F396209

General Info

Members Datasets Scaffolds Average Seq Length
301 230 277 421

Family's Representative Sequence

Representative Sequence 3300059641|Ga0587068_006732|Ga0587068_006732_74_1411
Length 445
Sequence MLAAVAPKRGEGTSVKIIVLGSGVIGTTSAYYLAKAGHEVTVIDRQPAAGLETSYANAGEVSPGYSAPWAAPGIPVKAMKWLLMRHSPLAIRPSLDPAMWRWVFEMLMNCTSARYETNKGRMVRLAEYSRDCLAQLRADTGISYDERTQGTMQLFRTQKQLDASAADIAVLERYGVPYEVLDEDGCIKVEPALAQVRGKFVGALRLPGDETGDCFKFTQQLATMAEKAGVKFKYGVSIQRLATDGRKITGIVTSEGQLKADSYVLALGSYSPLLLRDLGIRIPVYPIKGYSITIPIYDEKSAPESTIMDETYKVAITRLGDRIRVGGTAEIAGYDLTLRNARRETLEYSVVDLFPRGGDVSQAEFWTGLRPMTPDGTPVVGPTTYSNLFLNTGHGTLGWTMACGSGRLLSDLVSGKRPEIDTEGLFMDRYGKTSRPLAAPQEARA

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2643221569 Achromobacter sp. Root565 Isolate Unclassified
4 2643221594 Achromobacter sp. Root170 Isolate Unclassified
5 2643221621 Achromobacter sp. Root83 Isolate Unclassified
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2721755523 Delftia sp. HK171 Isolate Unclassified
8 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
9 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
10 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
11 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
12 2858950400 Achromobacter sp. K91 Isolate Unclassified
13 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
14 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
15 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
16 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
17 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
18 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
19 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
20 2941479691
21 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
22 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
230 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.4
Metatranscriptomes 11.63
Isolates 7.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.64
Nodule 2.66
Rhizoplane 4.65
Rhizosphere 71.76
Stem 0
Stem Tuber 0
Unclassified 12.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000190 3300003203 Bacteria 27399
2 Ga0055534_1000024 3300003784 Bacteria 131674
3 Ga0055528_1001328 3300003790 Bacteria 15400
4 Ga0070658_10098232 3300005327 Bacteria 2418
5 Ga0070660_100001231 3300005339 Bacteria 17385
6 Ga0070689_100042599 3300005340 Bacteria 3486
7 Ga0070669_100036308 3300005353 Bacteria 3570
8 Ga0070675_100281898 3300005354 Bacteria 1460
9 Ga0070674_100011296 3300005356 Bacteria 5433
10 Ga0070674_100021312 3300005356 Bacteria 4156
11 Ga0070688_100041939 3300005365 Bacteria 2812
12 Ga0070659_100000825 3300005366 Bacteria 22592
13 Ga0070667_100102125 3300005367 Bacteria 2477
14 Ga0070714_100075787 3300005435 Bacteria 2919
15 Ga0070700_100027125 3300005441 Bacteria 3393
16 Ga0070663_100002382 3300005455 Bacteria 10569
17 Ga0070663_100120717 3300005455 Bacteria 1979
18 Ga0070685_10004919 3300005466 Bacteria 6758
19 Ga0070684_100104230 3300005535 Bacteria 2537
20 Ga0070665_100055299 3300005548 Bacteria 3981
21 Ga0070664_100013271 3300005564 Bacteria 6710
22 Ga0068852_100026332 3300005616 Bacteria 4726
23 Ga0068852_100030354 3300005616 Bacteria 4448
24 Ga0068859_100017655 3300005617 Bacteria 7173
25 Ga0068864_100002249 3300005618 Bacteria 15963
26 Ga0068864_100028302 3300005618 Bacteria 4736
27 Ga0068861_100018717 3300005719 Bacteria 4936
28 Ga0068870_10026253 3300005840 Bacteria 2902
29 Ga0068863_100031060 3300005841 Bacteria 5100
30 Ga0068863_100052885 3300005841 Bacteria 3848
31 Ga0068858_100036864 3300005842 Bacteria 4534
32 Ga0068862_100015054 3300005844 Bacteria 6424
33 Ga0068862_100094388 3300005844 Bacteria 2609
34 Ga0081538_10012767 3300005981 Bacteria 6708
35 Ga0081540_1038232 3300005983 Bacteria 2532
36 Ga0081539_10000072 3300005985 Bacteria 232726
37 Ga0075363_100005901 3300006048 Bacteria 5514
38 Ga0075364_10006244 3300006051 Bacteria 6986
39 Ga0075432_10001625 3300006058 Bacteria 7389
40 Ga0075362_10013877 3300006177 Bacteria 3237
41 Ga0075366_10049179 3300006195 Bacteria 2502
42 Ga0068871_100005799 3300006358 Bacteria 8678
43 Ga0068865_100053630 3300006881 Bacteria 2798
44 Ga0097620_100017655 3300006931 Bacteria 7173
45 Ga0079104_1000004 3300006946 Bacteria 444549
46 Ga0099826_10000068 3300006948 Bacteria 55540
47 Ga0105245_10010351 3300009098 Bacteria 8124
48 Ga0105245_10025391 3300009098 Bacteria 5211
49 Ga0114129_10463422 3300009147 Bacteria 1660
50 Ga0105243_10000352 3300009148 Bacteria 49052
51 Ga0105243_10000498 3300009148 Bacteria 40115
52 Ga0105241_10134674 3300009174 Bacteria 2004
53 Ga0105237_10000828 3300009545 Bacteria 42351
54 Ga0105237_10043574 3300009545 Bacteria 4520
55 Ga0105249_10025620 3300009553 Bacteria 5312
56 Ga0105239_10032303 3300010375 Bacteria 5752
57 Ga0105239_10082261 3300010375 Bacteria 3545
58 Ga0105246_10003208 3300011119 Bacteria 9930
59 Ga0157374_10131777 3300013296 Bacteria 2420
60 Ga0157378_10009858 3300013297 Bacteria 8325
61 Ga0157378_10068033 3300013297 Bacteria 3193
62 Ga0163162_10011613 3300013306 Bacteria 8587
63 Ga0163162_10143458 3300013306 Bacteria 2502
64 Ga0163163_10000004 3300014325 Bacteria 416569
65 Ga0163163_10008087 3300014325 Bacteria 9318
66 Ga0163163_10044219 3300014325 Bacteria 4368
67 Ga0182008_10000041 3300014497 Bacteria 118254
68 Ga0157379_10000869 3300014968 Bacteria 24442
69 Ga0157379_10086638 3300014968 Bacteria 2808
70 Ga0157376_10009387 3300014969 Bacteria 7106
71 Ga0157376_10327667 3300014969 Bacteria 1458
72 Ga0209026_1004077 3300025250 Bacteria 4509
73 Ga0209148_1000306 3300025254 Bacteria 70293
74 Ga0209233_1013596 3300025261 Bacteria 2321
75 Ga0209565_1000040 3300025263 Bacteria 266543
76 Ga0209455_1003017 3300025272 Bacteria 6173
77 Ga0209673_1000109 3300025273 Bacteria 183000
78 Ga0209675_1000024 3300025291 Bacteria 312615
79 Ga0209025_1005140 3300025294 Bacteria 10854
80 Ga0209050_1001709 3300025298 Bacteria 21920
81 Ga0207688_10030589 3300025901 Bacteria 2970
82 Ga0207643_10005416 3300025908 Bacteria 6825
83 Ga0207654_10062702 3300025911 Bacteria 2179
84 Ga0207695_10000136 3300025913 Bacteria 217596
85 Ga0207695_10259869 3300025913 Bacteria 1634
86 Ga0207671_10006469 3300025914 Bacteria 10428
87 Ga0207671_10031150 3300025914 Bacteria 3976
88 Ga0207657_10002337 3300025919 Bacteria 20558
89 Ga0207657_10005104 3300025919 Bacteria 13756
90 Ga0207681_10028695 3300025923 Bacteria 3607
91 Ga0207650_10006350 3300025925 Bacteria 8052
92 Ga0207687_10085124 3300025927 Bacteria 2293
93 Ga0207687_10167670 3300025927 Bacteria 1691
94 Ga0207664_10051079 3300025929 Bacteria 3263
95 Ga0207644_10089535 3300025931 Bacteria 2291
96 Ga0207709_10000138 3300025935 Bacteria 104006
97 Ga0207709_10001062 3300025935 Bacteria 20280
98 Ga0207704_10022454 3300025938 Bacteria 3381
99 Ga0207689_10001070 3300025942 Bacteria 26388
100 Ga0207661_10061424 3300025944 Bacteria 3036
101 Ga0207712_10013433 3300025961 Bacteria 5249
102 Ga0207712_10072679 3300025961 Bacteria 2478
103 Ga0207658_10027164 3300025986 Bacteria 4020
104 Ga0207703_10017168 3300026035 Bacteria 5646
105 Ga0207639_10115417 3300026041 Bacteria 2196
106 Ga0207678_10006898 3300026067 Bacteria 10076
107 Ga0207678_10151845 3300026067 Bacteria 1978
108 Ga0207708_10046002 3300026075 Bacteria 3325
109 Ga0207641_10038880 3300026088 Bacteria 3978
110 Ga0207648_10035700 3300026089 Bacteria 4380
111 Ga0207676_10001668 3300026095 Bacteria 16361
112 Ga0207676_10072296 3300026095 Bacteria 2772
113 Ga0207676_10083086 3300026095 Bacteria 2607
114 Ga0207675_100011421 3300026118 Bacteria 8309
115 Ga0207675_100147559 3300026118 Bacteria 2237
116 Ga0207683_10006993 3300026121 Bacteria 9675
117 Ga0207683_10009454 3300026121 Bacteria 8306
118 Ga0207698_10067910 3300026142 Bacteria 2813
119 Ga0209281_1000005 3300027111 Bacteria 1242284
120 Ga0209282_1007281 3300027666 Bacteria 6920
121 Ga0207428_10050853 3300027907 Bacteria 3313
122 Ga0268266_10016344 3300028379 Bacteria 6345
123 Ga0265325_10001308 3300031241 Bacteria 17649
124 Ga0265339_10017769 3300031249 Bacteria 4205
125 Ga0307513_10217570 3300031456 Bacteria 1735
126 Ga0265313_10008008 3300031595 Bacteria 7092
127 Ga0373924_0006808 3300035410 Bacteria 4107
128 Ga0395899_0000288 3300037312 Bacteria 64881
129 Ga0395899_0000586 3300037312 Bacteria 38344
130 Ga0395899_0001645 3300037312 Bacteria 18655
131 Ga0395899_0002844 3300037312 Bacteria 13933
132 Ga0395900_0000246 3300037418 Bacteria 85104
133 Ga0395900_0031592 3300037418 Bacteria 5443
134 Ga0395900_0157840 3300037418 Bacteria 2316
135 Ga0395900_0235622 3300037418 Bacteria 1838
136 Ga0395898_0000447 3300037466 Bacteria 85103
137 Ga0395898_0128299 3300037466 Bacteria 2429
138 Ga0395905_0000228 3300037471 Bacteria 85103
139 Ga0395905_0000256 3300037471 Bacteria 79866
140 Ga0395905_0020129 3300037471 Bacteria 6322
141 Ga0395901_0000167 3300038443 Bacteria 85844
142 Ga0395901_0019294 3300038443 Bacteria 6970
143 Ga0436361_0040547 3300039447 Bacteria 7174
144 Ga0436361_0836000 3300039447 Bacteria 3637
145 Ga0439465_0000947 3300041413 Bacteria 9202
146 Ga0439431_0000923 3300041997 Bacteria 6371
147 Ga0439445_0001289 3300042004 Bacteria 5418
148 Ga0439452_001510 3300042010 Bacteria 9407
149 Ga0439457_002420 3300042014 Bacteria 5338
150 Ga0450919_005444 3300042121 Bacteria 1528
151 Ga0439434_0000778 3300042435 Bacteria 9172
152 Ga0466972_0000360 3300044658 Bacteria 24585
153 Ga0466966_0008582 3300044684 Bacteria 6763
154 Ga0466963_0009517 3300044694 Bacteria 5853
155 Ga0466971_0027655 3300044719 Bacteria 2541
156 Ga0466959_0014835 3300045049 Bacteria 5674
157 Ga0466959_0037646 3300045049 Bacteria 3575
158 Ga0466959_0108262 3300045049 Bacteria 1986
159 Ga0451576_0191743 3300045051 Bacteria 2135
160 Ga0495582_0124203 3300046473 Bacteria 1456
161 Ga0495584_0000167 3300046491 Bacteria 46214
162 Ga0495585_0000125 3300046492 Bacteria 83087
163 Ga0495585_0002757 3300046492 Bacteria 12245
164 Ga0495585_0003275 3300046492 Bacteria 11018
165 Ga0495594_0092619 3300046499 Bacteria 1694
166 Ga0495596_0006074 3300046500 Bacteria 5626
167 Ga0495583_0000065 3300046506 Bacteria 192022
168 Ga0495616_0000631 3300046513 Bacteria 26364
169 Ga0495616_0010663 3300046513 Bacteria 5309
170 Ga0495630_0101146 3300046517 Bacteria 2181
171 Ga0495637_0078722 3300046520 Bacteria 1317
172 Ga0495648_0000053 3300046524 Bacteria 159860
173 Ga0495666_0006950 3300046526 Bacteria 5687
174 Ga0495654_0019488 3300046530 Bacteria 3549
175 Ga0495586_0030938 3300046535 Bacteria 2865
176 Ga0495587_0045098 3300046536 Bacteria 2621
177 Ga0495609_0018203 3300046538 Bacteria 3257
178 Ga0495622_0017459 3300046557 Bacteria 3340
179 Ga0495668_0003462 3300046616 Bacteria 11786
180 Ga0495625_0000299 3300046660 Bacteria 76372
181 Ga0495625_0007499 3300046660 Bacteria 9482
182 Ga0495670_0002225 3300046691 Bacteria 9578
183 Ga0495670_0008477 3300046691 Bacteria 5057
184 Ga0495600_0078076 3300046809 Bacteria 2162
185 Ga0495683_0000614 3300047323 Bacteria 26609
186 Ga0495675_0029590 3300047444 Bacteria 3493
187 Ga0495686_0072092 3300047472 Bacteria 2125
188 Ga0495626_0037804 3300048091 Bacteria 2292
189 Ga0496100_0017983 3300048903 Bacteria 4185
190 Ga0496102_0004248 3300048905 Bacteria 12114
191 Ga0496103_0011511 3300048906 Bacteria 5242
192 Ga0496105_0042714 3300048908 Bacteria 3738
193 Ga0496107_0012004 3300048910 Bacteria 6044
194 Ga0496108_0358007 3300048911 Bacteria 1273
195 Ga0496109_0442098 3300048912 Bacteria 1228
196 Ga0496110_0109276 3300048913 Bacteria 2483
197 Ga0496112_0061183 3300048915 Bacteria 3711
198 Ga0496112_0106347 3300048915 Bacteria 2776
199 Ga0496113_0005038 3300048916 Bacteria 8196
200 Ga0496115_0002660 3300048918 Bacteria 12829
201 Ga0496115_0346620 3300048918 Bacteria 1212
202 Ga0496116_0002434 3300048919 Bacteria 19593
203 Ga0496116_0026550 3300048919 Bacteria 4233
204 Ga0496117_0008553 3300048920 Bacteria 9708
205 Ga0496118_0004807 3300048921 Bacteria 15762
206 Ga0496118_0035701 3300048921 Bacteria 4032
207 Ga0496119_0013864 3300048922 Bacteria 6364
208 Ga0496119_0053132 3300048922 Bacteria 2477
209 Ga0496120_0010587 3300048923 Bacteria 6415
210 Ga0496121_0001225 3300048924 Bacteria 44636
211 Ga0496121_0015782 3300048924 Bacteria 7867
212 Ga0496122_0000021 3300048925 Bacteria 391363
213 Ga0496123_0001826 3300048926 Bacteria 27983
214 Ga0496124_0000151 3300048927 Bacteria 142761
215 Ga0496124_0007006 3300048927 Bacteria 12080
216 Ga0496125_0000005 3300048928 Bacteria 827598
217 Ga0496125_0008396 3300048928 Bacteria 10820
218 Ga0496125_0022617 3300048928 Bacteria 5832
219 Ga0496125_0024631 3300048928 Bacteria 5528
220 Ga0496126_0018541 3300048929 Bacteria 6891
221 Ga0496126_0081056 3300048929 Bacteria 2870
222 Ga0495678_022367 3300049459 Bacteria 2765
223 Ga0501033_0046303 3300049570 Bacteria 3234
224 Ga0501038_0122400 3300049574 Bacteria 2144
225 Ga0501039_0054859 3300049575 Bacteria 3086
226 Ga0501043_0015482 3300049579 Bacteria 5974
227 Ga0501047_0027810 3300049581 Bacteria 5449
228 Ga0501047_0110044 3300049581 Bacteria 2638
229 Ga0501044_0026838 3300049823 Bacteria 6096
230 Ga0501044_0032007 3300049823 Bacteria 5529
231 nmdc:mga03683_1876_c1 3300050489 Bacteria 6402
232 nmdc:mga00v17_11139_c1 3300050491 Bacteria 4935
233 nmdc:mga0yw44_927_c1 3300050492 Bacteria 11106
234 nmdc:mga0k408_3780_c1 3300050493 Bacteria 8025
235 nmdc:mga07m45_101496_c1 3300050496 Bacteria 1652
236 nmdc:mga07m45_1840_c1 3300050496 Bacteria 9798
237 Ga0500554_001632 3300053102 Bacteria 4309
238 Ga0500595_001027 3300053119 Bacteria 15641
239 Ga0500608_003662 3300053122 Bacteria 5809
240 Ga0500636_0004081 3300053177 Bacteria 8246
241 Ga0500636_0048641 3300053177 Bacteria 2496
242 Ga0500645_000242 3300053730 Bacteria 40854
243 Ga0587084_005755 3300059477 Bacteria 1481
244 Ga0587093_001581 3300059478 Bacteria 1957
245 Ga0587093_002907 3300059478 Bacteria 1644
246 Ga0587066_002880 3300059490 Bacteria 1956
247 Ga0587070_001609 3300059491 Bacteria 2378
248 Ga0587070_007964 3300059491 Bacteria 1487
249 Ga0587077_002017 3300059493 Bacteria 2325
250 Ga0587077_002193 3300059493 Bacteria 2269
251 Ga0587083_0010725 3300059505 Bacteria 1493
252 Ga0587085_003473 3300059506 Bacteria 1717
253 Ga0587088_006971 3300059508 Bacteria 1545
254 Ga0587090_002092 3300059510 Bacteria 2143
255 Ga0587090_006182 3300059510 Bacteria 1528
256 Ga0587091_002195 3300059511 Bacteria 2281
257 Ga0587092_005761 3300059512 Bacteria 1543
258 Ga0587092_006374 3300059512 Bacteria 1491
259 Ga0587094_001434 3300059513 Bacteria 2252
260 Ga0587101_000835 3300059623 Bacteria 2419
261 Ga0587101_001123 3300059623 Bacteria 2201
262 Ga0587062_001202 3300059639 Bacteria 2157
263 Ga0587062_004048 3300059639 Bacteria 1530
264 Ga0587068_005948 3300059641 Bacteria 1687
265 Ga0587068_006732 3300059641 Bacteria 1618
266 Ga0587069_002133 3300059642 Bacteria 1956
267 Ga0587072_009639 3300059643 Bacteria 1547
268 Ga0587075_005221 3300059644 Bacteria 1546
269 Ga0587076_000697 3300059645 Bacteria 2970
270 Ga0587076_001856 3300059645 Bacteria 2254
271 Ga0587078_000975 3300059646 Bacteria 2400
272 Ga0587078_001062 3300059646 Bacteria 2335
273 Ga0587079_002942 3300059647 Bacteria 2166
274 Ga0587102_000732 3300059649 Bacteria 2020
275 Ga0587071_002133 3300060344 Bacteria 2630
276 Ga0587111_0001593 3300060346 Bacteria 2788
277 Ga0587111_0005298 3300060346 Bacteria 1979

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0008477 Ga0495670_0008477_3945_5042 351
2 3300042121 Ga0450919_005444 Ga0450919_005444_397_1479 360
3 3300046473 Ga0495582_0124203 Ga0495582_0124203_346_1434 360
4 3300046520 Ga0495637_0078722 Ga0495637_0078722_153_1277 360
5 3300048918 Ga0496115_0346620 Ga0496115_0346620_95_1183 360
6 3300050496 nmdc:mga07m45_101496_c1 nmdc:mga07m45_101496_c1_31_1113 360
7 3300048912 Ga0496109_0442098 Ga0496109_0442098_100_1215 371
8 3300005339 Ga0070660_100001231 Ga0070660_10000123111 392
9 3300005366 Ga0070659_100000825 Ga0070659_1000008258 392
10 3300005564 Ga0070664_100013271 Ga0070664_1000132712 392
11 3300025919 Ga0207657_10002337 Ga0207657_100023377 392
12 3300059647 Ga0587079_002942 Ga0587079_002942_199_1413 392
13 3300038443 Ga0395901_0019294 Ga0395901_0019294_17_1225 402
14 3300037312 Ga0395899_0000288 Ga0395899_0000288_19396_20652 404
15 3300037418 Ga0395900_0000246 Ga0395900_0000246_19395_20651 404
16 3300037466 Ga0395898_0000447 Ga0395898_0000447_19394_20650 404
17 3300037471 Ga0395905_0000228 Ga0395905_0000228_64454_65710 404
18 3300038443 Ga0395901_0000167 Ga0395901_0000167_65194_66450 404
19 3300049459 Ga0495678_022367 Ga0495678_022367_476_1771 407
20 3300048924 Ga0496121_0015782 Ga0496121_0015782_5126_6379 408
21 3300053122 Ga0500608_003662 Ga0500608_003662_1867_3120 408
22 3300053177 Ga0500636_0004081 Ga0500636_0004081_4772_6025 408
23 3300047444 Ga0495675_0029590 Ga0495675_0029590_197_1426 409
24 3300048921 Ga0496118_0035701 Ga0496118_0035701_677_1930 409
25 3300053102 Ga0500554_001632 Ga0500554_001632_2910_4163 409
26 3300037418 Ga0395900_0235622 Ga0395900_0235622_559_1827 410
27 3300048911 Ga0496108_0358007 Ga0496108_0358007_22_1260 412
28 iso_pu_bacteria 2721755523 2722884257 412
29 iso_pu_bacteria 2839138175 2839140766 412
30 iso_pu_bacteria 2599185292 2599902175 413
31 iso_pu_bacteria 2643221569 2643859566 413
32 iso_pu_bacteria 2643221594 2643978865 413
33 iso_pu_bacteria 2643221621 2644120302 413
34 iso_pu_bacteria 2808606395 2809036378 413
35 iso_pu_bacteria 2857576091 2857578158 413
36 iso_pu_bacteria 2858950400 2858952850 413
37 iso_pu_bacteria 2885192300 2885194129 413
38 iso_pu_bacteria 2893066018 2893067079 413
39 iso_pu_bacteria 2941479691 2941483276 413
40 iso_pu_bacteria 2945972063 2945976812 414
41 3300005367 Ga0070667_100102125 Ga0070667_1001021253 415
42 3300005535 Ga0070684_100104230 Ga0070684_1001042301 415
43 3300005841 Ga0068863_100031060 Ga0068863_1000310602 415
44 3300005842 Ga0068858_100036864 Ga0068858_1000368642 415
45 3300009174 Ga0105241_10134674 Ga0105241_101346742 415
46 3300009545 Ga0105237_10043574 Ga0105237_100435743 415
47 3300009553 Ga0105249_10025620 Ga0105249_100256203 415
48 3300010375 Ga0105239_10032303 Ga0105239_100323035 415
49 3300014325 Ga0163163_10000004 Ga0163163_10000004402 415
50 3300014968 Ga0157379_10000869 Ga0157379_1000086914 415
51 3300014969 Ga0157376_10327667 Ga0157376_103276672 415
52 3300025913 Ga0207695_10259869 Ga0207695_102598692 415
53 3300025914 Ga0207671_10031150 Ga0207671_100311504 415
54 3300025961 Ga0207712_10013433 Ga0207712_100134333 415
55 3300025986 Ga0207658_10027164 Ga0207658_100271642 415
56 3300026035 Ga0207703_10017168 Ga0207703_100171684 415
57 3300026088 Ga0207641_10038880 Ga0207641_100388804 415
58 3300026118 Ga0207675_100147559 Ga0207675_1001475591 415
59 3300031241 Ga0265325_10001308 Ga0265325_100013085 415
60 3300031249 Ga0265339_10017769 Ga0265339_100177692 415
61 3300031595 Ga0265313_10008008 Ga0265313_100080082 415
62 3300046538 Ga0495609_0018203 Ga0495609_0018203_391_1644 415
63 3300049581 Ga0501047_0110044 Ga0501047_0110044_897_2147 415
64 3300053119 Ga0500595_001027 Ga0500595_001027_5703_6953 415
65 iso_pu_bacteria 2508501009 2508540806 415
66 iso_pu_bacteria 2643221628 2644163041 415
67 iso_pu_bacteria 2844315083 2844320866 415
68 iso_pu_bacteria 2876761206 2876762034 415
69 iso_pu_bacteria 2888388044 2888392038 415
70 iso_pu_bacteria 2894772417 2894772622 415
71 iso_pu_bacteria 2903727486 2903728063 415
72 iso_pu_bacteria 2906602504 2906608149 415
73 iso_pu_bacteria 3005718088 3005723907 415
74 iso_pu_bacteria 8006926726 8006929371 415
75 iso_pu_bacteria 8056967851 8056969155 415
76 3300005548 Ga0070665_100055299 Ga0070665_1000552993 416
77 3300006048 Ga0075363_100005901 Ga0075363_1000059013 416
78 3300006177 Ga0075362_10013877 Ga0075362_100138773 416
79 3300006195 Ga0075366_10049179 Ga0075366_100491791 416
80 3300006946 Ga0079104_1000004 Ga0079104_1000004340 416
81 3300009148 Ga0105243_10000352 Ga0105243_1000035242 416
82 3300009148 Ga0105243_10000498 Ga0105243_1000049835 416
83 3300013297 Ga0157378_10009858 Ga0157378_100098583 416
84 3300013306 Ga0163162_10143458 Ga0163162_101434583 416
85 3300014497 Ga0182008_10000041 Ga0182008_1000004158 416
86 3300025935 Ga0207709_10000138 Ga0207709_1000013859 416
87 3300025935 Ga0207709_10001062 Ga0207709_100010623 416
88 3300027111 Ga0209281_1000005 Ga0209281_1000005546 416
89 3300028379 Ga0268266_10016344 Ga0268266_100163445 416
90 3300039447 Ga0436361_0836000 Ga0436361_0836000_903_2213 416
91 3300044694 Ga0466963_0009517 Ga0466963_0009517_3994_5250 416
92 3300044719 Ga0466971_0027655 Ga0466971_0027655_464_1720 416
93 3300048927 Ga0496124_0000151 Ga0496124_0000151_13839_15143 416
94 3300048928 Ga0496125_0008396 Ga0496125_0008396_454_1758 416
95 3300053730 Ga0500645_000242 Ga0500645_000242_34533_35828 416
96 3300005327 Ga0070658_10098232 Ga0070658_100982322 417
97 3300005356 Ga0070674_100011296 Ga0070674_1000112965 417
98 3300005455 Ga0070663_100002382 Ga0070663_10000238211 417
99 3300005616 Ga0068852_100026332 Ga0068852_1000263323 417
100 3300005618 Ga0068864_100002249 Ga0068864_1000022493 417
101 3300005618 Ga0068864_100028302 Ga0068864_1000283023 417
102 3300005719 Ga0068861_100018717 Ga0068861_1000187174 417
103 3300005844 Ga0068862_100015054 Ga0068862_1000150543 417
104 3300005981 Ga0081538_10012767 Ga0081538_100127672 417
105 3300005983 Ga0081540_1038232 Ga0081540_10382322 417
106 3300006881 Ga0068865_100053630 Ga0068865_1000536302 417
107 3300009098 Ga0105245_10025391 Ga0105245_100253912 417
108 3300009147 Ga0114129_10463422 Ga0114129_104634221 417
109 3300010375 Ga0105239_10082261 Ga0105239_100822612 417
110 3300011119 Ga0105246_10003208 Ga0105246_100032088 417
111 3300013296 Ga0157374_10131777 Ga0157374_101317772 417
112 3300013297 Ga0157378_10068033 Ga0157378_100680332 417
113 3300013306 Ga0163162_10011613 Ga0163162_100116136 417
114 3300014325 Ga0163163_10008087 Ga0163163_100080879 417
115 3300014325 Ga0163163_10044219 Ga0163163_100442193 417
116 3300014968 Ga0157379_10086638 Ga0157379_100866382 417
117 3300014969 Ga0157376_10009387 Ga0157376_100093874 417
118 3300025250 Ga0209026_1004077 Ga0209026_10040775 417
119 3300025298 Ga0209050_1001709 Ga0209050_100170920 417
120 3300025901 Ga0207688_10030589 Ga0207688_100305893 417
121 3300025919 Ga0207657_10005104 Ga0207657_100051042 417
122 3300025923 Ga0207681_10028695 Ga0207681_100286952 417
123 3300025925 Ga0207650_10006350 Ga0207650_100063505 417
124 3300025927 Ga0207687_10085124 Ga0207687_100851242 417
125 3300025931 Ga0207644_10089535 Ga0207644_100895352 417
126 3300025938 Ga0207704_10022454 Ga0207704_100224542 417
127 3300025944 Ga0207661_10061424 Ga0207661_100614242 417
128 3300026041 Ga0207639_10115417 Ga0207639_101154172 417
129 3300026067 Ga0207678_10006898 Ga0207678_1000689810 417
130 3300026095 Ga0207676_10001668 Ga0207676_1000166811 417
131 3300026095 Ga0207676_10083086 Ga0207676_100830862 417
132 3300026118 Ga0207675_100011421 Ga0207675_1000114213 417
133 3300026121 Ga0207683_10006993 Ga0207683_100069938 417
134 3300031456 Ga0307513_10217570 Ga0307513_102175702 417
135 3300035410 Ga0373924_0006808 Ga0373924_0006808_2690_3943 417
136 3300041413 Ga0439465_0000947 Ga0439465_0000947_3182_4435 417
137 3300041997 Ga0439431_0000923 Ga0439431_0000923_321_1574 417
138 3300042004 Ga0439445_0001289 Ga0439445_0001289_1032_2285 417
139 3300042010 Ga0439452_001510 Ga0439452_001510_4678_5931 417
140 3300042014 Ga0439457_002420 Ga0439457_002420_1013_2266 417
141 3300042435 Ga0439434_0000778 Ga0439434_0000778_2875_4128 417
142 3300047472 Ga0495686_0072092 Ga0495686_0072092_82_1335 417
143 3300048903 Ga0496100_0017983 Ga0496100_0017983_401_1654 417
144 3300048905 Ga0496102_0004248 Ga0496102_0004248_4497_5750 417
145 3300048906 Ga0496103_0011511 Ga0496103_0011511_2648_3901 417
146 3300048908 Ga0496105_0042714 Ga0496105_0042714_1566_2819 417
147 3300048910 Ga0496107_0012004 Ga0496107_0012004_2455_3708 417
148 3300048913 Ga0496110_0109276 Ga0496110_0109276_949_2202 417
149 3300048915 Ga0496112_0061183 Ga0496112_0061183_1415_2668 417
150 3300048915 Ga0496112_0106347 Ga0496112_0106347_1074_2327 417
151 3300048916 Ga0496113_0005038 Ga0496113_0005038_5624_6877 417
152 3300048918 Ga0496115_0002660 Ga0496115_0002660_9817_11070 417
153 3300048919 Ga0496116_0002434 Ga0496116_0002434_8647_9948 417
154 3300048919 Ga0496116_0026550 Ga0496116_0026550_217_1518 417
155 3300048920 Ga0496117_0008553 Ga0496117_0008553_7949_9250 417
156 3300048921 Ga0496118_0004807 Ga0496118_0004807_2960_4261 417
157 3300048922 Ga0496119_0013864 Ga0496119_0013864_1605_2906 417
158 3300048922 Ga0496119_0053132 Ga0496119_0053132_558_1859 417
159 3300048923 Ga0496120_0010587 Ga0496120_0010587_4619_5920 417
160 3300048924 Ga0496121_0001225 Ga0496121_0001225_2861_4162 417
161 3300048925 Ga0496122_0000021 Ga0496122_0000021_238475_239776 417
162 3300048926 Ga0496123_0001826 Ga0496123_0001826_8834_10135 417
163 3300048928 Ga0496125_0000005 Ga0496125_0000005_269427_270728 417
164 3300048928 Ga0496125_0022617 Ga0496125_0022617_4091_5392 417
165 3300048928 Ga0496125_0024631 Ga0496125_0024631_2898_4199 417
166 3300048929 Ga0496126_0018541 Ga0496126_0018541_1300_2601 417
167 3300048929 Ga0496126_0081056 Ga0496126_0081056_940_2241 417
168 3300049570 Ga0501033_0046303 Ga0501033_0046303_171_1424 417
169 3300049574 Ga0501038_0122400 Ga0501038_0122400_408_1661 417
170 3300049575 Ga0501039_0054859 Ga0501039_0054859_874_2127 417
171 3300049579 Ga0501043_0015482 Ga0501043_0015482_1333_2586 417
172 3300049581 Ga0501047_0027810 Ga0501047_0027810_2450_3703 417
173 3300049823 Ga0501044_0032007 Ga0501044_0032007_2251_3504 417
174 3300003784 Ga0055534_1000024 Ga0055534_100002412 418
175 3300003790 Ga0055528_1001328 Ga0055528_10013283 418
176 3300005340 Ga0070689_100042599 Ga0070689_1000425993 418
177 3300005353 Ga0070669_100036308 Ga0070669_1000363083 418
178 3300005354 Ga0070675_100281898 Ga0070675_1002818981 418
179 3300005356 Ga0070674_100021312 Ga0070674_1000213123 418
180 3300005365 Ga0070688_100041939 Ga0070688_1000419392 418
181 3300005441 Ga0070700_100027125 Ga0070700_1000271252 418
182 3300005466 Ga0070685_10004919 Ga0070685_100049193 418
183 3300005617 Ga0068859_100017655 Ga0068859_1000176555 418
184 3300005840 Ga0068870_10026253 Ga0068870_100262533 418
185 3300005841 Ga0068863_100052885 Ga0068863_1000528851 418
186 3300005844 Ga0068862_100094388 Ga0068862_1000943882 418
187 3300006358 Ga0068871_100005799 Ga0068871_1000057993 418
188 3300006931 Ga0097620_100017655 Ga0097620_1000176553 418
189 3300006948 Ga0099826_10000068 Ga0099826_1000006810 418
190 3300025263 Ga0209565_1000040 Ga0209565_1000040129 418
191 3300025273 Ga0209673_1000109 Ga0209673_100010934 418
192 3300025291 Ga0209675_1000024 Ga0209675_1000024139 418
193 3300025294 Ga0209025_1005140 Ga0209025_10051407 418
194 3300025908 Ga0207643_10005416 Ga0207643_100054163 418
195 3300025942 Ga0207689_10001070 Ga0207689_1000107018 418
196 3300025961 Ga0207712_10072679 Ga0207712_100726793 418
197 3300026075 Ga0207708_10046002 Ga0207708_100460022 418
198 3300026089 Ga0207648_10035700 Ga0207648_100357001 418
199 3300026095 Ga0207676_10072296 Ga0207676_100722962 418
200 3300026121 Ga0207683_10009454 Ga0207683_100094543 418
201 3300027666 Ga0209282_1007281 Ga0209282_10072816 418
202 3300039447 Ga0436361_0040547 Ga0436361_0040547_653_1924 418
203 3300050496 nmdc:mga07m45_1840_c1 nmdc:mga07m45_1840_c1_5404_6660 418
204 3300003203 JGI25406J46586_10000190 JGI25406J46586_100001907 419
205 3300005435 Ga0070714_100075787 Ga0070714_1000757872 419
206 3300005455 Ga0070663_100120717 Ga0070663_1001207173 419
207 3300005616 Ga0068852_100030354 Ga0068852_1000303544 419
208 3300005985 Ga0081539_10000072 Ga0081539_10000072141 419
209 3300006051 Ga0075364_10006244 Ga0075364_100062442 419
210 3300006058 Ga0075432_10001625 Ga0075432_100016252 419
211 3300009098 Ga0105245_10010351 Ga0105245_100103512 419
212 3300009545 Ga0105237_10000828 Ga0105237_1000082840 419
213 3300025254 Ga0209148_1000306 Ga0209148_100030621 419
214 3300025261 Ga0209233_1013596 Ga0209233_10135962 419
215 3300025272 Ga0209455_1003017 Ga0209455_10030173 419
216 3300025911 Ga0207654_10062702 Ga0207654_100627021 419
217 3300025913 Ga0207695_10000136 Ga0207695_10000136162 419
218 3300025914 Ga0207671_10006469 Ga0207671_100064698 419
219 3300025927 Ga0207687_10167670 Ga0207687_101676702 419
220 3300025929 Ga0207664_10051079 Ga0207664_100510794 419
221 3300026067 Ga0207678_10151845 Ga0207678_101518451 419
222 3300026142 Ga0207698_10067910 Ga0207698_100679102 419
223 3300027907 Ga0207428_10050853 Ga0207428_100508532 419
224 3300037312 Ga0395899_0000586 Ga0395899_0000586_33815_35110 419
225 3300037312 Ga0395899_0001645 Ga0395899_0001645_16327_17622 419
226 3300037312 Ga0395899_0002844 Ga0395899_0002844_8278_9573 419
227 3300037418 Ga0395900_0031592 Ga0395900_0031592_82_1377 419
228 3300037418 Ga0395900_0157840 Ga0395900_0157840_872_2131 419
229 3300037466 Ga0395898_0128299 Ga0395898_0128299_559_1854 419
230 3300037471 Ga0395905_0000256 Ga0395905_0000256_301_1596 419
231 3300037471 Ga0395905_0020129 Ga0395905_0020129_2564_3859 419
232 3300044658 Ga0466972_0000360 Ga0466972_0000360_10306_11601 419
233 3300044684 Ga0466966_0008582 Ga0466966_0008582_5014_6309 419
234 3300045049 Ga0466959_0014835 Ga0466959_0014835_1136_2431 419
235 3300045049 Ga0466959_0037646 Ga0466959_0037646_1507_2802 419
236 3300045049 Ga0466959_0108262 Ga0466959_0108262_183_1448 419
237 3300045051 Ga0451576_0191743 Ga0451576_0191743_838_2097 419
238 3300046491 Ga0495584_0000167 Ga0495584_0000167_36863_38164 419
239 3300046492 Ga0495585_0000125 Ga0495585_0000125_67923_69224 419
240 3300046492 Ga0495585_0002757 Ga0495585_0002757_3834_5135 419
241 3300046492 Ga0495585_0003275 Ga0495585_0003275_2615_3916 419
242 3300046499 Ga0495594_0092619 Ga0495594_0092619_354_1655 419
243 3300046500 Ga0495596_0006074 Ga0495596_0006074_15_1316 419
244 3300046506 Ga0495583_0000065 Ga0495583_0000065_29360_30661 419
245 3300046513 Ga0495616_0000631 Ga0495616_0000631_5896_7197 419
246 3300046513 Ga0495616_0010663 Ga0495616_0010663_125_1426 419
247 3300046517 Ga0495630_0101146 Ga0495630_0101146_94_1395 419
248 3300046524 Ga0495648_0000053 Ga0495648_0000053_151170_152471 419
249 3300046526 Ga0495666_0006950 Ga0495666_0006950_90_1391 419
250 3300046530 Ga0495654_0019488 Ga0495654_0019488_2156_3457 419
251 3300046535 Ga0495586_0030938 Ga0495586_0030938_890_2191 419
252 3300046536 Ga0495587_0045098 Ga0495587_0045098_784_2085 419
253 3300046557 Ga0495622_0017459 Ga0495622_0017459_1479_2780 419
254 3300046616 Ga0495668_0003462 Ga0495668_0003462_5058_6359 419
255 3300046660 Ga0495625_0000299 Ga0495625_0000299_60302_61561 419
256 3300046660 Ga0495625_0007499 Ga0495625_0007499_93_1394 419
257 3300046691 Ga0495670_0002225 Ga0495670_0002225_7788_9089 419
258 3300046809 Ga0495600_0078076 Ga0495600_0078076_208_1509 419
259 3300047323 Ga0495683_0000614 Ga0495683_0000614_17388_18689 419
260 3300048091 Ga0495626_0037804 Ga0495626_0037804_121_1422 419
261 3300048927 Ga0496124_0007006 Ga0496124_0007006_409_1704 419
262 3300049823 Ga0501044_0026838 Ga0501044_0026838_1605_2864 419
263 3300050489 nmdc:mga03683_1876_c1 nmdc:mga03683_1876_c1_2449_3708 419
264 3300050491 nmdc:mga00v17_11139_c1 nmdc:mga00v17_11139_c1_1773_3032 419
265 3300050492 nmdc:mga0yw44_927_c1 nmdc:mga0yw44_927_c1_7477_8736 419
266 3300050493 nmdc:mga0k408_3780_c1 nmdc:mga0k408_3780_c1_5373_6632 419
267 3300053177 Ga0500636_0048641 Ga0500636_0048641_203_1462 419
268 3300059477 Ga0587084_005755 Ga0587084_005755_109_1404 419
269 3300059478 Ga0587093_001581 Ga0587093_001581_118_1413 419
270 3300059478 Ga0587093_002907 Ga0587093_002907_118_1413 419
271 3300059490 Ga0587066_002880 Ga0587066_002880_546_1841 419
272 3300059491 Ga0587070_001609 Ga0587070_001609_117_1412 419
273 3300059491 Ga0587070_007964 Ga0587070_007964_118_1413 419
274 3300059493 Ga0587077_002017 Ga0587077_002017_114_1409 419
275 3300059493 Ga0587077_002193 Ga0587077_002193_118_1413 419
276 3300059505 Ga0587083_0010725 Ga0587083_0010725_77_1372 419
277 3300059506 Ga0587085_003473 Ga0587085_003473_307_1602 419
278 3300059508 Ga0587088_006971 Ga0587088_006971_138_1433 419
279 3300059510 Ga0587090_002092 Ga0587090_002092_737_2032 419
280 3300059510 Ga0587090_006182 Ga0587090_006182_113_1408 419
281 3300059511 Ga0587091_002195 Ga0587091_002195_118_1413 419
282 3300059512 Ga0587092_005761 Ga0587092_005761_118_1413 419
283 3300059512 Ga0587092_006374 Ga0587092_006374_120_1415 419
284 3300059513 Ga0587094_001434 Ga0587094_001434_117_1412 419
285 3300059623 Ga0587101_000835 Ga0587101_000835_857_2152 419
286 3300059623 Ga0587101_001123 Ga0587101_001123_317_1612 419
287 3300059639 Ga0587062_001202 Ga0587062_001202_118_1413 419
288 3300059639 Ga0587062_004048 Ga0587062_004048_117_1412 419
289 3300059641 Ga0587068_005948 Ga0587068_005948_117_1412 419
290 3300059641 Ga0587068_006732 Ga0587068_006732_74_1411 419
291 3300059642 Ga0587069_002133 Ga0587069_002133_549_1844 419
292 3300059643 Ga0587072_009639 Ga0587072_009639_115_1410 419
293 3300059644 Ga0587075_005221 Ga0587075_005221_118_1413 419
294 3300059645 Ga0587076_000697 Ga0587076_000697_1292_2629 419
295 3300059645 Ga0587076_001856 Ga0587076_001856_845_2140 419
296 3300059646 Ga0587078_000975 Ga0587078_000975_67_1404 419
297 3300059646 Ga0587078_001062 Ga0587078_001062_925_2220 419
298 3300059649 Ga0587102_000732 Ga0587102_000732_118_1413 419
299 3300060344 Ga0587071_002133 Ga0587071_002133_118_1413 419
300 3300060346 Ga0587111_0001593 Ga0587111_0001593_118_1413 419
301 3300060346 Ga0587111_0005298 Ga0587111_0005298_151_1446 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

16

412

0.94

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

16

56

0.93

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

17

61

0.91

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

19

79

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j0e-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa dehydrogenase from caenorhadbitis elegans in p1 space group 0.9905 2 32
5a9r-assembly1.cif.gz_A apo form of imine reductase from amycolatopsis orientalis 0.9815 2 32
7o1k-assembly1.cif.gz_A structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme alpha-e141a, beta-c92a mutant 0.9801 2 32
7bkd-assembly1.cif.gz_a formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) 0.9788 2 36
4b3j-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis fatty acid beta- oxidation complex with coenzymea bound at the hydratase and thiolase active sites 0.9783 2 32
ID Description Score Start End Superfamily
af_Q2G1C9_1_191_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 1 2 30 3.40.50.720
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9834 2 35 3.50.50.60
af_Q5U1B0_1_189_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.979 1 30 3.40.50.720
af_A0A1D6EF23_1_151_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9778 2 36 3.50.50.60
af_C0VXV5_2_190_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9777 2 32 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7J6Z2W5-F1-model_v4 deleted 0.9844 84 411
AF-A0A379B283-F1-model_v4 D-amino acid dehydrogenase small subunit (EC 1.4.3.19, EC 1.4.99.6) 0.9825 163 417 GO:0005737
GO:0005886
GO:0008718
GO:0043799
GO:0055130
AF-J0VQE7-F1-model_v4 deleted 0.9757 1 416
AF-A0A8B3G9I7-F1-model_v4 deleted 0.9737 240 416
AF-J0VQE7-F1-model_v4 deleted 0.9708 1 416

Feature Viewer

pLDDT pTM Quality
90.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map