0068854_1002096362 | 401 |
| 49 | 3300010375 | Ga0105239_10146287 | Ga0105239_101462873 | 401 |
| 50 | 3300031548 | Ga0307408_100107602 | Ga0307408_1001076021 | 401 |
| 51 | 3300031731 | Ga0307405_10004639 | Ga0307405_100046392 | 401 |
| 52 | 3300031901 | Ga0307406_10001389 | Ga0307406_100013898 | 401 |
| 53 | 3300031911 | Ga0307412_10015951 | Ga0307412_100159512 | 401 |
| 54 | 3300032002 | Ga0307416_100138572 | Ga0307416_1001385721 | 401 |
| 55 | 3300053087 | Ga0500643_000139 | Ga0500643_000139_41280_42503 | 401 |
| 56 | 3300053116 | Ga0500592_000096 | Ga0500592_000096_10056_11279 | 401 |
| 57 | 3300053158 | Ga0500627_0000119 | Ga0500627_0000119_8135_9358 | 401 |
| 58 | 3300005327 | Ga0070658_10000486 | Ga0070658_100004865 | 402 |
| 59 | 3300005335 | Ga0070666_10070893 | Ga0070666_100708931 | 402 |
| 60 | 3300005335 | Ga0070666_10100993 | Ga0070666_101009933 | 402 |
| 61 | 3300005347 | Ga0070668_100007888 | Ga0070668_1000078883 | 402 |
| 62 | 3300005353 | Ga0070669_100000659 | Ga0070669_10000065911 | 402 |
| 63 | 3300005353 | Ga0070669_100001143 | Ga0070669_10000114310 | 402 |
| 64 | 3300005355 | Ga0070671_100000040 | Ga0070671_10000004053 | 402 |
| 65 | 3300005355 | Ga0070671_100007178 | Ga0070671_1000071786 | 402 |
| 66 | 3300005367 | Ga0070667_100001272 | Ga0070667_10000127215 | 402 |
| 67 | 3300005455 | Ga0070663_100186363 | Ga0070663_1001863631 | 402 |
| 68 | 3300005548 | Ga0070665_100000169 | Ga0070665_10000016924 | 402 |
| 69 | 3300005548 | Ga0070665_100263263 | Ga0070665_1002632632 | 402 |
| 70 | 3300005563 | Ga0068855_100005354 | Ga0068855_10000535414 | 402 |
| 71 | 3300005578 | Ga0068854_100000459 | Ga0068854_10000045923 | 402 |
| 72 | 3300005578 | Ga0068854_100096540 | Ga0068854_1000965403 | 402 |
| 73 | 3300005614 | Ga0068856_100011271 | Ga0068856_1000112716 | 402 |
| 74 | 3300005616 | Ga0068852_100000231 | Ga0068852_10000023124 | 402 |
| 75 | 3300005617 | Ga0068859_100077259 | Ga0068859_1000772591 | 402 |
| 76 | 3300005841 | Ga0068863_100121763 | Ga0068863_1001217632 | 402 |
| 77 | 3300005842 | Ga0068858_100035149 | Ga0068858_1000351494 | 402 |
| 78 | 3300005842 | Ga0068858_100340856 | Ga0068858_1003408561 | 402 |
| 79 | 3300005843 | Ga0068860_100002824 | Ga0068860_10000282410 | 402 |
| 80 | 3300005843 | Ga0068860_100053350 | Ga0068860_1000533504 | 402 |
| 81 | 3300005844 | Ga0068862_100004950 | Ga0068862_1000049503 | 402 |
| 82 | 3300005844 | Ga0068862_100016090 | Ga0068862_1000160902 | 402 |
| 83 | 3300006048 | Ga0075363_100002516 | Ga0075363_1000025167 | 402 |
| 84 | 3300006051 | Ga0075364_10001358 | Ga0075364_100013586 | 402 |
| 85 | 3300006051 | Ga0075364_10054807 | Ga0075364_100548073 | 402 |
| 86 | 3300006177 | Ga0075362_10000042 | Ga0075362_100000428 | 402 |
| 87 | 3300006178 | Ga0075367_10088114 | Ga0075367_100881142 | 402 |
| 88 | 3300006195 | Ga0075366_10011165 | Ga0075366_100111654 | 402 |
| 89 | 3300006353 | Ga0075370_10000026 | Ga0075370_100000263 | 402 |
| 90 | 3300006931 | Ga0097620_100077259 | Ga0097620_1000772591 | 402 |
| 91 | 3300009011 | Ga0105251_10013183 | Ga0105251_100131833 | 402 |
| 92 | 3300009101 | Ga0105247_10011698 | Ga0105247_100116983 | 402 |
| 93 | 3300009177 | Ga0105248_10009758 | Ga0105248_100097585 | 402 |
| 94 | 3300009177 | Ga0105248_10124408 | Ga0105248_101244082 | 402 |
| 95 | 3300009553 | Ga0105249_10157944 | Ga0105249_101579442 | 402 |
| 96 | 3300013306 | Ga0163162_10198164 | Ga0163162_101981642 | 402 |
| 97 | 3300017792 | Ga0163161_10002387 | Ga0163161_100023871 | 402 |
| 98 | 3300025735 | Ga0207713_1001058 | Ga0207713_100105811 | 402 |
| 99 | 3300025904 | Ga0207647_10016969 | Ga0207647_100169692 | 402 |
| 100 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004167 | 402 |
| 101 | 3300025913 | Ga0207695_10023787 | Ga0207695_100237876 | 402 |
| 102 | 3300025923 | Ga0207681_10000393 | Ga0207681_1000039314 | 402 |
| 103 | 3300025923 | Ga0207681_10001400 | Ga0207681_100014009 | 402 |
| 104 | 3300025923 | Ga0207681_10094471 | Ga0207681_100944712 | 402 |
| 105 | 3300025931 | Ga0207644_10000005 | Ga0207644_10000005399 | 402 |
| 106 | 3300025931 | Ga0207644_10000148 | Ga0207644_1000014818 | 402 |
| 107 | 3300025941 | Ga0207711_10005031 | Ga0207711_100050314 | 402 |
| 108 | 3300025941 | Ga0207711_10356780 | Ga0207711_103567802 | 402 |
| 109 | 3300025949 | Ga0207667_10005425 | Ga0207667_100054258 | 402 |
| 110 | 3300025972 | Ga0207668_10003931 | Ga0207668_100039314 | 402 |
| 111 | 3300025972 | Ga0207668_10083125 | Ga0207668_100831252 | 402 |
| 112 | 3300025981 | Ga0207640_10000508 | Ga0207640_100005086 | 402 |
| 113 | 3300025986 | Ga0207658_10000955 | Ga0207658_1000095514 | 402 |
| 114 | 3300026035 | Ga0207703_10069077 | Ga0207703_100690772 | 402 |
| 115 | 3300026035 | Ga0207703_10107982 | Ga0207703_101079822 | 402 |
| 116 | 3300026078 | Ga0207702_10004366 | Ga0207702_100043667 | 402 |
| 117 | 3300026088 | Ga0207641_10005938 | Ga0207641_100059387 | 402 |
| 118 | 3300026116 | Ga0207674_10227772 | Ga0207674_102277721 | 402 |
| 119 | 3300026142 | Ga0207698_10000058 | Ga0207698_1000005824 | 402 |
| 120 | 3300028379 | Ga0268266_10000480 | Ga0268266_1000048017 | 402 |
| 121 | 3300028380 | Ga0268265_10046379 | Ga0268265_100463792 | 402 |
| 122 | 3300028381 | Ga0268264_10007130 | Ga0268264_100071304 | 402 |
| 123 | 3300028381 | Ga0268264_10021902 | Ga0268264_100219024 | 402 |
| 124 | 3300031548 | Ga0307408_100130029 | Ga0307408_1001300292 | 402 |
| 125 | 3300031731 | Ga0307405_10000949 | Ga0307405_100009496 | 402 |
| 126 | 3300031731 | Ga0307405_10081083 | Ga0307405_100810831 | 402 |
| 127 | 3300031824 | Ga0307413_10015035 | Ga0307413_100150352 | 402 |
| 128 | 3300031824 | Ga0307413_10165396 | Ga0307413_101653962 | 402 |
| 129 | 3300031852 | Ga0307410_10201457 | Ga0307410_102014571 | 402 |
| 130 | 3300031911 | Ga0307412_10010786 | Ga0307412_100107863 | 402 |
| 131 | 3300031911 | Ga0307412_10029158 | Ga0307412_100291583 | 402 |
| 132 | 3300031995 | Ga0307409_100110052 | Ga0307409_1001100522 | 402 |
| 133 | 3300031995 | Ga0307409_100451939 | Ga0307409_1004519391 | 402 |
| 134 | 3300032004 | Ga0307414_10034920 | Ga0307414_100349202 | 402 |
| 135 | 3300035242 | Ga0373962_0022834 | Ga0373962_0022834_173_1381 | 402 |
| 136 | 3300042015 | Ga0439462_0001193 | Ga0439462_0001193_732_1940 | 402 |
| 137 | 3300046506 | Ga0495583_0032183 | Ga0495583_0032183_83_1291 | 402 |
| 138 | 3300046512 | Ga0495610_0001553 | Ga0495610_0001553_9761_10969 | 402 |
| 139 | 3300046515 | Ga0495620_0010179 | Ga0495620_0010179_3131_4339 | 402 |
| 140 | 3300046522 | Ga0495643_0005754 | Ga0495643_0005754_5653_6861 | 402 |
| 141 | 3300046538 | Ga0495609_0028181 | Ga0495609_0028181_680_1888 | 402 |
| 142 | 3300048904 | Ga0496101_0092955 | Ga0496101_0092955_635_1843 | 402 |
| 143 | 3300048904 | Ga0496101_0169963 | Ga0496101_0169963_159_1367 | 402 |
| 144 | 3300048906 | Ga0496103_0007086 | Ga0496103_0007086_1100_2308 | 402 |
| 145 | 3300048909 | Ga0496106_0002615 | Ga0496106_0002615_10130_11338 | 402 |
| 146 | 3300048916 | Ga0496113_0002879 | Ga0496113_0002879_763_1971 | 402 |
| 147 | 3300048919 | Ga0496116_0009876 | Ga0496116_0009876_3657_4865 | 402 |
| 148 | 3300048922 | Ga0496119_0026232 | Ga0496119_0026232_2145_3353 | 402 |
| 149 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_117575_118783 | 402 |
| 150 | 3300048924 | Ga0496121_0003675 | Ga0496121_0003675_8778_9986 | 402 |
| 151 | 3300048925 | Ga0496122_0052224 | Ga0496122_0052224_365_1573 | 402 |
| 152 | 3300048926 | Ga0496123_0069644 | Ga0496123_0069644_285_1493 | 402 |
| 153 | 3300048928 | Ga0496125_0009487 | Ga0496125_0009487_8467_9675 | 402 |
| 154 | 3300048928 | Ga0496125_0018739 | Ga0496125_0018739_4933_6141 | 402 |
| 155 | 3300048929 | Ga0496126_0018631 | Ga0496126_0018631_1157_2365 | 402 |
| 156 | 3300050489 | nmdc:mga03683_53_c1 | nmdc:mga03683_53_c1_41711_42919 | 402 |
| 157 | 3300050490 | nmdc:mga03n38_2795_c1 | nmdc:mga03n38_2795_c1_2351_3559 | 402 |
| 158 | 3300050491 | nmdc:mga00v17_5090_c1 | nmdc:mga00v17_5090_c1_1583_2791 | 402 |
| 159 | 3300050493 | nmdc:mga0k408_499_c1 | nmdc:mga0k408_499_c1_8624_9832 | 402 |
| 160 | 3300050493 | nmdc:mga0k408_5_c2 | nmdc:mga0k408_5_c2_70542_71750 | 402 |
| 161 | 3300050496 | nmdc:mga07m45_30_c1 | nmdc:mga07m45_30_c1_27094_28302 | 402 |
| 162 | 3300050516 | nmdc:mga0sz30_78_c2 | nmdc:mga0sz30_78_c2_18962_20170 | 402 |
| 163 | 3300053122 | Ga0500608_000224 | Ga0500608_000224_1893_3107 | 402 |
| 164 | 3300053125 | Ga0500618_001521 | Ga0500618_001521_3926_5134 | 402 |
| 165 | 3300053140 | Ga0500573_0126988 | Ga0500573_0126988_59_1273 | 402 |
| 166 | 3300053156 | Ga0500622_0001336 | Ga0500622_0001336_14616_15824 | 402 |
| 167 | 3300053723 | Ga0500567_000658 | Ga0500567_000658_583_1797 | 402 |
| 168 | 3300053729 | Ga0500625_000037 | Ga0500625_000037_31889_33103 | 402 |
| 169 | iso_pu_bacteria | 2739367664 | 2739650260 | 402 |
| 170 | iso_pu_bacteria | 2739367865 | 2740028733 | 402 |
| 171 | 3300001915 | JGI24741J21665_1000661 | JGI24741J21665_10006617 | 403 |
| 172 | 3300001979 | JGI24740J21852_10001652 | JGI24740J21852_100016524 | 403 |
| 173 | 3300003215 | JGI25153J46596_10000075 | JGI25153J46596_10000075106 | 403 |
| 174 | 3300003759 | Ga0055525_1000058 | Ga0055525_100005890 | 403 |
| 175 | 3300003762 | Ga0055542_1000842 | Ga0055542_10008424 | 403 |
| 176 | 3300003763 | Ga0055529_1000040 | Ga0055529_100004023 | 403 |
| 177 | 3300003791 | Ga0055530_10000093 | Ga0055530_1000009339 | 403 |
| 178 | 3300003791 | Ga0055530_10000104 | Ga0055530_100001049 | 403 |
| 179 | 3300003794 | Ga0055531_10000854 | Ga0055531_100008546 | 403 |
| 180 | 3300005327 | Ga0070658_10004780 | Ga0070658_100047804 | 403 |
| 181 | 3300005328 | Ga0070676_10041780 | Ga0070676_100417801 | 403 |
| 182 | 3300005339 | Ga0070660_100023830 | Ga0070660_1000238305 | 403 |
| 183 | 3300005344 | Ga0070661_100010094 | Ga0070661_1000100944 | 403 |
| 184 | 3300005354 | Ga0070675_100199005 | Ga0070675_1001990052 | 403 |
| 185 | 3300005356 | Ga0070674_100005747 | Ga0070674_1000057471 | 403 |
| 186 | 3300005356 | Ga0070674_100009123 | Ga0070674_1000091231 | 403 |
| 187 | 3300005455 | Ga0070663_100088802 | Ga0070663_1000888022 | 403 |
| 188 | 3300005456 | Ga0070678_100042153 | Ga0070678_1000421533 | 403 |
| 189 | 3300005539 | Ga0068853_100109657 | Ga0068853_1001096572 | 403 |
| 190 | 3300005563 | Ga0068855_100097859 | Ga0068855_1000978592 | 403 |
| 191 | 3300005564 | Ga0070664_100003863 | Ga0070664_1000038639 | 403 |
| 192 | 3300005578 | Ga0068854_100033461 | Ga0068854_1000334612 | 403 |
| 193 | 3300005617 | Ga0068859_100030291 | Ga0068859_1000302915 | 403 |
| 194 | 3300005834 | Ga0068851_10017063 | Ga0068851_100170632 | 403 |
| 195 | 3300005843 | Ga0068860_100156545 | Ga0068860_1001565453 | 403 |
| 196 | 3300006931 | Ga0097620_100030291 | Ga0097620_1000302915 | 403 |
| 197 | 3300009093 | Ga0105240_10013931 | Ga0105240_100139319 | 403 |
| 198 | 3300009093 | Ga0105240_10317611 | Ga0105240_103176111 | 403 |
| 199 | 3300009174 | Ga0105241_10000452 | Ga0105241_1000045220 | 403 |
| 200 | 3300009176 | Ga0105242_10249420 | Ga0105242_102494201 | 403 |
| 201 | 3300009545 | Ga0105237_10228679 | Ga0105237_102286792 | 403 |
| 202 | 3300009545 | Ga0105237_10304411 | Ga0105237_103044112 | 403 |
| 203 | 3300013102 | Ga0157371_10000148 | Ga0157371_100001489 | 403 |
| 204 | 3300013104 | Ga0157370_10252404 | Ga0157370_102524041 | 403 |
| 205 | 3300013104 | Ga0157370_10284659 | Ga0157370_102846591 | 403 |
| 206 | 3300013105 | Ga0157369_10054717 | Ga0157369_100547173 | 403 |
| 207 | 3300014969 | Ga0157376_10075905 | Ga0157376_100759052 | 403 |
| 208 | 3300025226 | Ga0209674_105442 | Ga0209674_1054421 | 403 |
| 209 | 3300025230 | Ga0209563_100024 | Ga0209563_100024342 | 403 |
| 210 | 3300025253 | Ga0209677_101534 | Ga0209677_1015346 | 403 |
| 211 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008295 | 403 |
| 212 | 3300025272 | Ga0209455_1000002 | Ga0209455_10000021128 | 403 |
| 213 | 3300025291 | Ga0209675_1000188 | Ga0209675_10001888 | 403 |
| 214 | 3300025292 | Ga0209676_1000070 | Ga0209676_1000070128 | 403 |
| 215 | 3300025292 | Ga0209676_1000593 | Ga0209676_100059310 | 403 |
| 216 | 3300025294 | Ga0209025_1027965 | Ga0209025_10279652 | 403 |
| 217 | 3300025297 | Ga0209758_1000007 | Ga0209758_10000071125 | 403 |
| 218 | 3300025298 | Ga0209050_1000115 | Ga0209050_1000115130 | 403 |
| 219 | 3300025304 | Ga0209257_1000160 | Ga0209257_1000160104 | 403 |
| 220 | 3300025321 | Ga0207656_10022343 | Ga0207656_100223433 | 403 |
| 221 | 3300025909 | Ga0207705_10000127 | Ga0207705_1000012748 | 403 |
| 222 | 3300025913 | Ga0207695_10224743 | Ga0207695_102247432 | 403 |
| 223 | 3300025913 | Ga0207695_10224789 | Ga0207695_102247892 | 403 |
| 224 | 3300025914 | Ga0207671_10008129 | Ga0207671_100081296 | 403 |
| 225 | 3300025919 | Ga0207657_10035661 | Ga0207657_100356612 | 403 |
| 226 | 3300025920 | Ga0207649_10001574 | Ga0207649_100015742 | 403 |
| 227 | 3300025924 | Ga0207694_10006451 | Ga0207694_100064516 | 403 |
| 228 | 3300025926 | Ga0207659_10156350 | Ga0207659_101563502 | 403 |
| 229 | 3300025932 | Ga0207690_10000965 | Ga0207690_1000096513 | 403 |
| 230 | 3300025932 | Ga0207690_10068983 | Ga0207690_100689832 | 403 |
| 231 | 3300025935 | Ga0207709_10000109 | Ga0207709_1000010911 | 403 |
| 232 | 3300025937 | Ga0207669_10000059 | Ga0207669_1000005951 | 403 |
| 233 | 3300025937 | Ga0207669_10000384 | Ga0207669_100003849 | 403 |
| 234 | 3300025945 | Ga0207679_10022618 | Ga0207679_100226183 | 403 |
| 235 | 3300025949 | Ga0207667_10000074 | Ga0207667_1000007467 | 403 |
| 236 | 3300025949 | Ga0207667_10372121 | Ga0207667_103721211 | 403 |
| 237 | 3300025981 | Ga0207640_10005413 | Ga0207640_100054133 | 403 |
| 238 | 3300026089 | Ga0207648_10053104 | Ga0207648_100531043 | 403 |
| 239 | 3300026121 | Ga0207683_10002089 | Ga0207683_100020896 | 403 |
| 240 | 3300026142 | Ga0207698_10001783 | Ga0207698_100017838 | 403 |
| 241 | 3300028381 | Ga0268264_10285020 | Ga0268264_102850202 | 403 |
| 242 | 3300028786 | Ga0307517_10037580 | Ga0307517_100375803 | 403 |
| 243 | 3300031911 | Ga0307412_10037976 | Ga0307412_100379761 | 403 |
| 244 | 3300032004 | Ga0307414_10001704 | Ga0307414_100017046 | 403 |
| 245 | 3300032004 | Ga0307414_10165624 | Ga0307414_101656241 | 403 |
| 246 | 3300037312 | Ga0395899_0019969 | Ga0395899_0019969_965_2176 | 403 |
| 247 | 3300038443 | Ga0395901_0297922 | Ga0395901_0297922_395_1606 | 403 |
| 248 | 3300046471 | Ga0495650_0000058 | Ga0495650_0000058_168070_169281 | 403 |
| 249 | 3300046491 | Ga0495584_0004747 | Ga0495584_0004747_943_2154 | 403 |
| 250 | 3300046491 | Ga0495584_0067451 | Ga0495584_0067451_145_1356 | 403 |
| 251 | 3300046492 | Ga0495585_0012409 | Ga0495585_0012409_2751_3962 | 403 |
| 252 | 3300046500 | Ga0495596_0040387 | Ga0495596_0040387_150_1361 | 403 |
| 253 | 3300046506 | Ga0495583_0000673 | Ga0495583_0000673_14747_15958 | 403 |
| 254 | 3300046506 | Ga0495583_0003905 | Ga0495583_0003905_3148_4359 | 403 |
| 255 | 3300046518 | Ga0495631_0015276 | Ga0495631_0015276_1256_2467 | 403 |
| 256 | 3300046520 | Ga0495637_0013938 | Ga0495637_0013938_2341_3552 | 403 |
| 257 | 3300046522 | Ga0495643_0000557 | Ga0495643_0000557_1925_3136 | 403 |
| 258 | 3300046522 | Ga0495643_0004800 | Ga0495643_0004800_5191_6402 | 403 |
| 259 | 3300046522 | Ga0495643_0023176 | Ga0495643_0023176_1283_2494 | 403 |
| 260 | 3300046542 | Ga0495597_0008130 | Ga0495597_0008130_3573_4784 | 403 |
| 261 | 3300046557 | Ga0495622_0004213 | Ga0495622_0004213_3188_4399 | 403 |
| 262 | 3300046558 | Ga0495633_0001087 | Ga0495633_0001087_14972_16183 | 403 |
| 263 | 3300046616 | Ga0495668_0000098 | Ga0495668_0000098_88883_90094 | 403 |
| 264 | 3300046616 | Ga0495668_0018815 | Ga0495668_0018815_167_1378 | 403 |
| 265 | 3300046660 | Ga0495625_0005013 | Ga0495625_0005013_5279_6490 | 403 |
| 266 | 3300046660 | Ga0495625_0008659 | Ga0495625_0008659_5277_6488 | 403 |
| 267 | 3300046660 | Ga0495625_0033817 | Ga0495625_0033817_2397_3608 | 403 |
| 268 | 3300046684 | Ga0495669_0000026 | Ga0495669_0000026_45144_46355 | 403 |
| 269 | 3300046691 | Ga0495670_0002829 | Ga0495670_0002829_1580_2791 | 403 |
| 270 | 3300046694 | Ga0495649_0057746 | Ga0495649_0057746_353_1564 | 403 |
| 271 | 3300046809 | Ga0495600_0000389 | Ga0495600_0000389_14402_15613 | 403 |
| 272 | 3300046810 | Ga0495660_0016883 | Ga0495660_0016883_520_1731 | 403 |
| 273 | 3300047323 | Ga0495683_0058507 | Ga0495683_0058507_583_1794 | 403 |
| 274 | 3300047443 | Ga0495687_000123 | Ga0495687_000123_35421_36632 | 403 |
| 275 | 3300047443 | Ga0495687_000285 | Ga0495687_000285_35355_36566 | 403 |
| 276 | 3300047470 | Ga0495681_0001526 | Ga0495681_0001526_2907_4118 | 403 |
| 277 | 3300047470 | Ga0495681_0068301 | Ga0495681_0068301_213_1424 | 403 |
| 278 | 3300048905 | Ga0496102_0000092 | Ga0496102_0000092_86954_88165 | 403 |
| 279 | 3300048906 | Ga0496103_0000101 | Ga0496103_0000101_85069_86280 | 403 |
| 280 | 3300048907 | Ga0496104_0009124 | Ga0496104_0009124_3445_4656 | 403 |
| 281 | 3300048908 | Ga0496105_0001224 | Ga0496105_0001224_2542_3753 | 403 |
| 282 | 3300048910 | Ga0496107_0025116 | Ga0496107_0025116_1593_2804 | 403 |
| 283 | 3300048914 | Ga0496111_0006559 | Ga0496111_0006559_3072_4283 | 403 |
| 284 | 3300048917 | Ga0496114_0004414 | Ga0496114_0004414_9253_10464 | 403 |
| 285 | 3300048918 | Ga0496115_0000038 | Ga0496115_0000038_39047_40258 | 403 |
| 286 | 3300048919 | Ga0496116_0000627 | Ga0496116_0000627_7388_8599 | 403 |
| 287 | 3300048920 | Ga0496117_0000173 | Ga0496117_0000173_47131_48342 | 403 |
| 288 | 3300048921 | Ga0496118_0000131 | Ga0496118_0000131_84907_86118 | 403 |
| 289 | 3300048922 | Ga0496119_0009367 | Ga0496119_0009367_3630_4841 | 403 |
| 290 | 3300048923 | Ga0496120_0004518 | Ga0496120_0004518_4444_5655 | 403 |
| 291 | 3300048924 | Ga0496121_0000209 | Ga0496121_0000209_84885_86096 | 403 |
| 292 | 3300048924 | Ga0496121_0023519 | Ga0496121_0023519_2319_3530 | 403 |
| 293 | 3300048927 | Ga0496124_0000166 | Ga0496124_0000166_85075_86286 | 403 |
| 294 | 3300048929 | Ga0496126_0000222 | Ga0496126_0000222_37821_39032 | 403 |
| 295 | 3300049823 | Ga0501044_0000121 | Ga0501044_0000121_73415_74626 | 403 |
| 296 | 3300053079 | Ga0500610_0000169 | Ga0500610_0000169_4471_5682 | 403 |
| 297 | 3300053119 | Ga0500595_000230 | Ga0500595_000230_10013_11224 | 403 |
| 298 | 3300053136 | Ga0500559_0065143 | Ga0500559_0065143_274_1485 | 403 |
| 299 | 3300053177 | Ga0500636_0002265 | Ga0500636_0002265_844_2055 | 403 |
| 300 | 3300053730 | Ga0500645_000045 | Ga0500645_000045_66585_67796 | 403 |
| 301 | 3300053735 | Ga0500596_002065 | Ga0500596_002065_1694_2905 | 403 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g29-assembly1.cif.gz_A | crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 | 0.8911 | 3 | 403 |
| 2g29-assembly1.cif.gz_A | crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 | 0.8778 | 3 | 403 |
| 3un6-assembly1.cif.gz_A | 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound | 0.8572 | 4 | 345 |
| 2i49-assembly1.cif.gz_A | crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 | 0.8547 | 5 | 403 |
| 3un6-assembly1.cif.gz_A | 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound | 0.8431 | 4 | 345 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2g29A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8881 | 3 | 346 | 3.40.190.10 |
| 2g29A02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8571 | 88 | 208 | 3.40.190.10 |
| 2i4cA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8383 | 88 | 208 | 3.40.190.10 |
| 2g29A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7989 | 3 | 346 | 3.40.190.10 |
| 3up9A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7894 | 3 | 96 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A430E7E2-F1-model_v4 | deleted | 0.9851 | 1 | 367 |
|
| AF-A0A430E7E2-F1-model_v4 | deleted | 0.9824 | 1 | 367 |
|
| AF-A0A327JPI0-F1-model_v4 | Nitrate transporter | 0.9635 | 1 | 220 |
GO:0005886
GO:0012505 |
| AF-A0A679JJF7-F1-model_v4 | Nitrate transport protein NrtA | 0.9616 | 5 | 348 |
GO:0005886
GO:0012505 |
| AF-A0A4Q3MZI6-F1-model_v4 | deleted | 0.9578 | 4 | 274 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar