F396209
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 230 | 277 | 421 |
Family's Representative Sequence
| Representative Sequence | 3300059641|Ga0587068_006732|Ga0587068_006732_74_1411 |
| Length | 445 |
| Sequence | MLAAVAPKRGEGTSVKIIVLGSGVIGTTSAYYLAKAGHEVTVIDRQPAAGLETSYANAGEVSPGYSAPWAAPGIPVKAMKWLLMRHSPLAIRPSLDPAMWRWVFEMLMNCTSARYETNKGRMVRLAEYSRDCLAQLRADTGISYDERTQGTMQLFRTQKQLDASAADIAVLERYGVPYEVLDEDGCIKVEPALAQVRGKFVGALRLPGDETGDCFKFTQQLATMAEKAGVKFKYGVSIQRLATDGRKITGIVTSEGQLKADSYVLALGSYSPLLLRDLGIRIPVYPIKGYSITIPIYDEKSAPESTIMDETYKVAITRLGDRIRVGGTAEIAGYDLTLRNARRETLEYSVVDLFPRGGDVSQAEFWTGLRPMTPDGTPVVGPTTYSNLFLNTGHGTLGWTMACGSGRLLSDLVSGKRPEIDTEGLFMDRYGKTSRPLAAPQEARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 3 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 4 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 5 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 6 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 7 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 8 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 9 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 10 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 11 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 12 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 13 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 14 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 15 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 16 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 17 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 18 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 19 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 20 | 2941479691 | |||
| 21 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 22 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 62 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 119 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 121 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 122 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 129 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 130 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 131 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 132 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 133 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 134 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 135 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 136 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 137 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 140 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 169 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 170 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 171 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 181 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 182 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 196 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 197 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 199 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 201 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 202 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 203 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 204 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 205 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 230 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.4 |
| Metatranscriptomes | 11.63 |
| Isolates | 7.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.64 |
| Nodule | 2.66 |
| Rhizoplane | 4.65 |
| Rhizosphere | 71.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000190 | 3300003203 | Bacteria | 27399 |
| 2 | Ga0055534_1000024 | 3300003784 | Bacteria | 131674 |
| 3 | Ga0055528_1001328 | 3300003790 | Bacteria | 15400 |
| 4 | Ga0070658_10098232 | 3300005327 | Bacteria | 2418 |
| 5 | Ga0070660_100001231 | 3300005339 | Bacteria | 17385 |
| 6 | Ga0070689_100042599 | 3300005340 | Bacteria | 3486 |
| 7 | Ga0070669_100036308 | 3300005353 | Bacteria | 3570 |
| 8 | Ga0070675_100281898 | 3300005354 | Bacteria | 1460 |
| 9 | Ga0070674_100011296 | 3300005356 | Bacteria | 5433 |
| 10 | Ga0070674_100021312 | 3300005356 | Bacteria | 4156 |
| 11 | Ga0070688_100041939 | 3300005365 | Bacteria | 2812 |
| 12 | Ga0070659_100000825 | 3300005366 | Bacteria | 22592 |
| 13 | Ga0070667_100102125 | 3300005367 | Bacteria | 2477 |
| 14 | Ga0070714_100075787 | 3300005435 | Bacteria | 2919 |
| 15 | Ga0070700_100027125 | 3300005441 | Bacteria | 3393 |
| 16 | Ga0070663_100002382 | 3300005455 | Bacteria | 10569 |
| 17 | Ga0070663_100120717 | 3300005455 | Bacteria | 1979 |
| 18 | Ga0070685_10004919 | 3300005466 | Bacteria | 6758 |
| 19 | Ga0070684_100104230 | 3300005535 | Bacteria | 2537 |
| 20 | Ga0070665_100055299 | 3300005548 | Bacteria | 3981 |
| 21 | Ga0070664_100013271 | 3300005564 | Bacteria | 6710 |
| 22 | Ga0068852_100026332 | 3300005616 | Bacteria | 4726 |
| 23 | Ga0068852_100030354 | 3300005616 | Bacteria | 4448 |
| 24 | Ga0068859_100017655 | 3300005617 | Bacteria | 7173 |
| 25 | Ga0068864_100002249 | 3300005618 | Bacteria | 15963 |
| 26 | Ga0068864_100028302 | 3300005618 | Bacteria | 4736 |
| 27 | Ga0068861_100018717 | 3300005719 | Bacteria | 4936 |
| 28 | Ga0068870_10026253 | 3300005840 | Bacteria | 2902 |
| 29 | Ga0068863_100031060 | 3300005841 | Bacteria | 5100 |
| 30 | Ga0068863_100052885 | 3300005841 | Bacteria | 3848 |
| 31 | Ga0068858_100036864 | 3300005842 | Bacteria | 4534 |
| 32 | Ga0068862_100015054 | 3300005844 | Bacteria | 6424 |
| 33 | Ga0068862_100094388 | 3300005844 | Bacteria | 2609 |
| 34 | Ga0081538_10012767 | 3300005981 | Bacteria | 6708 |
| 35 | Ga0081540_1038232 | 3300005983 | Bacteria | 2532 |
| 36 | Ga0081539_10000072 | 3300005985 | Bacteria | 232726 |
| 37 | Ga0075363_100005901 | 3300006048 | Bacteria | 5514 |
| 38 | Ga0075364_10006244 | 3300006051 | Bacteria | 6986 |
| 39 | Ga0075432_10001625 | 3300006058 | Bacteria | 7389 |
| 40 | Ga0075362_10013877 | 3300006177 | Bacteria | 3237 |
| 41 | Ga0075366_10049179 | 3300006195 | Bacteria | 2502 |
| 42 | Ga0068871_100005799 | 3300006358 | Bacteria | 8678 |
| 43 | Ga0068865_100053630 | 3300006881 | Bacteria | 2798 |
| 44 | Ga0097620_100017655 | 3300006931 | Bacteria | 7173 |
| 45 | Ga0079104_1000004 | 3300006946 | Bacteria | 444549 |
| 46 | Ga0099826_10000068 | 3300006948 | Bacteria | 55540 |
| 47 | Ga0105245_10010351 | 3300009098 | Bacteria | 8124 |
| 48 | Ga0105245_10025391 | 3300009098 | Bacteria | 5211 |
| 49 | Ga0114129_10463422 | 3300009147 | Bacteria | 1660 |
| 50 | Ga0105243_10000352 | 3300009148 | Bacteria | 49052 |
| 51 | Ga0105243_10000498 | 3300009148 | Bacteria | 40115 |
| 52 | Ga0105241_10134674 | 3300009174 | Bacteria | 2004 |
| 53 | Ga0105237_10000828 | 3300009545 | Bacteria | 42351 |
| 54 | Ga0105237_10043574 | 3300009545 | Bacteria | 4520 |
| 55 | Ga0105249_10025620 | 3300009553 | Bacteria | 5312 |
| 56 | Ga0105239_10032303 | 3300010375 | Bacteria | 5752 |
| 57 | Ga0105239_10082261 | 3300010375 | Bacteria | 3545 |
| 58 | Ga0105246_10003208 | 3300011119 | Bacteria | 9930 |
| 59 | Ga0157374_10131777 | 3300013296 | Bacteria | 2420 |
| 60 | Ga0157378_10009858 | 3300013297 | Bacteria | 8325 |
| 61 | Ga0157378_10068033 | 3300013297 | Bacteria | 3193 |
| 62 | Ga0163162_10011613 | 3300013306 | Bacteria | 8587 |
| 63 | Ga0163162_10143458 | 3300013306 | Bacteria | 2502 |
| 64 | Ga0163163_10000004 | 3300014325 | Bacteria | 416569 |
| 65 | Ga0163163_10008087 | 3300014325 | Bacteria | 9318 |
| 66 | Ga0163163_10044219 | 3300014325 | Bacteria | 4368 |
| 67 | Ga0182008_10000041 | 3300014497 | Bacteria | 118254 |
| 68 | Ga0157379_10000869 | 3300014968 | Bacteria | 24442 |
| 69 | Ga0157379_10086638 | 3300014968 | Bacteria | 2808 |
| 70 | Ga0157376_10009387 | 3300014969 | Bacteria | 7106 |
| 71 | Ga0157376_10327667 | 3300014969 | Bacteria | 1458 |
| 72 | Ga0209026_1004077 | 3300025250 | Bacteria | 4509 |
| 73 | Ga0209148_1000306 | 3300025254 | Bacteria | 70293 |
| 74 | Ga0209233_1013596 | 3300025261 | Bacteria | 2321 |
| 75 | Ga0209565_1000040 | 3300025263 | Bacteria | 266543 |
| 76 | Ga0209455_1003017 | 3300025272 | Bacteria | 6173 |
| 77 | Ga0209673_1000109 | 3300025273 | Bacteria | 183000 |
| 78 | Ga0209675_1000024 | 3300025291 | Bacteria | 312615 |
| 79 | Ga0209025_1005140 | 3300025294 | Bacteria | 10854 |
| 80 | Ga0209050_1001709 | 3300025298 | Bacteria | 21920 |
| 81 | Ga0207688_10030589 | 3300025901 | Bacteria | 2970 |
| 82 | Ga0207643_10005416 | 3300025908 | Bacteria | 6825 |
| 83 | Ga0207654_10062702 | 3300025911 | Bacteria | 2179 |
| 84 | Ga0207695_10000136 | 3300025913 | Bacteria | 217596 |
| 85 | Ga0207695_10259869 | 3300025913 | Bacteria | 1634 |
| 86 | Ga0207671_10006469 | 3300025914 | Bacteria | 10428 |
| 87 | Ga0207671_10031150 | 3300025914 | Bacteria | 3976 |
| 88 | Ga0207657_10002337 | 3300025919 | Bacteria | 20558 |
| 89 | Ga0207657_10005104 | 3300025919 | Bacteria | 13756 |
| 90 | Ga0207681_10028695 | 3300025923 | Bacteria | 3607 |
| 91 | Ga0207650_10006350 | 3300025925 | Bacteria | 8052 |
| 92 | Ga0207687_10085124 | 3300025927 | Bacteria | 2293 |
| 93 | Ga0207687_10167670 | 3300025927 | Bacteria | 1691 |
| 94 | Ga0207664_10051079 | 3300025929 | Bacteria | 3263 |
| 95 | Ga0207644_10089535 | 3300025931 | Bacteria | 2291 |
| 96 | Ga0207709_10000138 | 3300025935 | Bacteria | 104006 |
| 97 | Ga0207709_10001062 | 3300025935 | Bacteria | 20280 |
| 98 | Ga0207704_10022454 | 3300025938 | Bacteria | 3381 |
| 99 | Ga0207689_10001070 | 3300025942 | Bacteria | 26388 |
| 100 | Ga0207661_10061424 | 3300025944 | Bacteria | 3036 |
| 101 | Ga0207712_10013433 | 3300025961 | Bacteria | 5249 |
| 102 | Ga0207712_10072679 | 3300025961 | Bacteria | 2478 |
| 103 | Ga0207658_10027164 | 3300025986 | Bacteria | 4020 |
| 104 | Ga0207703_10017168 | 3300026035 | Bacteria | 5646 |
| 105 | Ga0207639_10115417 | 3300026041 | Bacteria | 2196 |
| 106 | Ga0207678_10006898 | 3300026067 | Bacteria | 10076 |
| 107 | Ga0207678_10151845 | 3300026067 | Bacteria | 1978 |
| 108 | Ga0207708_10046002 | 3300026075 | Bacteria | 3325 |
| 109 | Ga0207641_10038880 | 3300026088 | Bacteria | 3978 |
| 110 | Ga0207648_10035700 | 3300026089 | Bacteria | 4380 |
| 111 | Ga0207676_10001668 | 3300026095 | Bacteria | 16361 |
| 112 | Ga0207676_10072296 | 3300026095 | Bacteria | 2772 |
| 113 | Ga0207676_10083086 | 3300026095 | Bacteria | 2607 |
| 114 | Ga0207675_100011421 | 3300026118 | Bacteria | 8309 |
| 115 | Ga0207675_100147559 | 3300026118 | Bacteria | 2237 |
| 116 | Ga0207683_10006993 | 3300026121 | Bacteria | 9675 |
| 117 | Ga0207683_10009454 | 3300026121 | Bacteria | 8306 |
| 118 | Ga0207698_10067910 | 3300026142 | Bacteria | 2813 |
| 119 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 120 | Ga0209282_1007281 | 3300027666 | Bacteria | 6920 |
| 121 | Ga0207428_10050853 | 3300027907 | Bacteria | 3313 |
| 122 | Ga0268266_10016344 | 3300028379 | Bacteria | 6345 |
| 123 | Ga0265325_10001308 | 3300031241 | Bacteria | 17649 |
| 124 | Ga0265339_10017769 | 3300031249 | Bacteria | 4205 |
| 125 | Ga0307513_10217570 | 3300031456 | Bacteria | 1735 |
| 126 | Ga0265313_10008008 | 3300031595 | Bacteria | 7092 |
| 127 | Ga0373924_0006808 | 3300035410 | Bacteria | 4107 |
| 128 | Ga0395899_0000288 | 3300037312 | Bacteria | 64881 |
| 129 | Ga0395899_0000586 | 3300037312 | Bacteria | 38344 |
| 130 | Ga0395899_0001645 | 3300037312 | Bacteria | 18655 |
| 131 | Ga0395899_0002844 | 3300037312 | Bacteria | 13933 |
| 132 | Ga0395900_0000246 | 3300037418 | Bacteria | 85104 |
| 133 | Ga0395900_0031592 | 3300037418 | Bacteria | 5443 |
| 134 | Ga0395900_0157840 | 3300037418 | Bacteria | 2316 |
| 135 | Ga0395900_0235622 | 3300037418 | Bacteria | 1838 |
| 136 | Ga0395898_0000447 | 3300037466 | Bacteria | 85103 |
| 137 | Ga0395898_0128299 | 3300037466 | Bacteria | 2429 |
| 138 | Ga0395905_0000228 | 3300037471 | Bacteria | 85103 |
| 139 | Ga0395905_0000256 | 3300037471 | Bacteria | 79866 |
| 140 | Ga0395905_0020129 | 3300037471 | Bacteria | 6322 |
| 141 | Ga0395901_0000167 | 3300038443 | Bacteria | 85844 |
| 142 | Ga0395901_0019294 | 3300038443 | Bacteria | 6970 |
| 143 | Ga0436361_0040547 | 3300039447 | Bacteria | 7174 |
| 144 | Ga0436361_0836000 | 3300039447 | Bacteria | 3637 |
| 145 | Ga0439465_0000947 | 3300041413 | Bacteria | 9202 |
| 146 | Ga0439431_0000923 | 3300041997 | Bacteria | 6371 |
| 147 | Ga0439445_0001289 | 3300042004 | Bacteria | 5418 |
| 148 | Ga0439452_001510 | 3300042010 | Bacteria | 9407 |
| 149 | Ga0439457_002420 | 3300042014 | Bacteria | 5338 |
| 150 | Ga0450919_005444 | 3300042121 | Bacteria | 1528 |
| 151 | Ga0439434_0000778 | 3300042435 | Bacteria | 9172 |
| 152 | Ga0466972_0000360 | 3300044658 | Bacteria | 24585 |
| 153 | Ga0466966_0008582 | 3300044684 | Bacteria | 6763 |
| 154 | Ga0466963_0009517 | 3300044694 | Bacteria | 5853 |
| 155 | Ga0466971_0027655 | 3300044719 | Bacteria | 2541 |
| 156 | Ga0466959_0014835 | 3300045049 | Bacteria | 5674 |
| 157 | Ga0466959_0037646 | 3300045049 | Bacteria | 3575 |
| 158 | Ga0466959_0108262 | 3300045049 | Bacteria | 1986 |
| 159 | Ga0451576_0191743 | 3300045051 | Bacteria | 2135 |
| 160 | Ga0495582_0124203 | 3300046473 | Bacteria | 1456 |
| 161 | Ga0495584_0000167 | 3300046491 | Bacteria | 46214 |
| 162 | Ga0495585_0000125 | 3300046492 | Bacteria | 83087 |
| 163 | Ga0495585_0002757 | 3300046492 | Bacteria | 12245 |
| 164 | Ga0495585_0003275 | 3300046492 | Bacteria | 11018 |
| 165 | Ga0495594_0092619 | 3300046499 | Bacteria | 1694 |
| 166 | Ga0495596_0006074 | 3300046500 | Bacteria | 5626 |
| 167 | Ga0495583_0000065 | 3300046506 | Bacteria | 192022 |
| 168 | Ga0495616_0000631 | 3300046513 | Bacteria | 26364 |
| 169 | Ga0495616_0010663 | 3300046513 | Bacteria | 5309 |
| 170 | Ga0495630_0101146 | 3300046517 | Bacteria | 2181 |
| 171 | Ga0495637_0078722 | 3300046520 | Bacteria | 1317 |
| 172 | Ga0495648_0000053 | 3300046524 | Bacteria | 159860 |
| 173 | Ga0495666_0006950 | 3300046526 | Bacteria | 5687 |
| 174 | Ga0495654_0019488 | 3300046530 | Bacteria | 3549 |
| 175 | Ga0495586_0030938 | 3300046535 | Bacteria | 2865 |
| 176 | Ga0495587_0045098 | 3300046536 | Bacteria | 2621 |
| 177 | Ga0495609_0018203 | 3300046538 | Bacteria | 3257 |
| 178 | Ga0495622_0017459 | 3300046557 | Bacteria | 3340 |
| 179 | Ga0495668_0003462 | 3300046616 | Bacteria | 11786 |
| 180 | Ga0495625_0000299 | 3300046660 | Bacteria | 76372 |
| 181 | Ga0495625_0007499 | 3300046660 | Bacteria | 9482 |
| 182 | Ga0495670_0002225 | 3300046691 | Bacteria | 9578 |
| 183 | Ga0495670_0008477 | 3300046691 | Bacteria | 5057 |
| 184 | Ga0495600_0078076 | 3300046809 | Bacteria | 2162 |
| 185 | Ga0495683_0000614 | 3300047323 | Bacteria | 26609 |
| 186 | Ga0495675_0029590 | 3300047444 | Bacteria | 3493 |
| 187 | Ga0495686_0072092 | 3300047472 | Bacteria | 2125 |
| 188 | Ga0495626_0037804 | 3300048091 | Bacteria | 2292 |
| 189 | Ga0496100_0017983 | 3300048903 | Bacteria | 4185 |
| 190 | Ga0496102_0004248 | 3300048905 | Bacteria | 12114 |
| 191 | Ga0496103_0011511 | 3300048906 | Bacteria | 5242 |
| 192 | Ga0496105_0042714 | 3300048908 | Bacteria | 3738 |
| 193 | Ga0496107_0012004 | 3300048910 | Bacteria | 6044 |
| 194 | Ga0496108_0358007 | 3300048911 | Bacteria | 1273 |
| 195 | Ga0496109_0442098 | 3300048912 | Bacteria | 1228 |
| 196 | Ga0496110_0109276 | 3300048913 | Bacteria | 2483 |
| 197 | Ga0496112_0061183 | 3300048915 | Bacteria | 3711 |
| 198 | Ga0496112_0106347 | 3300048915 | Bacteria | 2776 |
| 199 | Ga0496113_0005038 | 3300048916 | Bacteria | 8196 |
| 200 | Ga0496115_0002660 | 3300048918 | Bacteria | 12829 |
| 201 | Ga0496115_0346620 | 3300048918 | Bacteria | 1212 |
| 202 | Ga0496116_0002434 | 3300048919 | Bacteria | 19593 |
| 203 | Ga0496116_0026550 | 3300048919 | Bacteria | 4233 |
| 204 | Ga0496117_0008553 | 3300048920 | Bacteria | 9708 |
| 205 | Ga0496118_0004807 | 3300048921 | Bacteria | 15762 |
| 206 | Ga0496118_0035701 | 3300048921 | Bacteria | 4032 |
| 207 | Ga0496119_0013864 | 3300048922 | Bacteria | 6364 |
| 208 | Ga0496119_0053132 | 3300048922 | Bacteria | 2477 |
| 209 | Ga0496120_0010587 | 3300048923 | Bacteria | 6415 |
| 210 | Ga0496121_0001225 | 3300048924 | Bacteria | 44636 |
| 211 | Ga0496121_0015782 | 3300048924 | Bacteria | 7867 |
| 212 | Ga0496122_0000021 | 3300048925 | Bacteria | 391363 |
| 213 | Ga0496123_0001826 | 3300048926 | Bacteria | 27983 |
| 214 | Ga0496124_0000151 | 3300048927 | Bacteria | 142761 |
| 215 | Ga0496124_0007006 | 3300048927 | Bacteria | 12080 |
| 216 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 217 | Ga0496125_0008396 | 3300048928 | Bacteria | 10820 |
| 218 | Ga0496125_0022617 | 3300048928 | Bacteria | 5832 |
| 219 | Ga0496125_0024631 | 3300048928 | Bacteria | 5528 |
| 220 | Ga0496126_0018541 | 3300048929 | Bacteria | 6891 |
| 221 | Ga0496126_0081056 | 3300048929 | Bacteria | 2870 |
| 222 | Ga0495678_022367 | 3300049459 | Bacteria | 2765 |
| 223 | Ga0501033_0046303 | 3300049570 | Bacteria | 3234 |
| 224 | Ga0501038_0122400 | 3300049574 | Bacteria | 2144 |
| 225 | Ga0501039_0054859 | 3300049575 | Bacteria | 3086 |
| 226 | Ga0501043_0015482 | 3300049579 | Bacteria | 5974 |
| 227 | Ga0501047_0027810 | 3300049581 | Bacteria | 5449 |
| 228 | Ga0501047_0110044 | 3300049581 | Bacteria | 2638 |
| 229 | Ga0501044_0026838 | 3300049823 | Bacteria | 6096 |
| 230 | Ga0501044_0032007 | 3300049823 | Bacteria | 5529 |
| 231 | nmdc:mga03683_1876_c1 | 3300050489 | Bacteria | 6402 |
| 232 | nmdc:mga00v17_11139_c1 | 3300050491 | Bacteria | 4935 |
| 233 | nmdc:mga0yw44_927_c1 | 3300050492 | Bacteria | 11106 |
| 234 | nmdc:mga0k408_3780_c1 | 3300050493 | Bacteria | 8025 |
| 235 | nmdc:mga07m45_101496_c1 | 3300050496 | Bacteria | 1652 |
| 236 | nmdc:mga07m45_1840_c1 | 3300050496 | Bacteria | 9798 |
| 237 | Ga0500554_001632 | 3300053102 | Bacteria | 4309 |
| 238 | Ga0500595_001027 | 3300053119 | Bacteria | 15641 |
| 239 | Ga0500608_003662 | 3300053122 | Bacteria | 5809 |
| 240 | Ga0500636_0004081 | 3300053177 | Bacteria | 8246 |
| 241 | Ga0500636_0048641 | 3300053177 | Bacteria | 2496 |
| 242 | Ga0500645_000242 | 3300053730 | Bacteria | 40854 |
| 243 | Ga0587084_005755 | 3300059477 | Bacteria | 1481 |
| 244 | Ga0587093_001581 | 3300059478 | Bacteria | 1957 |
| 245 | Ga0587093_002907 | 3300059478 | Bacteria | 1644 |
| 246 | Ga0587066_002880 | 3300059490 | Bacteria | 1956 |
| 247 | Ga0587070_001609 | 3300059491 | Bacteria | 2378 |
| 248 | Ga0587070_007964 | 3300059491 | Bacteria | 1487 |
| 249 | Ga0587077_002017 | 3300059493 | Bacteria | 2325 |
| 250 | Ga0587077_002193 | 3300059493 | Bacteria | 2269 |
| 251 | Ga0587083_0010725 | 3300059505 | Bacteria | 1493 |
| 252 | Ga0587085_003473 | 3300059506 | Bacteria | 1717 |
| 253 | Ga0587088_006971 | 3300059508 | Bacteria | 1545 |
| 254 | Ga0587090_002092 | 3300059510 | Bacteria | 2143 |
| 255 | Ga0587090_006182 | 3300059510 | Bacteria | 1528 |
| 256 | Ga0587091_002195 | 3300059511 | Bacteria | 2281 |
| 257 | Ga0587092_005761 | 3300059512 | Bacteria | 1543 |
| 258 | Ga0587092_006374 | 3300059512 | Bacteria | 1491 |
| 259 | Ga0587094_001434 | 3300059513 | Bacteria | 2252 |
| 260 | Ga0587101_000835 | 3300059623 | Bacteria | 2419 |
| 261 | Ga0587101_001123 | 3300059623 | Bacteria | 2201 |
| 262 | Ga0587062_001202 | 3300059639 | Bacteria | 2157 |
| 263 | Ga0587062_004048 | 3300059639 | Bacteria | 1530 |
| 264 | Ga0587068_005948 | 3300059641 | Bacteria | 1687 |
| 265 | Ga0587068_006732 | 3300059641 | Bacteria | 1618 |
| 266 | Ga0587069_002133 | 3300059642 | Bacteria | 1956 |
| 267 | Ga0587072_009639 | 3300059643 | Bacteria | 1547 |
| 268 | Ga0587075_005221 | 3300059644 | Bacteria | 1546 |
| 269 | Ga0587076_000697 | 3300059645 | Bacteria | 2970 |
| 270 | Ga0587076_001856 | 3300059645 | Bacteria | 2254 |
| 271 | Ga0587078_000975 | 3300059646 | Bacteria | 2400 |
| 272 | Ga0587078_001062 | 3300059646 | Bacteria | 2335 |
| 273 | Ga0587079_002942 | 3300059647 | Bacteria | 2166 |
| 274 | Ga0587102_000732 | 3300059649 | Bacteria | 2020 |
| 275 | Ga0587071_002133 | 3300060344 | Bacteria | 2630 |
| 276 | Ga0587111_0001593 | 3300060346 | Bacteria | 2788 |
| 277 | Ga0587111_0005298 | 3300060346 | Bacteria | 1979 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046691 | Ga0495670_0008477 | Ga0495670_0008477_3945_5042 | 351 |
| 2 | 3300042121 | Ga0450919_005444 | Ga0450919_005444_397_1479 | 360 |
| 3 | 3300046473 | Ga0495582_0124203 | Ga0495582_0124203_346_1434 | 360 |
| 4 | 3300046520 | Ga0495637_0078722 | Ga0495637_0078722_153_1277 | 360 |
| 5 | 3300048918 | Ga0496115_0346620 | Ga0496115_0346620_95_1183 | 360 |
| 6 | 3300050496 | nmdc:mga07m45_101496_c1 | nmdc:mga07m45_101496_c1_31_1113 | 360 |
| 7 | 3300048912 | Ga0496109_0442098 | Ga0496109_0442098_100_1215 | 371 |
| 8 | 3300005339 | Ga0070660_100001231 | Ga0070660_10000123111 | 392 |
| 9 | 3300005366 | Ga0070659_100000825 | Ga0070659_1000008258 | 392 |
| 10 | 3300005564 | Ga0070664_100013271 | Ga0070664_1000132712 | 392 |
| 11 | 3300025919 | Ga0207657_10002337 | Ga0207657_100023377 | 392 |
| 12 | 3300059647 | Ga0587079_002942 | Ga0587079_002942_199_1413 | 392 |
| 13 | 3300038443 | Ga0395901_0019294 | Ga0395901_0019294_17_1225 | 402 |
| 14 | 3300037312 | Ga0395899_0000288 | Ga0395899_0000288_19396_20652 | 404 |
| 15 | 3300037418 | Ga0395900_0000246 | Ga0395900_0000246_19395_20651 | 404 |
| 16 | 3300037466 | Ga0395898_0000447 | Ga0395898_0000447_19394_20650 | 404 |
| 17 | 3300037471 | Ga0395905_0000228 | Ga0395905_0000228_64454_65710 | 404 |
| 18 | 3300038443 | Ga0395901_0000167 | Ga0395901_0000167_65194_66450 | 404 |
| 19 | 3300049459 | Ga0495678_022367 | Ga0495678_022367_476_1771 | 407 |
| 20 | 3300048924 | Ga0496121_0015782 | Ga0496121_0015782_5126_6379 | 408 |
| 21 | 3300053122 | Ga0500608_003662 | Ga0500608_003662_1867_3120 | 408 |
| 22 | 3300053177 | Ga0500636_0004081 | Ga0500636_0004081_4772_6025 | 408 |
| 23 | 3300047444 | Ga0495675_0029590 | Ga0495675_0029590_197_1426 | 409 |
| 24 | 3300048921 | Ga0496118_0035701 | Ga0496118_0035701_677_1930 | 409 |
| 25 | 3300053102 | Ga0500554_001632 | Ga0500554_001632_2910_4163 | 409 |
| 26 | 3300037418 | Ga0395900_0235622 | Ga0395900_0235622_559_1827 | 410 |
| 27 | 3300048911 | Ga0496108_0358007 | Ga0496108_0358007_22_1260 | 412 |
| 28 | iso_pu_bacteria | 2721755523 | 2722884257 | 412 |
| 29 | iso_pu_bacteria | 2839138175 | 2839140766 | 412 |
| 30 | iso_pu_bacteria | 2599185292 | 2599902175 | 413 |
| 31 | iso_pu_bacteria | 2643221569 | 2643859566 | 413 |
| 32 | iso_pu_bacteria | 2643221594 | 2643978865 | 413 |
| 33 | iso_pu_bacteria | 2643221621 | 2644120302 | 413 |
| 34 | iso_pu_bacteria | 2808606395 | 2809036378 | 413 |
| 35 | iso_pu_bacteria | 2857576091 | 2857578158 | 413 |
| 36 | iso_pu_bacteria | 2858950400 | 2858952850 | 413 |
| 37 | iso_pu_bacteria | 2885192300 | 2885194129 | 413 |
| 38 | iso_pu_bacteria | 2893066018 | 2893067079 | 413 |
| 39 | iso_pu_bacteria | 2941479691 | 2941483276 | 413 |
| 40 | iso_pu_bacteria | 2945972063 | 2945976812 | 414 |
| 41 | 3300005367 | Ga0070667_100102125 | Ga0070667_1001021253 | 415 |
| 42 | 3300005535 | Ga0070684_100104230 | Ga0070684_1001042301 | 415 |
| 43 | 3300005841 | Ga0068863_100031060 | Ga0068863_1000310602 | 415 |
| 44 | 3300005842 | Ga0068858_100036864 | Ga0068858_1000368642 | 415 |
| 45 | 3300009174 | Ga0105241_10134674 | Ga0105241_101346742 | 415 |
| 46 | 3300009545 | Ga0105237_10043574 | Ga0105237_100435743 | 415 |
| 47 | 3300009553 | Ga0105249_10025620 | Ga0105249_100256203 | 415 |
| 48 | 3300010375 | Ga0105239_10032303 | Ga0105239_100323035 | 415 |
| 49 | 3300014325 | Ga0163163_10000004 | Ga0163163_10000004402 | 415 |
| 50 | 3300014968 | Ga0157379_10000869 | Ga0157379_1000086914 | 415 |
| 51 | 3300014969 | Ga0157376_10327667 | Ga0157376_103276672 | 415 |
| 52 | 3300025913 | Ga0207695_10259869 | Ga0207695_102598692 | 415 |
| 53 | 3300025914 | Ga0207671_10031150 | Ga0207671_100311504 | 415 |
| 54 | 3300025961 | Ga0207712_10013433 | Ga0207712_100134333 | 415 |
| 55 | 3300025986 | Ga0207658_10027164 | Ga0207658_100271642 | 415 |
| 56 | 3300026035 | Ga0207703_10017168 | Ga0207703_100171684 | 415 |
| 57 | 3300026088 | Ga0207641_10038880 | Ga0207641_100388804 | 415 |
| 58 | 3300026118 | Ga0207675_100147559 | Ga0207675_1001475591 | 415 |
| 59 | 3300031241 | Ga0265325_10001308 | Ga0265325_100013085 | 415 |
| 60 | 3300031249 | Ga0265339_10017769 | Ga0265339_100177692 | 415 |
| 61 | 3300031595 | Ga0265313_10008008 | Ga0265313_100080082 | 415 |
| 62 | 3300046538 | Ga0495609_0018203 | Ga0495609_0018203_391_1644 | 415 |
| 63 | 3300049581 | Ga0501047_0110044 | Ga0501047_0110044_897_2147 | 415 |
| 64 | 3300053119 | Ga0500595_001027 | Ga0500595_001027_5703_6953 | 415 |
| 65 | iso_pu_bacteria | 2508501009 | 2508540806 | 415 |
| 66 | iso_pu_bacteria | 2643221628 | 2644163041 | 415 |
| 67 | iso_pu_bacteria | 2844315083 | 2844320866 | 415 |
| 68 | iso_pu_bacteria | 2876761206 | 2876762034 | 415 |
| 69 | iso_pu_bacteria | 2888388044 | 2888392038 | 415 |
| 70 | iso_pu_bacteria | 2894772417 | 2894772622 | 415 |
| 71 | iso_pu_bacteria | 2903727486 | 2903728063 | 415 |
| 72 | iso_pu_bacteria | 2906602504 | 2906608149 | 415 |
| 73 | iso_pu_bacteria | 3005718088 | 3005723907 | 415 |
| 74 | iso_pu_bacteria | 8006926726 | 8006929371 | 415 |
| 75 | iso_pu_bacteria | 8056967851 | 8056969155 | 415 |
| 76 | 3300005548 | Ga0070665_100055299 | Ga0070665_1000552993 | 416 |
| 77 | 3300006048 | Ga0075363_100005901 | Ga0075363_1000059013 | 416 |
| 78 | 3300006177 | Ga0075362_10013877 | Ga0075362_100138773 | 416 |
| 79 | 3300006195 | Ga0075366_10049179 | Ga0075366_100491791 | 416 |
| 80 | 3300006946 | Ga0079104_1000004 | Ga0079104_1000004340 | 416 |
| 81 | 3300009148 | Ga0105243_10000352 | Ga0105243_1000035242 | 416 |
| 82 | 3300009148 | Ga0105243_10000498 | Ga0105243_1000049835 | 416 |
| 83 | 3300013297 | Ga0157378_10009858 | Ga0157378_100098583 | 416 |
| 84 | 3300013306 | Ga0163162_10143458 | Ga0163162_101434583 | 416 |
| 85 | 3300014497 | Ga0182008_10000041 | Ga0182008_1000004158 | 416 |
| 86 | 3300025935 | Ga0207709_10000138 | Ga0207709_1000013859 | 416 |
| 87 | 3300025935 | Ga0207709_10001062 | Ga0207709_100010623 | 416 |
| 88 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005546 | 416 |
| 89 | 3300028379 | Ga0268266_10016344 | Ga0268266_100163445 | 416 |
| 90 | 3300039447 | Ga0436361_0836000 | Ga0436361_0836000_903_2213 | 416 |
| 91 | 3300044694 | Ga0466963_0009517 | Ga0466963_0009517_3994_5250 | 416 |
| 92 | 3300044719 | Ga0466971_0027655 | Ga0466971_0027655_464_1720 | 416 |
| 93 | 3300048927 | Ga0496124_0000151 | Ga0496124_0000151_13839_15143 | 416 |
| 94 | 3300048928 | Ga0496125_0008396 | Ga0496125_0008396_454_1758 | 416 |
| 95 | 3300053730 | Ga0500645_000242 | Ga0500645_000242_34533_35828 | 416 |
| 96 | 3300005327 | Ga0070658_10098232 | Ga0070658_100982322 | 417 |
| 97 | 3300005356 | Ga0070674_100011296 | Ga0070674_1000112965 | 417 |
| 98 | 3300005455 | Ga0070663_100002382 | Ga0070663_10000238211 | 417 |
| 99 | 3300005616 | Ga0068852_100026332 | Ga0068852_1000263323 | 417 |
| 100 | 3300005618 | Ga0068864_100002249 | Ga0068864_1000022493 | 417 |
| 101 | 3300005618 | Ga0068864_100028302 | Ga0068864_1000283023 | 417 |
| 102 | 3300005719 | Ga0068861_100018717 | Ga0068861_1000187174 | 417 |
| 103 | 3300005844 | Ga0068862_100015054 | Ga0068862_1000150543 | 417 |
| 104 | 3300005981 | Ga0081538_10012767 | Ga0081538_100127672 | 417 |
| 105 | 3300005983 | Ga0081540_1038232 | Ga0081540_10382322 | 417 |
| 106 | 3300006881 | Ga0068865_100053630 | Ga0068865_1000536302 | 417 |
| 107 | 3300009098 | Ga0105245_10025391 | Ga0105245_100253912 | 417 |
| 108 | 3300009147 | Ga0114129_10463422 | Ga0114129_104634221 | 417 |
| 109 | 3300010375 | Ga0105239_10082261 | Ga0105239_100822612 | 417 |
| 110 | 3300011119 | Ga0105246_10003208 | Ga0105246_100032088 | 417 |
| 111 | 3300013296 | Ga0157374_10131777 | Ga0157374_101317772 | 417 |
| 112 | 3300013297 | Ga0157378_10068033 | Ga0157378_100680332 | 417 |
| 113 | 3300013306 | Ga0163162_10011613 | Ga0163162_100116136 | 417 |
| 114 | 3300014325 | Ga0163163_10008087 | Ga0163163_100080879 | 417 |
| 115 | 3300014325 | Ga0163163_10044219 | Ga0163163_100442193 | 417 |
| 116 | 3300014968 | Ga0157379_10086638 | Ga0157379_100866382 | 417 |
| 117 | 3300014969 | Ga0157376_10009387 | Ga0157376_100093874 | 417 |
| 118 | 3300025250 | Ga0209026_1004077 | Ga0209026_10040775 | 417 |
| 119 | 3300025298 | Ga0209050_1001709 | Ga0209050_100170920 | 417 |
| 120 | 3300025901 | Ga0207688_10030589 | Ga0207688_100305893 | 417 |
| 121 | 3300025919 | Ga0207657_10005104 | Ga0207657_100051042 | 417 |
| 122 | 3300025923 | Ga0207681_10028695 | Ga0207681_100286952 | 417 |
| 123 | 3300025925 | Ga0207650_10006350 | Ga0207650_100063505 | 417 |
| 124 | 3300025927 | Ga0207687_10085124 | Ga0207687_100851242 | 417 |
| 125 | 3300025931 | Ga0207644_10089535 | Ga0207644_100895352 | 417 |
| 126 | 3300025938 | Ga0207704_10022454 | Ga0207704_100224542 | 417 |
| 127 | 3300025944 | Ga0207661_10061424 | Ga0207661_100614242 | 417 |
| 128 | 3300026041 | Ga0207639_10115417 | Ga0207639_101154172 | 417 |
| 129 | 3300026067 | Ga0207678_10006898 | Ga0207678_1000689810 | 417 |
| 130 | 3300026095 | Ga0207676_10001668 | Ga0207676_1000166811 | 417 |
| 131 | 3300026095 | Ga0207676_10083086 | Ga0207676_100830862 | 417 |
| 132 | 3300026118 | Ga0207675_100011421 | Ga0207675_1000114213 | 417 |
| 133 | 3300026121 | Ga0207683_10006993 | Ga0207683_100069938 | 417 |
| 134 | 3300031456 | Ga0307513_10217570 | Ga0307513_102175702 | 417 |
| 135 | 3300035410 | Ga0373924_0006808 | Ga0373924_0006808_2690_3943 | 417 |
| 136 | 3300041413 | Ga0439465_0000947 | Ga0439465_0000947_3182_4435 | 417 |
| 137 | 3300041997 | Ga0439431_0000923 | Ga0439431_0000923_321_1574 | 417 |
| 138 | 3300042004 | Ga0439445_0001289 | Ga0439445_0001289_1032_2285 | 417 |
| 139 | 3300042010 | Ga0439452_001510 | Ga0439452_001510_4678_5931 | 417 |
| 140 | 3300042014 | Ga0439457_002420 | Ga0439457_002420_1013_2266 | 417 |
| 141 | 3300042435 | Ga0439434_0000778 | Ga0439434_0000778_2875_4128 | 417 |
| 142 | 3300047472 | Ga0495686_0072092 | Ga0495686_0072092_82_1335 | 417 |
| 143 | 3300048903 | Ga0496100_0017983 | Ga0496100_0017983_401_1654 | 417 |
| 144 | 3300048905 | Ga0496102_0004248 | Ga0496102_0004248_4497_5750 | 417 |
| 145 | 3300048906 | Ga0496103_0011511 | Ga0496103_0011511_2648_3901 | 417 |
| 146 | 3300048908 | Ga0496105_0042714 | Ga0496105_0042714_1566_2819 | 417 |
| 147 | 3300048910 | Ga0496107_0012004 | Ga0496107_0012004_2455_3708 | 417 |
| 148 | 3300048913 | Ga0496110_0109276 | Ga0496110_0109276_949_2202 | 417 |
| 149 | 3300048915 | Ga0496112_0061183 | Ga0496112_0061183_1415_2668 | 417 |
| 150 | 3300048915 | Ga0496112_0106347 | Ga0496112_0106347_1074_2327 | 417 |
| 151 | 3300048916 | Ga0496113_0005038 | Ga0496113_0005038_5624_6877 | 417 |
| 152 | 3300048918 | Ga0496115_0002660 | Ga0496115_0002660_9817_11070 | 417 |
| 153 | 3300048919 | Ga0496116_0002434 | Ga0496116_0002434_8647_9948 | 417 |
| 154 | 3300048919 | Ga0496116_0026550 | Ga0496116_0026550_217_1518 | 417 |
| 155 | 3300048920 | Ga0496117_0008553 | Ga0496117_0008553_7949_9250 | 417 |
| 156 | 3300048921 | Ga0496118_0004807 | Ga0496118_0004807_2960_4261 | 417 |
| 157 | 3300048922 | Ga0496119_0013864 | Ga0496119_0013864_1605_2906 | 417 |
| 158 | 3300048922 | Ga0496119_0053132 | Ga0496119_0053132_558_1859 | 417 |
| 159 | 3300048923 | Ga0496120_0010587 | Ga0496120_0010587_4619_5920 | 417 |
| 160 | 3300048924 | Ga0496121_0001225 | Ga0496121_0001225_2861_4162 | 417 |
| 161 | 3300048925 | Ga0496122_0000021 | Ga0496122_0000021_238475_239776 | 417 |
| 162 | 3300048926 | Ga0496123_0001826 | Ga0496123_0001826_8834_10135 | 417 |
| 163 | 3300048928 | Ga0496125_0000005 | Ga0496125_0000005_269427_270728 | 417 |
| 164 | 3300048928 | Ga0496125_0022617 | Ga0496125_0022617_4091_5392 | 417 |
| 165 | 3300048928 | Ga0496125_0024631 | Ga0496125_0024631_2898_4199 | 417 |
| 166 | 3300048929 | Ga0496126_0018541 | Ga0496126_0018541_1300_2601 | 417 |
| 167 | 3300048929 | Ga0496126_0081056 | Ga0496126_0081056_940_2241 | 417 |
| 168 | 3300049570 | Ga0501033_0046303 | Ga0501033_0046303_171_1424 | 417 |
| 169 | 3300049574 | Ga0501038_0122400 | Ga0501038_0122400_408_1661 | 417 |
| 170 | 3300049575 | Ga0501039_0054859 | Ga0501039_0054859_874_2127 | 417 |
| 171 | 3300049579 | Ga0501043_0015482 | Ga0501043_0015482_1333_2586 | 417 |
| 172 | 3300049581 | Ga0501047_0027810 | Ga0501047_0027810_2450_3703 | 417 |
| 173 | 3300049823 | Ga0501044_0032007 | Ga0501044_0032007_2251_3504 | 417 |
| 174 | 3300003784 | Ga0055534_1000024 | Ga0055534_100002412 | 418 |
| 175 | 3300003790 | Ga0055528_1001328 | Ga0055528_10013283 | 418 |
| 176 | 3300005340 | Ga0070689_100042599 | Ga0070689_1000425993 | 418 |
| 177 | 3300005353 | Ga0070669_100036308 | Ga0070669_1000363083 | 418 |
| 178 | 3300005354 | Ga0070675_100281898 | Ga0070675_1002818981 | 418 |
| 179 | 3300005356 | Ga0070674_100021312 | Ga0070674_1000213123 | 418 |
| 180 | 3300005365 | Ga0070688_100041939 | Ga0070688_1000419392 | 418 |
| 181 | 3300005441 | Ga0070700_100027125 | Ga0070700_1000271252 | 418 |
| 182 | 3300005466 | Ga0070685_10004919 | Ga0070685_100049193 | 418 |
| 183 | 3300005617 | Ga0068859_100017655 | Ga0068859_1000176555 | 418 |
| 184 | 3300005840 | Ga0068870_10026253 | Ga0068870_100262533 | 418 |
| 185 | 3300005841 | Ga0068863_100052885 | Ga0068863_1000528851 | 418 |
| 186 | 3300005844 | Ga0068862_100094388 | Ga0068862_1000943882 | 418 |
| 187 | 3300006358 | Ga0068871_100005799 | Ga0068871_1000057993 | 418 |
| 188 | 3300006931 | Ga0097620_100017655 | Ga0097620_1000176553 | 418 |
| 189 | 3300006948 | Ga0099826_10000068 | Ga0099826_1000006810 | 418 |
| 190 | 3300025263 | Ga0209565_1000040 | Ga0209565_1000040129 | 418 |
| 191 | 3300025273 | Ga0209673_1000109 | Ga0209673_100010934 | 418 |
| 192 | 3300025291 | Ga0209675_1000024 | Ga0209675_1000024139 | 418 |
| 193 | 3300025294 | Ga0209025_1005140 | Ga0209025_10051407 | 418 |
| 194 | 3300025908 | Ga0207643_10005416 | Ga0207643_100054163 | 418 |
| 195 | 3300025942 | Ga0207689_10001070 | Ga0207689_1000107018 | 418 |
| 196 | 3300025961 | Ga0207712_10072679 | Ga0207712_100726793 | 418 |
| 197 | 3300026075 | Ga0207708_10046002 | Ga0207708_100460022 | 418 |
| 198 | 3300026089 | Ga0207648_10035700 | Ga0207648_100357001 | 418 |
| 199 | 3300026095 | Ga0207676_10072296 | Ga0207676_100722962 | 418 |
| 200 | 3300026121 | Ga0207683_10009454 | Ga0207683_100094543 | 418 |
| 201 | 3300027666 | Ga0209282_1007281 | Ga0209282_10072816 | 418 |
| 202 | 3300039447 | Ga0436361_0040547 | Ga0436361_0040547_653_1924 | 418 |
| 203 | 3300050496 | nmdc:mga07m45_1840_c1 | nmdc:mga07m45_1840_c1_5404_6660 | 418 |
| 204 | 3300003203 | JGI25406J46586_10000190 | JGI25406J46586_100001907 | 419 |
| 205 | 3300005435 | Ga0070714_100075787 | Ga0070714_1000757872 | 419 |
| 206 | 3300005455 | Ga0070663_100120717 | Ga0070663_1001207173 | 419 |
| 207 | 3300005616 | Ga0068852_100030354 | Ga0068852_1000303544 | 419 |
| 208 | 3300005985 | Ga0081539_10000072 | Ga0081539_10000072141 | 419 |
| 209 | 3300006051 | Ga0075364_10006244 | Ga0075364_100062442 | 419 |
| 210 | 3300006058 | Ga0075432_10001625 | Ga0075432_100016252 | 419 |
| 211 | 3300009098 | Ga0105245_10010351 | Ga0105245_100103512 | 419 |
| 212 | 3300009545 | Ga0105237_10000828 | Ga0105237_1000082840 | 419 |
| 213 | 3300025254 | Ga0209148_1000306 | Ga0209148_100030621 | 419 |
| 214 | 3300025261 | Ga0209233_1013596 | Ga0209233_10135962 | 419 |
| 215 | 3300025272 | Ga0209455_1003017 | Ga0209455_10030173 | 419 |
| 216 | 3300025911 | Ga0207654_10062702 | Ga0207654_100627021 | 419 |
| 217 | 3300025913 | Ga0207695_10000136 | Ga0207695_10000136162 | 419 |
| 218 | 3300025914 | Ga0207671_10006469 | Ga0207671_100064698 | 419 |
| 219 | 3300025927 | Ga0207687_10167670 | Ga0207687_101676702 | 419 |
| 220 | 3300025929 | Ga0207664_10051079 | Ga0207664_100510794 | 419 |
| 221 | 3300026067 | Ga0207678_10151845 | Ga0207678_101518451 | 419 |
| 222 | 3300026142 | Ga0207698_10067910 | Ga0207698_100679102 | 419 |
| 223 | 3300027907 | Ga0207428_10050853 | Ga0207428_100508532 | 419 |
| 224 | 3300037312 | Ga0395899_0000586 | Ga0395899_0000586_33815_35110 | 419 |
| 225 | 3300037312 | Ga0395899_0001645 | Ga0395899_0001645_16327_17622 | 419 |
| 226 | 3300037312 | Ga0395899_0002844 | Ga0395899_0002844_8278_9573 | 419 |
| 227 | 3300037418 | Ga0395900_0031592 | Ga0395900_0031592_82_1377 | 419 |
| 228 | 3300037418 | Ga0395900_0157840 | Ga0395900_0157840_872_2131 | 419 |
| 229 | 3300037466 | Ga0395898_0128299 | Ga0395898_0128299_559_1854 | 419 |
| 230 | 3300037471 | Ga0395905_0000256 | Ga0395905_0000256_301_1596 | 419 |
| 231 | 3300037471 | Ga0395905_0020129 | Ga0395905_0020129_2564_3859 | 419 |
| 232 | 3300044658 | Ga0466972_0000360 | Ga0466972_0000360_10306_11601 | 419 |
| 233 | 3300044684 | Ga0466966_0008582 | Ga0466966_0008582_5014_6309 | 419 |
| 234 | 3300045049 | Ga0466959_0014835 | Ga0466959_0014835_1136_2431 | 419 |
| 235 | 3300045049 | Ga0466959_0037646 | Ga0466959_0037646_1507_2802 | 419 |
| 236 | 3300045049 | Ga0466959_0108262 | Ga0466959_0108262_183_1448 | 419 |
| 237 | 3300045051 | Ga0451576_0191743 | Ga0451576_0191743_838_2097 | 419 |
| 238 | 3300046491 | Ga0495584_0000167 | Ga0495584_0000167_36863_38164 | 419 |
| 239 | 3300046492 | Ga0495585_0000125 | Ga0495585_0000125_67923_69224 | 419 |
| 240 | 3300046492 | Ga0495585_0002757 | Ga0495585_0002757_3834_5135 | 419 |
| 241 | 3300046492 | Ga0495585_0003275 | Ga0495585_0003275_2615_3916 | 419 |
| 242 | 3300046499 | Ga0495594_0092619 | Ga0495594_0092619_354_1655 | 419 |
| 243 | 3300046500 | Ga0495596_0006074 | Ga0495596_0006074_15_1316 | 419 |
| 244 | 3300046506 | Ga0495583_0000065 | Ga0495583_0000065_29360_30661 | 419 |
| 245 | 3300046513 | Ga0495616_0000631 | Ga0495616_0000631_5896_7197 | 419 |
| 246 | 3300046513 | Ga0495616_0010663 | Ga0495616_0010663_125_1426 | 419 |
| 247 | 3300046517 | Ga0495630_0101146 | Ga0495630_0101146_94_1395 | 419 |
| 248 | 3300046524 | Ga0495648_0000053 | Ga0495648_0000053_151170_152471 | 419 |
| 249 | 3300046526 | Ga0495666_0006950 | Ga0495666_0006950_90_1391 | 419 |
| 250 | 3300046530 | Ga0495654_0019488 | Ga0495654_0019488_2156_3457 | 419 |
| 251 | 3300046535 | Ga0495586_0030938 | Ga0495586_0030938_890_2191 | 419 |
| 252 | 3300046536 | Ga0495587_0045098 | Ga0495587_0045098_784_2085 | 419 |
| 253 | 3300046557 | Ga0495622_0017459 | Ga0495622_0017459_1479_2780 | 419 |
| 254 | 3300046616 | Ga0495668_0003462 | Ga0495668_0003462_5058_6359 | 419 |
| 255 | 3300046660 | Ga0495625_0000299 | Ga0495625_0000299_60302_61561 | 419 |
| 256 | 3300046660 | Ga0495625_0007499 | Ga0495625_0007499_93_1394 | 419 |
| 257 | 3300046691 | Ga0495670_0002225 | Ga0495670_0002225_7788_9089 | 419 |
| 258 | 3300046809 | Ga0495600_0078076 | Ga0495600_0078076_208_1509 | 419 |
| 259 | 3300047323 | Ga0495683_0000614 | Ga0495683_0000614_17388_18689 | 419 |
| 260 | 3300048091 | Ga0495626_0037804 | Ga0495626_0037804_121_1422 | 419 |
| 261 | 3300048927 | Ga0496124_0007006 | Ga0496124_0007006_409_1704 | 419 |
| 262 | 3300049823 | Ga0501044_0026838 | Ga0501044_0026838_1605_2864 | 419 |
| 263 | 3300050489 | nmdc:mga03683_1876_c1 | nmdc:mga03683_1876_c1_2449_3708 | 419 |
| 264 | 3300050491 | nmdc:mga00v17_11139_c1 | nmdc:mga00v17_11139_c1_1773_3032 | 419 |
| 265 | 3300050492 | nmdc:mga0yw44_927_c1 | nmdc:mga0yw44_927_c1_7477_8736 | 419 |
| 266 | 3300050493 | nmdc:mga0k408_3780_c1 | nmdc:mga0k408_3780_c1_5373_6632 | 419 |
| 267 | 3300053177 | Ga0500636_0048641 | Ga0500636_0048641_203_1462 | 419 |
| 268 | 3300059477 | Ga0587084_005755 | Ga0587084_005755_109_1404 | 419 |
| 269 | 3300059478 | Ga0587093_001581 | Ga0587093_001581_118_1413 | 419 |
| 270 | 3300059478 | Ga0587093_002907 | Ga0587093_002907_118_1413 | 419 |
| 271 | 3300059490 | Ga0587066_002880 | Ga0587066_002880_546_1841 | 419 |
| 272 | 3300059491 | Ga0587070_001609 | Ga0587070_001609_117_1412 | 419 |
| 273 | 3300059491 | Ga0587070_007964 | Ga0587070_007964_118_1413 | 419 |
| 274 | 3300059493 | Ga0587077_002017 | Ga0587077_002017_114_1409 | 419 |
| 275 | 3300059493 | Ga0587077_002193 | Ga0587077_002193_118_1413 | 419 |
| 276 | 3300059505 | Ga0587083_0010725 | Ga0587083_0010725_77_1372 | 419 |
| 277 | 3300059506 | Ga0587085_003473 | Ga0587085_003473_307_1602 | 419 |
| 278 | 3300059508 | Ga0587088_006971 | Ga0587088_006971_138_1433 | 419 |
| 279 | 3300059510 | Ga0587090_002092 | Ga0587090_002092_737_2032 | 419 |
| 280 | 3300059510 | Ga0587090_006182 | Ga0587090_006182_113_1408 | 419 |
| 281 | 3300059511 | Ga0587091_002195 | Ga0587091_002195_118_1413 | 419 |
| 282 | 3300059512 | Ga0587092_005761 | Ga0587092_005761_118_1413 | 419 |
| 283 | 3300059512 | Ga0587092_006374 | Ga0587092_006374_120_1415 | 419 |
| 284 | 3300059513 | Ga0587094_001434 | Ga0587094_001434_117_1412 | 419 |
| 285 | 3300059623 | Ga0587101_000835 | Ga0587101_000835_857_2152 | 419 |
| 286 | 3300059623 | Ga0587101_001123 | Ga0587101_001123_317_1612 | 419 |
| 287 | 3300059639 | Ga0587062_001202 | Ga0587062_001202_118_1413 | 419 |
| 288 | 3300059639 | Ga0587062_004048 | Ga0587062_004048_117_1412 | 419 |
| 289 | 3300059641 | Ga0587068_005948 | Ga0587068_005948_117_1412 | 419 |
| 290 | 3300059641 | Ga0587068_006732 | Ga0587068_006732_74_1411 | 419 |
| 291 | 3300059642 | Ga0587069_002133 | Ga0587069_002133_549_1844 | 419 |
| 292 | 3300059643 | Ga0587072_009639 | Ga0587072_009639_115_1410 | 419 |
| 293 | 3300059644 | Ga0587075_005221 | Ga0587075_005221_118_1413 | 419 |
| 294 | 3300059645 | Ga0587076_000697 | Ga0587076_000697_1292_2629 | 419 |
| 295 | 3300059645 | Ga0587076_001856 | Ga0587076_001856_845_2140 | 419 |
| 296 | 3300059646 | Ga0587078_000975 | Ga0587078_000975_67_1404 | 419 |
| 297 | 3300059646 | Ga0587078_001062 | Ga0587078_001062_925_2220 | 419 |
| 298 | 3300059649 | Ga0587102_000732 | Ga0587102_000732_118_1413 | 419 |
| 299 | 3300060344 | Ga0587071_002133 | Ga0587071_002133_118_1413 | 419 |
| 300 | 3300060346 | Ga0587111_0001593 | Ga0587111_0001593_118_1413 | 419 |
| 301 | 3300060346 | Ga0587111_0005298 | Ga0587111_0005298_151_1446 | 419 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j0e-assembly1.cif.gz_A | crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group | 0.9905 | 2 | 32 |
| 5a9r-assembly1.cif.gz_A | apo form of imine reductase from amycolatopsis orientalis | 0.9815 | 2 | 32 |
| 7o1k-assembly1.cif.gz_A | structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a, beta-c92a mutant | 0.9801 | 2 | 32 |
| 7bkd-assembly1.cif.gz_a | formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) | 0.9788 | 2 | 36 |
| 4b3j-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex with coenzymea bound at the hydratase and thiolase active sites | 0.9783 | 2 | 32 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1C9_1_191_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 1 | 2 | 30 | 3.40.50.720 |
| af_A0A1D6LYX0_29_117_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9834 | 2 | 35 | 3.50.50.60 |
| af_Q5U1B0_1_189_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.979 | 1 | 30 | 3.40.50.720 |
| af_A0A1D6EF23_1_151_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9778 | 2 | 36 | 3.50.50.60 |
| af_C0VXV5_2_190_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9777 | 2 | 32 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J6Z2W5-F1-model_v4 | deleted | 0.9844 | 84 | 411 |
|
| AF-A0A379B283-F1-model_v4 | D-amino acid dehydrogenase small subunit (EC 1.4.3.19, EC 1.4.99.6) | 0.9825 | 163 | 417 |
GO:0005737
GO:0005886 GO:0008718 GO:0043799 GO:0055130 |
| AF-J0VQE7-F1-model_v4 | deleted | 0.9757 | 1 | 416 |
|
| AF-A0A8B3G9I7-F1-model_v4 | deleted | 0.9737 | 240 | 416 |
|
| AF-J0VQE7-F1-model_v4 | deleted | 0.9708 | 1 | 416 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar