F396198

General Info

Members Datasets Scaffolds Average Seq Length
301 204 287 401

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0068528|Ga0495601_0068528_22_1218
Length 398
Sequence VSLDRFRIGFVPLVDAALPILAHELGFAEEQGVAVDLVRDVTWAAVRDRLLYGHTDAAHMVAPLAIATALGRDRPAVPMAVPFVLGLNGNAITFSTALGEACGLGEGLGDPIAVGAALREVAARQRLRFGVVHRHSSHNYMLRYWLAGVGIRPDMDVDIVVTSPPFAADALAAGEVDGICVGEPWNSIAVDRGVGRIALATAQIWRRGVEKVLAMRSDQAEERRDAVLRLIRALHAAAAHFIDPETVEQSAEILSRTAYLDAPVGAILRAITDRIRVVPGGEPVHYPDFMFQYREAANFPWRSQAGWLYAQMVRWEGLSFSNADAATAQGVFRPDLYRAALAGSGAPLPGASSKLEGALVEPIGAGSTQGRLVLGSDPFFDGRAFDPDDIPGYLKELP

Samples

Sample ID Description Type Environment
1 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
2 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
3 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
4 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
5 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
6 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
7 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
8 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
9 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
10 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
11 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
12 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
13 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
192 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
193 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
194 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
195 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
201 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
202 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
203 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
204 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.35
Metatranscriptomes 0
Isolates 4.65

Biome Distribution

Category Percentage (%)
Aerial Root 1.66
Bulb 0
Endosphere 16.28
Nodule 0
Rhizoplane 4.32
Rhizosphere 68.77
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000661 3300001915 Bacteria 10421
2 JGI24740J21852_10001652 3300001979 Bacteria 10234
3 JGI24739J22299_10014010 3300001989 Bacteria 2920
4 JGI25153J46596_10000075 3300003215 Bacteria 114168
5 Ga0055525_1000058 3300003759 Bacteria 210367
6 Ga0055542_1000842 3300003762 Bacteria 21677
7 Ga0055529_1000040 3300003763 Bacteria 230562
8 Ga0055530_10000093 3300003791 Bacteria 77624
9 Ga0055530_10000104 3300003791 Bacteria 72163
10 Ga0055531_10000854 3300003794 Bacteria 25073
11 Ga0070658_10000486 3300005327 Bacteria 34470
12 Ga0070658_10004780 3300005327 Bacteria 11020
13 Ga0070676_10041780 3300005328 Bacteria 2660
14 Ga0070666_10070893 3300005335 Bacteria 2371
15 Ga0070666_10100993 3300005335 Bacteria 1988
16 Ga0070660_100023830 3300005339 Bacteria 4537
17 Ga0070661_100010094 3300005344 Bacteria 6558
18 Ga0070668_100006192 3300005347 Bacteria 8860
19 Ga0070668_100007888 3300005347 Bacteria 7903
20 Ga0070669_100000659 3300005353 Bacteria 25480
21 Ga0070669_100001143 3300005353 Bacteria 19370
22 Ga0070675_100199005 3300005354 Bacteria 1738
23 Ga0070671_100000040 3300005355 Bacteria 92357
24 Ga0070671_100001027 3300005355 Bacteria 20510
25 Ga0070671_100007178 3300005355 Bacteria 8906
26 Ga0070674_100005747 3300005356 Bacteria 7197
27 Ga0070674_100009123 3300005356 Bacteria 5933
28 Ga0070667_100001272 3300005367 Bacteria 22834
29 Ga0070667_100011008 3300005367 Bacteria 7480
30 Ga0070663_100088802 3300005455 Bacteria 2286
31 Ga0070663_100186363 3300005455 Bacteria 1613
32 Ga0070678_100042153 3300005456 Bacteria 3242
33 Ga0070662_100051588 3300005457 Bacteria 2971
34 Ga0068853_100109657 3300005539 Bacteria 2450
35 Ga0070665_100000169 3300005548 Bacteria 118043
36 Ga0070665_100263263 3300005548 Bacteria 1725
37 Ga0068855_100005354 3300005563 Bacteria 15653
38 Ga0068855_100097859 3300005563 Bacteria 3380
39 Ga0070664_100003863 3300005564 Bacteria 12097
40 Ga0068854_100000459 3300005578 Bacteria 25127
41 Ga0068854_100001010 3300005578 Bacteria 16921
42 Ga0068854_100033461 3300005578 Bacteria 3584
43 Ga0068854_100096540 3300005578 Bacteria 2208
44 Ga0068854_100209636 3300005578 Bacteria 1536
45 Ga0068856_100011271 3300005614 Bacteria 8677
46 Ga0068852_100000231 3300005616 Bacteria 37728
47 Ga0068859_100030291 3300005617 Bacteria 5430
48 Ga0068859_100077259 3300005617 Bacteria 3371
49 Ga0068859_100088781 3300005617 Bacteria 3141
50 Ga0068851_10017063 3300005834 Bacteria 3483
51 Ga0068863_100000131 3300005841 Bacteria 79059
52 Ga0068863_100121763 3300005841 Bacteria 2488
53 Ga0068858_100035149 3300005842 Bacteria 4648
54 Ga0068858_100340856 3300005842 Bacteria 1435
55 Ga0068860_100002824 3300005843 Bacteria 18062
56 Ga0068860_100053350 3300005843 Bacteria 3844
57 Ga0068860_100156545 3300005843 Bacteria 2196
58 Ga0068860_100176421 3300005843 Bacteria 2065
59 Ga0068862_100004950 3300005844 Bacteria 11216
60 Ga0068862_100016090 3300005844 Bacteria 6220
61 Ga0075363_100002516 3300006048 Bacteria 7517
62 Ga0075364_10001358 3300006051 Bacteria 13201
63 Ga0075364_10054807 3300006051 Bacteria 2608
64 Ga0075362_10000042 3300006177 Bacteria 45768
65 Ga0075367_10088114 3300006178 Bacteria 1886
66 Ga0075366_10011165 3300006195 Bacteria 5064
67 Ga0075370_10000026 3300006353 Bacteria 51806
68 Ga0097620_100030291 3300006931 Bacteria 5430
69 Ga0097620_100077259 3300006931 Bacteria 3371
70 Ga0097620_100088781 3300006931 Bacteria 3141
71 Ga0105251_10013183 3300009011 Bacteria 4634
72 Ga0105240_10013931 3300009093 Bacteria 11008
73 Ga0105240_10317611 3300009093 Bacteria 1776
74 Ga0105247_10011698 3300009101 Bacteria 5281
75 Ga0105241_10000452 3300009174 Bacteria 30921
76 Ga0105242_10249420 3300009176 Bacteria 1599
77 Ga0105248_10009758 3300009177 Bacteria 10578
78 Ga0105248_10124408 3300009177 Bacteria 2909
79 Ga0105237_10228679 3300009545 Bacteria 1861
80 Ga0105237_10304411 3300009545 Bacteria 1597
81 Ga0105249_10157944 3300009553 Bacteria 2189
82 Ga0105239_10146287 3300010375 Bacteria 2636
83 Ga0157371_10000148 3300013102 Bacteria 101711
84 Ga0157370_10252404 3300013104 Bacteria 1631
85 Ga0157370_10284659 3300013104 Bacteria 1527
86 Ga0157369_10054717 3300013105 Bacteria 4309
87 Ga0163162_10198164 3300013306 Bacteria 2137
88 Ga0157376_10075905 3300014969 Bacteria 2870
89 Ga0163161_10002387 3300017792 Bacteria 13456
90 Ga0163161_10109339 3300017792 Bacteria 2065
91 Ga0209674_105442 3300025226 Bacteria 1880
92 Ga0209563_100024 3300025230 Bacteria 601155
93 Ga0209677_101534 3300025253 Bacteria 9867
94 Ga0209148_1000008 3300025254 Bacteria 1504371
95 Ga0209455_1000002 3300025272 Bacteria 1505459
96 Ga0209675_1000188 3300025291 Bacteria 68178
97 Ga0209676_1000070 3300025292 Bacteria 312074
98 Ga0209676_1000593 3300025292 Bacteria 54046
99 Ga0209025_1027965 3300025294 Bacteria 2778
100 Ga0209758_1000007 3300025297 Bacteria 1270410
101 Ga0209050_1000115 3300025298 Bacteria 204622
102 Ga0209257_1000160 3300025304 Bacteria 177175
103 Ga0207656_10022343 3300025321 Bacteria 2537
104 Ga0207713_1001058 3300025735 Bacteria 23840
105 Ga0207647_10005855 3300025904 Bacteria 8959
106 Ga0207647_10016969 3300025904 Bacteria 4957
107 Ga0207705_10000004 3300025909 Bacteria 705756
108 Ga0207705_10000127 3300025909 Bacteria 83788
109 Ga0207695_10023787 3300025913 Bacteria 6914
110 Ga0207695_10224743 3300025913 Bacteria 1784
111 Ga0207695_10224789 3300025913 Bacteria 1784
112 Ga0207671_10008129 3300025914 Bacteria 8952
113 Ga0207657_10035661 3300025919 Bacteria 4459
114 Ga0207649_10001574 3300025920 Bacteria 13298
115 Ga0207681_10000393 3300025923 Bacteria 30649
116 Ga0207681_10001400 3300025923 Bacteria 15582
117 Ga0207681_10094471 3300025923 Bacteria 2143
118 Ga0207694_10006451 3300025924 Bacteria 8938
119 Ga0207659_10156350 3300025926 Bacteria 1786
120 Ga0207644_10000005 3300025931 Bacteria 441948
121 Ga0207644_10000148 3300025931 Bacteria 50390
122 Ga0207644_10001680 3300025931 Bacteria 14272
123 Ga0207690_10000965 3300025932 Bacteria 18393
124 Ga0207690_10068983 3300025932 Bacteria 2431
125 Ga0207709_10000109 3300025935 Bacteria 128086
126 Ga0207669_10000059 3300025937 Bacteria 54857
127 Ga0207669_10000384 3300025937 Bacteria 19532
128 Ga0207711_10005031 3300025941 Bacteria 11212
129 Ga0207711_10356780 3300025941 Bacteria 1354
130 Ga0207679_10022618 3300025945 Bacteria 4283
131 Ga0207667_10000074 3300025949 Bacteria 171635
132 Ga0207667_10005425 3300025949 Bacteria 15550
133 Ga0207667_10372121 3300025949 Bacteria 1456
134 Ga0207712_10030818 3300025961 Bacteria 3608
135 Ga0207668_10003853 3300025972 Bacteria 8839
136 Ga0207668_10003931 3300025972 Bacteria 8761
137 Ga0207668_10083125 3300025972 Bacteria 2329
138 Ga0207640_10000508 3300025981 Bacteria 23527
139 Ga0207640_10000554 3300025981 Bacteria 22430
140 Ga0207640_10005413 3300025981 Bacteria 6961
141 Ga0207658_10000955 3300025986 Bacteria 23859
142 Ga0207658_10093116 3300025986 Bacteria 2342
143 Ga0207703_10069077 3300026035 Bacteria 2912
144 Ga0207703_10107982 3300026035 Bacteria 2370
145 Ga0207702_10004366 3300026078 Bacteria 12605
146 Ga0207641_10000004 3300026088 Bacteria 481088
147 Ga0207641_10005938 3300026088 Bacteria 10349
148 Ga0207648_10053104 3300026089 Bacteria 3543
149 Ga0207674_10227772 3300026116 Bacteria 1812
150 Ga0207683_10002089 3300026121 Bacteria 17609
151 Ga0207698_10000058 3300026142 Bacteria 78048
152 Ga0207698_10001783 3300026142 Bacteria 12574
153 Ga0207698_10094578 3300026142 Bacteria 2457
154 Ga0268266_10000480 3300028379 Bacteria 57568
155 Ga0268265_10046379 3300028380 Bacteria 3248
156 Ga0268264_10002511 3300028381 Bacteria 16129
157 Ga0268264_10007130 3300028381 Bacteria 9367
158 Ga0268264_10021902 3300028381 Bacteria 5216
159 Ga0268264_10285020 3300028381 Bacteria 1549
160 Ga0307517_10037580 3300028786 Bacteria 5401
161 Ga0307408_100107602 3300031548 Bacteria 2135
162 Ga0307408_100130029 3300031548 Bacteria 1963
163 Ga0307405_10000949 3300031731 Bacteria 11579
164 Ga0307405_10004639 3300031731 Bacteria 6524
165 Ga0307405_10081083 3300031731 Bacteria 2120
166 Ga0307413_10015035 3300031824 Bacteria 3954
167 Ga0307413_10165396 3300031824 Bacteria 1559
168 Ga0307410_10201457 3300031852 Bacteria 1520
169 Ga0307406_10001389 3300031901 Bacteria 13476
170 Ga0307412_10010786 3300031911 Bacteria 5273
171 Ga0307412_10015951 3300031911 Bacteria 4463
172 Ga0307412_10029158 3300031911 Bacteria 3461
173 Ga0307412_10037976 3300031911 Bacteria 3097
174 Ga0307409_100110052 3300031995 Bacteria 2308
175 Ga0307409_100451939 3300031995 Bacteria 1240
176 Ga0307416_100138572 3300032002 Bacteria 2206
177 Ga0307414_10001704 3300032004 Bacteria 11449
178 Ga0307414_10003444 3300032004 Bacteria 8446
179 Ga0307414_10034920 3300032004 Bacteria 3339
180 Ga0307414_10165624 3300032004 Bacteria 1761
181 Ga0373962_0022834 3300035242 Bacteria 1662
182 Ga0395899_0019969 3300037312 Bacteria 5083
183 Ga0395901_0297922 3300038443 Bacteria 1672
184 Ga0439462_0001193 3300042015 Bacteria 5682
185 Ga0495650_0000058 3300046471 Bacteria 302308
186 Ga0495584_0004747 3300046491 Bacteria 7275
187 Ga0495584_0067451 3300046491 Bacteria 1798
188 Ga0495585_0012409 3300046492 Bacteria 5020
189 Ga0495596_0040387 3300046500 Bacteria 1842
190 Ga0495583_0000673 3300046506 Bacteria 44600
191 Ga0495583_0003905 3300046506 Bacteria 11037
192 Ga0495583_0032183 3300046506 Bacteria 2533
193 Ga0495583_0036559 3300046506 Bacteria 2334
194 Ga0495606_0001811 3300046507 Bacteria 27176
195 Ga0495610_0001553 3300046512 Bacteria 20242
196 Ga0495620_0010179 3300046515 Bacteria 4967
197 Ga0495631_0015276 3300046518 Bacteria 3682
198 Ga0495632_0123161 3300046519 Bacteria 1210
199 Ga0495637_0013938 3300046520 Bacteria 3804
200 Ga0495643_0000557 3300046522 Bacteria 46202
201 Ga0495643_0004800 3300046522 Bacteria 9321
202 Ga0495643_0005754 3300046522 Bacteria 8294
203 Ga0495643_0023176 3300046522 Bacteria 3531
204 Ga0495648_0000498 3300046524 Bacteria 42255
205 Ga0495663_0000325 3300046525 Bacteria 17863
206 Ga0495609_0028181 3300046538 Bacteria 2564
207 Ga0495597_0008130 3300046542 Bacteria 5277
208 Ga0495622_0004213 3300046557 Bacteria 6706
209 Ga0495633_0001087 3300046558 Bacteria 21944
210 Ga0495668_0000098 3300046616 Bacteria 138553
211 Ga0495668_0018815 3300046616 Bacteria 3991
212 Ga0495625_0005013 3300046660 Bacteria 12283
213 Ga0495625_0008659 3300046660 Bacteria 8651
214 Ga0495625_0033817 3300046660 Bacteria 3776
215 Ga0495669_0000026 3300046684 Bacteria 111814
216 Ga0495670_0002829 3300046691 Bacteria 8587
217 Ga0495649_0015220 3300046694 Bacteria 4379
218 Ga0495649_0057746 3300046694 Bacteria 2092
219 Ga0495600_0000389 3300046809 Bacteria 22709
220 Ga0495660_0016883 3300046810 Bacteria 4206
221 Ga0495683_0004258 3300047323 Bacteria 8166
222 Ga0495683_0058507 3300047323 Bacteria 1914
223 Ga0495687_000123 3300047443 Bacteria 118577
224 Ga0495687_000285 3300047443 Bacteria 66562
225 Ga0495681_0001526 3300047470 Bacteria 17269
226 Ga0495681_0068301 3300047470 Bacteria 1618
227 Ga0496101_0092955 3300048904 Bacteria 2246
228 Ga0496101_0169963 3300048904 Bacteria 1675
229 Ga0496102_0000092 3300048905 Bacteria 125879
230 Ga0496103_0000101 3300048906 Bacteria 93679
231 Ga0496103_0007086 3300048906 Bacteria 6694
232 Ga0496104_0009124 3300048907 Bacteria 8819
233 Ga0496105_0001224 3300048908 Bacteria 17875
234 Ga0496106_0002615 3300048909 Bacteria 13399
235 Ga0496107_0025116 3300048910 Bacteria 4217
236 Ga0496111_0006559 3300048914 Bacteria 7567
237 Ga0496113_0002879 3300048916 Bacteria 10132
238 Ga0496114_0004414 3300048917 Bacteria 10917
239 Ga0496115_0000038 3300048918 Bacteria 125104
240 Ga0496116_0000627 3300048919 Bacteria 46393
241 Ga0496116_0009876 3300048919 Bacteria 8075
242 Ga0496117_0000173 3300048920 Bacteria 133415
243 Ga0496118_0000131 3300048921 Bacteria 133116
244 Ga0496119_0009367 3300048922 Bacteria 8420
245 Ga0496119_0026232 3300048922 Bacteria 4044
246 Ga0496120_0004518 3300048923 Bacteria 11632
247 Ga0496121_0000022 3300048924 Bacteria 472849
248 Ga0496121_0000209 3300048924 Bacteria 129740
249 Ga0496121_0003675 3300048924 Bacteria 21549
250 Ga0496121_0023519 3300048924 Bacteria 5930
251 Ga0496122_0001686 3300048925 Bacteria 34241
252 Ga0496122_0052224 3300048925 Bacteria 3097
253 Ga0496123_0003133 3300048926 Bacteria 18969
254 Ga0496123_0069644 3300048926 Bacteria 2207
255 Ga0496124_0000166 3300048927 Bacteria 133634
256 Ga0496125_0000390 3300048928 Bacteria 81748
257 Ga0496125_0009487 3300048928 Bacteria 9988
258 Ga0496125_0018739 3300048928 Bacteria 6561
259 Ga0496126_0000222 3300048929 Bacteria 123936
260 Ga0496126_0018631 3300048929 Bacteria 6871
261 Ga0501257_000098 3300049686 Bacteria 20774
262 Ga0501280_000355 3300049776 Bacteria 11410
263 Ga0501044_0000121 3300049823 Bacteria 93902
264 nmdc:mga03683_53_c1 3300050489 Bacteria 47904
265 nmdc:mga03n38_2795_c1 3300050490 Bacteria 5482
266 nmdc:mga00v17_5090_c1 3300050491 Bacteria 6906
267 nmdc:mga0k408_499_c1 3300050493 Bacteria 21537
268 nmdc:mga0k408_5_c2 3300050493 Bacteria 142245
269 nmdc:mga07m45_30_c1 3300050496 Bacteria 85279
270 nmdc:mga0sz30_78_c2 3300050516 Bacteria 28116
271 Ga0495601_0068528 3300053077 Bacteria 2262
272 Ga0500610_0000169 3300053079 Bacteria 19508
273 Ga0500643_000139 3300053087 Bacteria 73348
274 Ga0500592_000096 3300053116 Bacteria 19420
275 Ga0500595_000230 3300053119 Bacteria 37914
276 Ga0500608_000224 3300053122 Bacteria 22253
277 Ga0500618_001521 3300053125 Bacteria 10201
278 Ga0500559_0065143 3300053136 Bacteria 1632
279 Ga0500573_0126988 3300053140 Bacteria 1415
280 Ga0500622_0001336 3300053156 Bacteria 19980
281 Ga0500627_0000119 3300053158 Bacteria 24541
282 Ga0500627_0004611 3300053158 Bacteria 4456
283 Ga0500636_0002265 3300053177 Bacteria 10680
284 Ga0500567_000658 3300053723 Bacteria 12534
285 Ga0500625_000037 3300053729 Bacteria 44475
286 Ga0500645_000045 3300053730 Bacteria 108141
287 Ga0500596_002065 3300053735 Bacteria 4000

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2993693658 2993696090 348
2 3300046519 Ga0495632_0123161 Ga0495632_0123161_14_1105 363
3 3300005347 Ga0070668_100006192 Ga0070668_1000061924 379
4 3300005355 Ga0070671_100001027 Ga0070671_10000102714 379
5 3300005617 Ga0068859_100088781 Ga0068859_1000887814 384
6 3300005841 Ga0068863_100000131 Ga0068863_10000013184 384
7 3300005843 Ga0068860_100176421 Ga0068860_1001764212 384
8 3300006931 Ga0097620_100088781 Ga0097620_1000887811 384
9 3300025931 Ga0207644_10001680 Ga0207644_1000168013 384
10 3300025961 Ga0207712_10030818 Ga0207712_100308185 384
11 3300025972 Ga0207668_10003853 Ga0207668_100038534 384
12 3300026088 Ga0207641_10000004 Ga0207641_10000004311 384
13 3300028381 Ga0268264_10002511 Ga0268264_100025112 384
14 3300032004 Ga0307414_10003444 Ga0307414_100034443 385
15 3300005578 Ga0068854_100001010 Ga0068854_10000101011 386
16 3300025981 Ga0207640_10000554 Ga0207640_100005546 386
17 3300026142 Ga0207698_10094578 Ga0207698_100945782 386
18 3300049686 Ga0501257_000098 Ga0501257_000098_147_1370 391
19 3300049776 Ga0501280_000355 Ga0501280_000355_2188_3411 391
20 3300046507 Ga0495606_0001811 Ga0495606_0001811_25221_26432 395
21 3300053158 Ga0500627_0004611 Ga0500627_0004611_893_2116 395
22 3300001989 JGI24739J22299_10014010 JGI24739J22299_100140102 397
23 3300005367 Ga0070667_100011008 Ga0070667_1000110084 397
24 3300005457 Ga0070662_100051588 Ga0070662_1000515882 397
25 3300017792 Ga0163161_10109339 Ga0163161_101093392 397
26 3300025904 Ga0207647_10005855 Ga0207647_100058553 397
27 3300025986 Ga0207658_10093116 Ga0207658_100931162 397
28 3300046506 Ga0495583_0036559 Ga0495583_0036559_799_2010 397
29 3300046524 Ga0495648_0000498 Ga0495648_0000498_27100_28311 397
30 3300046525 Ga0495663_0000325 Ga0495663_0000325_16014_17225 397
31 3300046694 Ga0495649_0015220 Ga0495649_0015220_482_1693 397
32 3300047323 Ga0495683_0004258 Ga0495683_0004258_2849_4060 397
33 3300048925 Ga0496122_0001686 Ga0496122_0001686_15432_16643 397
34 3300048926 Ga0496123_0003133 Ga0496123_0003133_1536_2747 397
35 3300048928 Ga0496125_0000390 Ga0496125_0000390_34358_35569 397
36 3300053077 Ga0495601_0068528 Ga0495601_0068528_22_1218 398
37 iso_pu_bacteria 2643221588 2643951509 398
38 iso_pu_bacteria 2852680915 2852682990 398
39 iso_pu_bacteria 2919138771 2919140267 398
40 iso_pu_bacteria 2928100450 2928104365 398
41 iso_pu_bacteria 2928959182 2928962968 398
42 iso_pu_bacteria 2928027323 2928028757 399
43 iso_pu_bacteria 2984555340 2984555415 399
44 iso_pu_bacteria 2984564862 2984566448 399
45 iso_pu_bacteria 2990265787 2990266116 399
46 iso_pu_bacteria 2993356040 2993357486 399
47 iso_pu_bacteria 8057101203 8057105867 399
48 3300005578 Ga0068854_100209636 Ga0068854_1002096362 401
49 3300010375 Ga0105239_10146287 Ga0105239_101462873 401
50 3300031548 Ga0307408_100107602 Ga0307408_1001076021 401
51 3300031731 Ga0307405_10004639 Ga0307405_100046392 401
52 3300031901 Ga0307406_10001389 Ga0307406_100013898 401
53 3300031911 Ga0307412_10015951 Ga0307412_100159512 401
54 3300032002 Ga0307416_100138572 Ga0307416_1001385721 401
55 3300053087 Ga0500643_000139 Ga0500643_000139_41280_42503 401
56 3300053116 Ga0500592_000096 Ga0500592_000096_10056_11279 401
57 3300053158 Ga0500627_0000119 Ga0500627_0000119_8135_9358 401
58 3300005327 Ga0070658_10000486 Ga0070658_100004865 402
59 3300005335 Ga0070666_10070893 Ga0070666_100708931 402
60 3300005335 Ga0070666_10100993 Ga0070666_101009933 402
61 3300005347 Ga0070668_100007888 Ga0070668_1000078883 402
62 3300005353 Ga0070669_100000659 Ga0070669_10000065911 402
63 3300005353 Ga0070669_100001143 Ga0070669_10000114310 402
64 3300005355 Ga0070671_100000040 Ga0070671_10000004053 402
65 3300005355 Ga0070671_100007178 Ga0070671_1000071786 402
66 3300005367 Ga0070667_100001272 Ga0070667_10000127215 402
67 3300005455 Ga0070663_100186363 Ga0070663_1001863631 402
68 3300005548 Ga0070665_100000169 Ga0070665_10000016924 402
69 3300005548 Ga0070665_100263263 Ga0070665_1002632632 402
70 3300005563 Ga0068855_100005354 Ga0068855_10000535414 402
71 3300005578 Ga0068854_100000459 Ga0068854_10000045923 402
72 3300005578 Ga0068854_100096540 Ga0068854_1000965403 402
73 3300005614 Ga0068856_100011271 Ga0068856_1000112716 402
74 3300005616 Ga0068852_100000231 Ga0068852_10000023124 402
75 3300005617 Ga0068859_100077259 Ga0068859_1000772591 402
76 3300005841 Ga0068863_100121763 Ga0068863_1001217632 402
77 3300005842 Ga0068858_100035149 Ga0068858_1000351494 402
78 3300005842 Ga0068858_100340856 Ga0068858_1003408561 402
79 3300005843 Ga0068860_100002824 Ga0068860_10000282410 402
80 3300005843 Ga0068860_100053350 Ga0068860_1000533504 402
81 3300005844 Ga0068862_100004950 Ga0068862_1000049503 402
82 3300005844 Ga0068862_100016090 Ga0068862_1000160902 402
83 3300006048 Ga0075363_100002516 Ga0075363_1000025167 402
84 3300006051 Ga0075364_10001358 Ga0075364_100013586 402
85 3300006051 Ga0075364_10054807 Ga0075364_100548073 402
86 3300006177 Ga0075362_10000042 Ga0075362_100000428 402
87 3300006178 Ga0075367_10088114 Ga0075367_100881142 402
88 3300006195 Ga0075366_10011165 Ga0075366_100111654 402
89 3300006353 Ga0075370_10000026 Ga0075370_100000263 402
90 3300006931 Ga0097620_100077259 Ga0097620_1000772591 402
91 3300009011 Ga0105251_10013183 Ga0105251_100131833 402
92 3300009101 Ga0105247_10011698 Ga0105247_100116983 402
93 3300009177 Ga0105248_10009758 Ga0105248_100097585 402
94 3300009177 Ga0105248_10124408 Ga0105248_101244082 402
95 3300009553 Ga0105249_10157944 Ga0105249_101579442 402
96 3300013306 Ga0163162_10198164 Ga0163162_101981642 402
97 3300017792 Ga0163161_10002387 Ga0163161_100023871 402
98 3300025735 Ga0207713_1001058 Ga0207713_100105811 402
99 3300025904 Ga0207647_10016969 Ga0207647_100169692 402
100 3300025909 Ga0207705_10000004 Ga0207705_10000004167 402
101 3300025913 Ga0207695_10023787 Ga0207695_100237876 402
102 3300025923 Ga0207681_10000393 Ga0207681_1000039314 402
103 3300025923 Ga0207681_10001400 Ga0207681_100014009 402
104 3300025923 Ga0207681_10094471 Ga0207681_100944712 402
105 3300025931 Ga0207644_10000005 Ga0207644_10000005399 402
106 3300025931 Ga0207644_10000148 Ga0207644_1000014818 402
107 3300025941 Ga0207711_10005031 Ga0207711_100050314 402
108 3300025941 Ga0207711_10356780 Ga0207711_103567802 402
109 3300025949 Ga0207667_10005425 Ga0207667_100054258 402
110 3300025972 Ga0207668_10003931 Ga0207668_100039314 402
111 3300025972 Ga0207668_10083125 Ga0207668_100831252 402
112 3300025981 Ga0207640_10000508 Ga0207640_100005086 402
113 3300025986 Ga0207658_10000955 Ga0207658_1000095514 402
114 3300026035 Ga0207703_10069077 Ga0207703_100690772 402
115 3300026035 Ga0207703_10107982 Ga0207703_101079822 402
116 3300026078 Ga0207702_10004366 Ga0207702_100043667 402
117 3300026088 Ga0207641_10005938 Ga0207641_100059387 402
118 3300026116 Ga0207674_10227772 Ga0207674_102277721 402
119 3300026142 Ga0207698_10000058 Ga0207698_1000005824 402
120 3300028379 Ga0268266_10000480 Ga0268266_1000048017 402
121 3300028380 Ga0268265_10046379 Ga0268265_100463792 402
122 3300028381 Ga0268264_10007130 Ga0268264_100071304 402
123 3300028381 Ga0268264_10021902 Ga0268264_100219024 402
124 3300031548 Ga0307408_100130029 Ga0307408_1001300292 402
125 3300031731 Ga0307405_10000949 Ga0307405_100009496 402
126 3300031731 Ga0307405_10081083 Ga0307405_100810831 402
127 3300031824 Ga0307413_10015035 Ga0307413_100150352 402
128 3300031824 Ga0307413_10165396 Ga0307413_101653962 402
129 3300031852 Ga0307410_10201457 Ga0307410_102014571 402
130 3300031911 Ga0307412_10010786 Ga0307412_100107863 402
131 3300031911 Ga0307412_10029158 Ga0307412_100291583 402
132 3300031995 Ga0307409_100110052 Ga0307409_1001100522 402
133 3300031995 Ga0307409_100451939 Ga0307409_1004519391 402
134 3300032004 Ga0307414_10034920 Ga0307414_100349202 402
135 3300035242 Ga0373962_0022834 Ga0373962_0022834_173_1381 402
136 3300042015 Ga0439462_0001193 Ga0439462_0001193_732_1940 402
137 3300046506 Ga0495583_0032183 Ga0495583_0032183_83_1291 402
138 3300046512 Ga0495610_0001553 Ga0495610_0001553_9761_10969 402
139 3300046515 Ga0495620_0010179 Ga0495620_0010179_3131_4339 402
140 3300046522 Ga0495643_0005754 Ga0495643_0005754_5653_6861 402
141 3300046538 Ga0495609_0028181 Ga0495609_0028181_680_1888 402
142 3300048904 Ga0496101_0092955 Ga0496101_0092955_635_1843 402
143 3300048904 Ga0496101_0169963 Ga0496101_0169963_159_1367 402
144 3300048906 Ga0496103_0007086 Ga0496103_0007086_1100_2308 402
145 3300048909 Ga0496106_0002615 Ga0496106_0002615_10130_11338 402
146 3300048916 Ga0496113_0002879 Ga0496113_0002879_763_1971 402
147 3300048919 Ga0496116_0009876 Ga0496116_0009876_3657_4865 402
148 3300048922 Ga0496119_0026232 Ga0496119_0026232_2145_3353 402
149 3300048924 Ga0496121_0000022 Ga0496121_0000022_117575_118783 402
150 3300048924 Ga0496121_0003675 Ga0496121_0003675_8778_9986 402
151 3300048925 Ga0496122_0052224 Ga0496122_0052224_365_1573 402
152 3300048926 Ga0496123_0069644 Ga0496123_0069644_285_1493 402
153 3300048928 Ga0496125_0009487 Ga0496125_0009487_8467_9675 402
154 3300048928 Ga0496125_0018739 Ga0496125_0018739_4933_6141 402
155 3300048929 Ga0496126_0018631 Ga0496126_0018631_1157_2365 402
156 3300050489 nmdc:mga03683_53_c1 nmdc:mga03683_53_c1_41711_42919 402
157 3300050490 nmdc:mga03n38_2795_c1 nmdc:mga03n38_2795_c1_2351_3559 402
158 3300050491 nmdc:mga00v17_5090_c1 nmdc:mga00v17_5090_c1_1583_2791 402
159 3300050493 nmdc:mga0k408_499_c1 nmdc:mga0k408_499_c1_8624_9832 402
160 3300050493 nmdc:mga0k408_5_c2 nmdc:mga0k408_5_c2_70542_71750 402
161 3300050496 nmdc:mga07m45_30_c1 nmdc:mga07m45_30_c1_27094_28302 402
162 3300050516 nmdc:mga0sz30_78_c2 nmdc:mga0sz30_78_c2_18962_20170 402
163 3300053122 Ga0500608_000224 Ga0500608_000224_1893_3107 402
164 3300053125 Ga0500618_001521 Ga0500618_001521_3926_5134 402
165 3300053140 Ga0500573_0126988 Ga0500573_0126988_59_1273 402
166 3300053156 Ga0500622_0001336 Ga0500622_0001336_14616_15824 402
167 3300053723 Ga0500567_000658 Ga0500567_000658_583_1797 402
168 3300053729 Ga0500625_000037 Ga0500625_000037_31889_33103 402
169 iso_pu_bacteria 2739367664 2739650260 402
170 iso_pu_bacteria 2739367865 2740028733 402
171 3300001915 JGI24741J21665_1000661 JGI24741J21665_10006617 403
172 3300001979 JGI24740J21852_10001652 JGI24740J21852_100016524 403
173 3300003215 JGI25153J46596_10000075 JGI25153J46596_10000075106 403
174 3300003759 Ga0055525_1000058 Ga0055525_100005890 403
175 3300003762 Ga0055542_1000842 Ga0055542_10008424 403
176 3300003763 Ga0055529_1000040 Ga0055529_100004023 403
177 3300003791 Ga0055530_10000093 Ga0055530_1000009339 403
178 3300003791 Ga0055530_10000104 Ga0055530_100001049 403
179 3300003794 Ga0055531_10000854 Ga0055531_100008546 403
180 3300005327 Ga0070658_10004780 Ga0070658_100047804 403
181 3300005328 Ga0070676_10041780 Ga0070676_100417801 403
182 3300005339 Ga0070660_100023830 Ga0070660_1000238305 403
183 3300005344 Ga0070661_100010094 Ga0070661_1000100944 403
184 3300005354 Ga0070675_100199005 Ga0070675_1001990052 403
185 3300005356 Ga0070674_100005747 Ga0070674_1000057471 403
186 3300005356 Ga0070674_100009123 Ga0070674_1000091231 403
187 3300005455 Ga0070663_100088802 Ga0070663_1000888022 403
188 3300005456 Ga0070678_100042153 Ga0070678_1000421533 403
189 3300005539 Ga0068853_100109657 Ga0068853_1001096572 403
190 3300005563 Ga0068855_100097859 Ga0068855_1000978592 403
191 3300005564 Ga0070664_100003863 Ga0070664_1000038639 403
192 3300005578 Ga0068854_100033461 Ga0068854_1000334612 403
193 3300005617 Ga0068859_100030291 Ga0068859_1000302915 403
194 3300005834 Ga0068851_10017063 Ga0068851_100170632 403
195 3300005843 Ga0068860_100156545 Ga0068860_1001565453 403
196 3300006931 Ga0097620_100030291 Ga0097620_1000302915 403
197 3300009093 Ga0105240_10013931 Ga0105240_100139319 403
198 3300009093 Ga0105240_10317611 Ga0105240_103176111 403
199 3300009174 Ga0105241_10000452 Ga0105241_1000045220 403
200 3300009176 Ga0105242_10249420 Ga0105242_102494201 403
201 3300009545 Ga0105237_10228679 Ga0105237_102286792 403
202 3300009545 Ga0105237_10304411 Ga0105237_103044112 403
203 3300013102 Ga0157371_10000148 Ga0157371_100001489 403
204 3300013104 Ga0157370_10252404 Ga0157370_102524041 403
205 3300013104 Ga0157370_10284659 Ga0157370_102846591 403
206 3300013105 Ga0157369_10054717 Ga0157369_100547173 403
207 3300014969 Ga0157376_10075905 Ga0157376_100759052 403
208 3300025226 Ga0209674_105442 Ga0209674_1054421 403
209 3300025230 Ga0209563_100024 Ga0209563_100024342 403
210 3300025253 Ga0209677_101534 Ga0209677_1015346 403
211 3300025254 Ga0209148_1000008 Ga0209148_1000008295 403
212 3300025272 Ga0209455_1000002 Ga0209455_10000021128 403
213 3300025291 Ga0209675_1000188 Ga0209675_10001888 403
214 3300025292 Ga0209676_1000070 Ga0209676_1000070128 403
215 3300025292 Ga0209676_1000593 Ga0209676_100059310 403
216 3300025294 Ga0209025_1027965 Ga0209025_10279652 403
217 3300025297 Ga0209758_1000007 Ga0209758_10000071125 403
218 3300025298 Ga0209050_1000115 Ga0209050_1000115130 403
219 3300025304 Ga0209257_1000160 Ga0209257_1000160104 403
220 3300025321 Ga0207656_10022343 Ga0207656_100223433 403
221 3300025909 Ga0207705_10000127 Ga0207705_1000012748 403
222 3300025913 Ga0207695_10224743 Ga0207695_102247432 403
223 3300025913 Ga0207695_10224789 Ga0207695_102247892 403
224 3300025914 Ga0207671_10008129 Ga0207671_100081296 403
225 3300025919 Ga0207657_10035661 Ga0207657_100356612 403
226 3300025920 Ga0207649_10001574 Ga0207649_100015742 403
227 3300025924 Ga0207694_10006451 Ga0207694_100064516 403
228 3300025926 Ga0207659_10156350 Ga0207659_101563502 403
229 3300025932 Ga0207690_10000965 Ga0207690_1000096513 403
230 3300025932 Ga0207690_10068983 Ga0207690_100689832 403
231 3300025935 Ga0207709_10000109 Ga0207709_1000010911 403
232 3300025937 Ga0207669_10000059 Ga0207669_1000005951 403
233 3300025937 Ga0207669_10000384 Ga0207669_100003849 403
234 3300025945 Ga0207679_10022618 Ga0207679_100226183 403
235 3300025949 Ga0207667_10000074 Ga0207667_1000007467 403
236 3300025949 Ga0207667_10372121 Ga0207667_103721211 403
237 3300025981 Ga0207640_10005413 Ga0207640_100054133 403
238 3300026089 Ga0207648_10053104 Ga0207648_100531043 403
239 3300026121 Ga0207683_10002089 Ga0207683_100020896 403
240 3300026142 Ga0207698_10001783 Ga0207698_100017838 403
241 3300028381 Ga0268264_10285020 Ga0268264_102850202 403
242 3300028786 Ga0307517_10037580 Ga0307517_100375803 403
243 3300031911 Ga0307412_10037976 Ga0307412_100379761 403
244 3300032004 Ga0307414_10001704 Ga0307414_100017046 403
245 3300032004 Ga0307414_10165624 Ga0307414_101656241 403
246 3300037312 Ga0395899_0019969 Ga0395899_0019969_965_2176 403
247 3300038443 Ga0395901_0297922 Ga0395901_0297922_395_1606 403
248 3300046471 Ga0495650_0000058 Ga0495650_0000058_168070_169281 403
249 3300046491 Ga0495584_0004747 Ga0495584_0004747_943_2154 403
250 3300046491 Ga0495584_0067451 Ga0495584_0067451_145_1356 403
251 3300046492 Ga0495585_0012409 Ga0495585_0012409_2751_3962 403
252 3300046500 Ga0495596_0040387 Ga0495596_0040387_150_1361 403
253 3300046506 Ga0495583_0000673 Ga0495583_0000673_14747_15958 403
254 3300046506 Ga0495583_0003905 Ga0495583_0003905_3148_4359 403
255 3300046518 Ga0495631_0015276 Ga0495631_0015276_1256_2467 403
256 3300046520 Ga0495637_0013938 Ga0495637_0013938_2341_3552 403
257 3300046522 Ga0495643_0000557 Ga0495643_0000557_1925_3136 403
258 3300046522 Ga0495643_0004800 Ga0495643_0004800_5191_6402 403
259 3300046522 Ga0495643_0023176 Ga0495643_0023176_1283_2494 403
260 3300046542 Ga0495597_0008130 Ga0495597_0008130_3573_4784 403
261 3300046557 Ga0495622_0004213 Ga0495622_0004213_3188_4399 403
262 3300046558 Ga0495633_0001087 Ga0495633_0001087_14972_16183 403
263 3300046616 Ga0495668_0000098 Ga0495668_0000098_88883_90094 403
264 3300046616 Ga0495668_0018815 Ga0495668_0018815_167_1378 403
265 3300046660 Ga0495625_0005013 Ga0495625_0005013_5279_6490 403
266 3300046660 Ga0495625_0008659 Ga0495625_0008659_5277_6488 403
267 3300046660 Ga0495625_0033817 Ga0495625_0033817_2397_3608 403
268 3300046684 Ga0495669_0000026 Ga0495669_0000026_45144_46355 403
269 3300046691 Ga0495670_0002829 Ga0495670_0002829_1580_2791 403
270 3300046694 Ga0495649_0057746 Ga0495649_0057746_353_1564 403
271 3300046809 Ga0495600_0000389 Ga0495600_0000389_14402_15613 403
272 3300046810 Ga0495660_0016883 Ga0495660_0016883_520_1731 403
273 3300047323 Ga0495683_0058507 Ga0495683_0058507_583_1794 403
274 3300047443 Ga0495687_000123 Ga0495687_000123_35421_36632 403
275 3300047443 Ga0495687_000285 Ga0495687_000285_35355_36566 403
276 3300047470 Ga0495681_0001526 Ga0495681_0001526_2907_4118 403
277 3300047470 Ga0495681_0068301 Ga0495681_0068301_213_1424 403
278 3300048905 Ga0496102_0000092 Ga0496102_0000092_86954_88165 403
279 3300048906 Ga0496103_0000101 Ga0496103_0000101_85069_86280 403
280 3300048907 Ga0496104_0009124 Ga0496104_0009124_3445_4656 403
281 3300048908 Ga0496105_0001224 Ga0496105_0001224_2542_3753 403
282 3300048910 Ga0496107_0025116 Ga0496107_0025116_1593_2804 403
283 3300048914 Ga0496111_0006559 Ga0496111_0006559_3072_4283 403
284 3300048917 Ga0496114_0004414 Ga0496114_0004414_9253_10464 403
285 3300048918 Ga0496115_0000038 Ga0496115_0000038_39047_40258 403
286 3300048919 Ga0496116_0000627 Ga0496116_0000627_7388_8599 403
287 3300048920 Ga0496117_0000173 Ga0496117_0000173_47131_48342 403
288 3300048921 Ga0496118_0000131 Ga0496118_0000131_84907_86118 403
289 3300048922 Ga0496119_0009367 Ga0496119_0009367_3630_4841 403
290 3300048923 Ga0496120_0004518 Ga0496120_0004518_4444_5655 403
291 3300048924 Ga0496121_0000209 Ga0496121_0000209_84885_86096 403
292 3300048924 Ga0496121_0023519 Ga0496121_0023519_2319_3530 403
293 3300048927 Ga0496124_0000166 Ga0496124_0000166_85075_86286 403
294 3300048929 Ga0496126_0000222 Ga0496126_0000222_37821_39032 403
295 3300049823 Ga0501044_0000121 Ga0501044_0000121_73415_74626 403
296 3300053079 Ga0500610_0000169 Ga0500610_0000169_4471_5682 403
297 3300053119 Ga0500595_000230 Ga0500595_000230_10013_11224 403
298 3300053136 Ga0500559_0065143 Ga0500559_0065143_274_1485 403
299 3300053177 Ga0500636_0002265 Ga0500636_0002265_844_2055 403
300 3300053730 Ga0500645_000045 Ga0500645_000045_66585_67796 403
301 3300053735 Ga0500596_002065 Ga0500596_002065_1694_2905 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

2

255

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.8911 3 403
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.8778 3 403
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8572 4 345
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8547 5 403
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8431 4 345
ID Description Score Start End Superfamily
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8881 3 346 3.40.190.10
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8571 88 208 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8383 88 208 3.40.190.10
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7989 3 346 3.40.190.10
3up9A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7894 3 96 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A430E7E2-F1-model_v4 deleted 0.9851 1 367
AF-A0A430E7E2-F1-model_v4 deleted 0.9824 1 367
AF-A0A327JPI0-F1-model_v4 Nitrate transporter 0.9635 1 220 GO:0005886
GO:0012505
AF-A0A679JJF7-F1-model_v4 Nitrate transport protein NrtA 0.9616 5 348 GO:0005886
GO:0012505
AF-A0A4Q3MZI6-F1-model_v4 deleted 0.9578 4 274

Feature Viewer

pLDDT pTM Quality
87.43 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map