F396247

General Info

Members Datasets Scaffolds Average Seq Length
302 189 299 151

Family's Representative Sequence

Representative Sequence 3300001991|JGI24743J22301_10031591|JGI24743J22301_100315912
Length 158
Sequence MPKIDLGSLEQTNRTGYPPPFNEPVQGRWQRKVGEAAGLTALGARHVTLEPGAWSSQRHWHDTEDELLVMISGSAVLVEDDGETELAPGDITAWAMGERNGHHLINRGSEPCTFVCVSAGKPGAGGYSDIDMMWTDDGRFVHKDGTPYGDARTLSSTS

Samples

Sample ID Description Type Environment
1 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 1.66
Rhizosphere 94.37
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10031591 3300001991 Bacteria 1043
2 Ga0055543_1020675 3300004625 Bacteria 1207
3 Ga0065165_1005265 3300005262 Bacteria 7384
4 Ga0065704_10087424 3300005289 Bacteria 3027
5 Ga0065712_10081144 3300005290 Bacteria 3035
6 Ga0065707_10470187 3300005295 Unclassified 783
7 Ga0070658_10003845 3300005327 Bacteria 12307
8 Ga0070658_10957274 3300005327 Bacteria 744
9 Ga0070676_10016884 3300005328 Bacteria 4036
10 Ga0070676_11515789 3300005328 Bacteria 517
11 Ga0070690_100025929 3300005330 Bacteria 3612
12 Ga0070670_100000016 3300005331 Bacteria 226440
13 Ga0070666_10109678 3300005335 Bacteria 1908
14 Ga0070666_10179206 3300005335 Bacteria 1486
15 Ga0070666_10751899 3300005335 Bacteria 716
16 Ga0070680_100002910 3300005336 Bacteria 12723
17 Ga0070680_100069192 3300005336 Bacteria 2898
18 Ga0070680_101483781 3300005336 Bacteria 587
19 Ga0070682_100593153 3300005337 Bacteria 874
20 Ga0068868_100183789 3300005338 Bacteria 1736
21 Ga0068868_100303496 3300005338 Bacteria 1356
22 Ga0070660_100004955 3300005339 Bacteria 9209
23 Ga0070660_100038880 3300005339 Bacteria 3614
24 Ga0070660_100082446 3300005339 Bacteria 2525
25 Ga0070661_100279384 3300005344 Bacteria 1295
26 Ga0070692_10960721 3300005345 Bacteria 595
27 Ga0070669_100064339 3300005353 Bacteria 2701
28 Ga0070669_100174740 3300005353 Bacteria 1677
29 Ga0070675_100843471 3300005354 Bacteria 838
30 Ga0070671_100013831 3300005355 Bacteria 6512
31 Ga0070671_100068998 3300005355 Bacteria 2948
32 Ga0070673_100020625 3300005364 Bacteria 4755
33 Ga0070673_100046407 3300005364 Bacteria 3375
34 Ga0070659_100001058 3300005366 Bacteria 20125
35 Ga0070659_100043122 3300005366 Bacteria 3528
36 Ga0070659_100220705 3300005366 Bacteria 1564
37 Ga0070659_101154846 3300005366 Bacteria 684
38 Ga0070667_100000425 3300005367 Bacteria 44629
39 Ga0070667_100042609 3300005367 Bacteria 3809
40 Ga0070667_100069704 3300005367 Bacteria 2993
41 Ga0070667_101014191 3300005367 Bacteria 775
42 Ga0070714_101347569 3300005435 Bacteria 697
43 Ga0070714_101724398 3300005435 Bacteria 612
44 Ga0070663_100162654 3300005455 Bacteria 1719
45 Ga0070662_100173143 3300005457 Bacteria 1697
46 Ga0070662_100392843 3300005457 Bacteria 1143
47 Ga0070681_10067981 3300005458 Bacteria 3531
48 Ga0070681_10233501 3300005458 Bacteria 1753
49 Ga0070681_10466326 3300005458 Bacteria 1175
50 Ga0068867_100368804 3300005459 Bacteria 1203
51 Ga0068867_100987071 3300005459 Bacteria 763
52 Ga0070685_10492586 3300005466 Bacteria 866
53 Ga0070679_100227413 3300005530 Bacteria 1825
54 Ga0070679_100276189 3300005530 Bacteria 1633
55 Ga0070679_101250550 3300005530 Bacteria 688
56 Ga0070684_100510266 3300005535 Bacteria 1114
57 Ga0070697_100624380 3300005536 Bacteria 948
58 Ga0068853_100053054 3300005539 Bacteria 3492
59 Ga0068853_100687391 3300005539 Bacteria 975
60 Ga0070686_100119413 3300005544 Bacteria 1808
61 Ga0070693_100194843 3300005547 Bacteria 1313
62 Ga0070665_100059602 3300005548 Bacteria 3826
63 Ga0070665_102254487 3300005548 Bacteria 548
64 Ga0068855_100031905 3300005563 Bacteria 6289
65 Ga0068855_100164794 3300005563 Bacteria 2513
66 Ga0068855_100374024 3300005563 Bacteria 1565
67 Ga0068855_100651683 3300005563 Bacteria 1131
68 Ga0070664_100013519 3300005564 Bacteria 6650
69 Ga0070664_100541692 3300005564 Bacteria 1076
70 Ga0068857_101580082 3300005577 Bacteria 640
71 Ga0068854_100114054 3300005578 Bacteria 2042
72 Ga0068854_100122221 3300005578 Bacteria 1978
73 Ga0068854_100567394 3300005578 Bacteria 965
74 Ga0068854_101106074 3300005578 Unclassified 706
75 Ga0068856_100444177 3300005614 Bacteria 1318
76 Ga0068856_100694938 3300005614 Bacteria 1037
77 Ga0068856_101354134 3300005614 Bacteria 726
78 Ga0068852_100095052 3300005616 Bacteria 2675
79 Ga0068852_100588840 3300005616 Bacteria 1116
80 Ga0068859_100516916 3300005617 Bacteria 1289
81 Ga0068859_100921605 3300005617 Bacteria 958
82 Ga0068859_101315938 3300005617 Unclassified 796
83 Ga0068864_100000017 3300005618 Bacteria 285607
84 Ga0068864_101368992 3300005618 Bacteria 709
85 Ga0068866_10466516 3300005718 Bacteria 829
86 Ga0068851_10138990 3300005834 Bacteria 1320
87 Ga0068863_100000018 3300005841 Bacteria 206948
88 Ga0068858_100008141 3300005842 Bacteria 10078
89 Ga0068858_100510060 3300005842 Bacteria 1162
90 Ga0068858_100690396 3300005842 Bacteria 993
91 Ga0068858_100744192 3300005842 Bacteria 955
92 Ga0068860_101433956 3300005843 Bacteria 712
93 Ga0068862_100000010 3300005844 Bacteria 285607
94 Ga0068862_100928146 3300005844 Bacteria 857
95 Ga0068865_100560257 3300006881 Bacteria 961
96 Ga0097620_100516999 3300006931 Bacteria 1289
97 Ga0097620_100921828 3300006931 Bacteria 958
98 Ga0097620_101316047 3300006931 Unclassified 796
99 Ga0105251_10002120 3300009011 Bacteria 15958
100 Ga0105240_10048454 3300009093 Bacteria 5370
101 Ga0111539_11599036 3300009094 Bacteria 756
102 Ga0105245_10011260 3300009098 Bacteria 7787
103 Ga0105247_10017958 3300009101 Bacteria 4243
104 Ga0105241_11092456 3300009174 Bacteria 751
105 Ga0105241_12530976 3300009174 Unclassified 514
106 Ga0105248_10000001 3300009177 Bacteria 1881304
107 Ga0105248_10000128 3300009177 Bacteria 87735
108 Ga0105248_10040998 3300009177 Bacteria 5191
109 Ga0105248_10391910 3300009177 Bacteria 1564
110 Ga0105248_10771329 3300009177 Bacteria 1085
111 Ga0105238_10343490 3300009551 Bacteria 1481
112 Ga0105249_10000726 3300009553 Bacteria 29928
113 Ga0105249_10050288 3300009553 Bacteria 3800
114 Ga0105239_10899405 3300010375 Bacteria 1016
115 Ga0157373_10071537 3300013100 Bacteria 2449
116 Ga0157373_10159853 3300013100 Bacteria 1585
117 Ga0157371_10047584 3300013102 Bacteria 3049
118 Ga0157371_10417643 3300013102 Bacteria 983
119 Ga0157370_10253538 3300013104 Bacteria 1627
120 Ga0157370_10290860 3300013104 Bacteria 1509
121 Ga0157369_10019843 3300013105 Bacteria 7521
122 Ga0157369_10519990 3300013105 Bacteria 1231
123 Ga0157369_10608173 3300013105 Bacteria 1128
124 Ga0157369_11646847 3300013105 Unclassified 652
125 Ga0157378_10240229 3300013297 Bacteria 1730
126 Ga0163162_10178354 3300013306 Bacteria 2250
127 Ga0163162_10368792 3300013306 Bacteria 1569
128 Ga0157372_10097975 3300013307 Bacteria 3345
129 Ga0157372_11604680 3300013307 Bacteria 749
130 Ga0163163_10167435 3300014325 Bacteria 2244
131 Ga0157379_10211568 3300014968 Bacteria 1755
132 Ga0157379_10793029 3300014968 Unclassified 894
133 Ga0213876_10005598 3300021384 Bacteria 6897
134 Ga0209050_1012797 3300025298 Bacteria 3804
135 Ga0207697_10008985 3300025315 Bacteria 4336
136 Ga0207713_1007194 3300025735 Bacteria 6632
137 Ga0207710_10006016 3300025900 Bacteria 5201
138 Ga0207680_10068884 3300025903 Bacteria 2184
139 Ga0207680_10280964 3300025903 Bacteria 1156
140 Ga0207647_10003324 3300025904 Bacteria 12082
141 Ga0207645_10003650 3300025907 Bacteria 11612
142 Ga0207645_10162560 3300025907 Bacteria 1461
143 Ga0207705_10000929 3300025909 Bacteria 23915
144 Ga0207705_10006704 3300025909 Bacteria 8515
145 Ga0207705_10130140 3300025909 Bacteria 1872
146 Ga0207705_10134511 3300025909 Bacteria 1842
147 Ga0207705_10454554 3300025909 Bacteria 993
148 Ga0207705_11053464 3300025909 Bacteria 627
149 Ga0207695_10252946 3300025913 Bacteria 1661
150 Ga0207660_10001261 3300025917 Bacteria 16979
151 Ga0207660_10003546 3300025917 Bacteria 10168
152 Ga0207657_10000498 3300025919 Bacteria 41427
153 Ga0207657_10002291 3300025919 Bacteria 20732
154 Ga0207657_10040707 3300025919 Bacteria 4115
155 Ga0207649_10363633 3300025920 Bacteria 1074
156 Ga0207652_10189017 3300025921 Bacteria 1852
157 Ga0207652_10317686 3300025921 Bacteria 1406
158 Ga0207652_10816591 3300025921 Bacteria 827
159 Ga0207681_10050696 3300025923 Bacteria 2809
160 Ga0207681_10213152 3300025923 Bacteria 1490
161 Ga0207650_10000057 3300025925 Bacteria 156913
162 Ga0207650_10089450 3300025925 Bacteria 2350
163 Ga0207659_10007909 3300025926 Bacteria 6574
164 Ga0207687_10021225 3300025927 Bacteria 4313
165 Ga0207664_11099302 3300025929 Bacteria 711
166 Ga0207644_10144097 3300025931 Bacteria 1837
167 Ga0207644_10414438 3300025931 Bacteria 1103
168 Ga0207644_10683645 3300025931 Bacteria 855
169 Ga0207690_10049447 3300025932 Bacteria 2803
170 Ga0207690_10239882 3300025932 Bacteria 1396
171 Ga0207690_10342534 3300025932 Bacteria 1180
172 Ga0207690_10770043 3300025932 Bacteria 794
173 Ga0207690_10773518 3300025932 Bacteria 792
174 Ga0207706_10018262 3300025933 Bacteria 6310
175 Ga0207706_10063866 3300025933 Bacteria 3241
176 Ga0207706_11097938 3300025933 Bacteria 665
177 Ga0207669_10088836 3300025937 Bacteria 2005
178 Ga0207711_10000001 3300025941 Bacteria 1325674
179 Ga0207711_10000031 3300025941 Bacteria 203323
180 Ga0207711_10003771 3300025941 Bacteria 13052
181 Ga0207711_10023655 3300025941 Bacteria 5144
182 Ga0207679_10020851 3300025945 Bacteria 4432
183 Ga0207679_10264197 3300025945 Bacteria 1469
184 Ga0207667_10182383 3300025949 Bacteria 2155
185 Ga0207651_11544311 3300025960 Bacteria 598
186 Ga0207651_11613997 3300025960 Bacteria 584
187 Ga0207712_10000565 3300025961 Bacteria 29915
188 Ga0207668_10190029 3300025972 Bacteria 1627
189 Ga0207640_10059457 3300025981 Bacteria 2522
190 Ga0207640_11071983 3300025981 Unclassified 712
191 Ga0207658_10001980 3300025986 Bacteria 15286
192 Ga0207658_10042081 3300025986 Bacteria 3311
193 Ga0207677_10018043 3300026023 Bacteria 4226
194 Ga0207703_10002473 3300026035 Bacteria 16026
195 Ga0207703_10453637 3300026035 Bacteria 1198
196 Ga0207703_10581202 3300026035 Bacteria 1058
197 Ga0207639_10093361 3300026041 Bacteria 2413
198 Ga0207639_10132001 3300026041 Bacteria 2069
199 Ga0207678_10132855 3300026067 Bacteria 2123
200 Ga0207702_10206833 3300026078 Bacteria 1822
201 Ga0207702_10268191 3300026078 Bacteria 1609
202 Ga0207702_11774366 3300026078 Bacteria 609
203 Ga0207641_10000002 3300026088 Bacteria 981004
204 Ga0207648_10927798 3300026089 Bacteria 814
205 Ga0207676_10000005 3300026095 Bacteria 698744
206 Ga0207698_10544437 3300026142 Bacteria 1136
207 Ga0268266_10137560 3300028379 Bacteria 2189
208 Ga0268266_10816074 3300028379 Bacteria 901
209 Ga0268265_10000003 3300028380 Bacteria 949201
210 Ga0268265_10108157 3300028380 Bacteria 2263
211 Ga0268265_10876130 3300028380 Bacteria 880
212 Ga0314311_1257367 3300030733 Bacteria 2579
213 Ga0307413_10001941 3300031824 Bacteria 8212
214 Ga0307410_10000937 3300031852 Bacteria 12506
215 Ga0307410_10240230 3300031852 Bacteria 1403
216 Ga0307407_10011250 3300031903 Bacteria 4251
217 Ga0307412_10012463 3300031911 Bacteria 4958
218 Ga0307409_100026559 3300031995 Bacteria 4085
219 Ga0307409_100868839 3300031995 Bacteria 914
220 Ga0307409_101165414 3300031995 Bacteria 793
221 Ga0307416_100095943 3300032002 Bacteria 2562
222 Ga0307414_10004546 3300032004 Bacteria 7545
223 Ga0307411_11026642 3300032005 Unclassified 739
224 Ga0307415_100007081 3300032126 Bacteria 6106
225 Ga0373946_0538017 3300035171 Bacteria 602
226 Ga0373947_0221547 3300035725 Bacteria 1244
227 Ga0395899_0054770 3300037312 Bacteria 2951
228 Ga0395900_0720829 3300037418 Bacteria 930
229 Ga0395898_0086427 3300037466 Bacteria 3022
230 Ga0395905_0031077 3300037471 Bacteria 5029
231 Ga0395905_0042384 3300037471 Bacteria 4271
232 Ga0395901_0039511 3300038443 Bacteria 4882
233 Ga0395901_0133526 3300038443 Bacteria 2609
234 Ga0395901_0137154 3300038443 Bacteria 2571
235 Ga0436365_0137032 3300039437 Bacteria 18768
236 Ga0439436_0025434 3300041404 Bacteria 1738
237 Ga0439439_0004329 3300041406 Bacteria 3192
238 Ga0439461_0004396 3300041410 Bacteria 2353
239 Ga0439466_0115760 3300041411 Bacteria 829
240 Ga0439465_0002284 3300041413 Bacteria 6297
241 Ga0439431_0008890 3300041997 Bacteria 2263
242 Ga0439432_006593 3300042006 Bacteria 4137
243 Ga0439449_0090101 3300042007 Bacteria 1132
244 Ga0439452_069280 3300042010 Bacteria 779
245 Ga0439457_004374 3300042014 Bacteria 3688
246 Ga0439462_0015072 3300042015 Bacteria 1989
247 Ga0439434_0006247 3300042435 Bacteria 3476
248 Ga0451577_0511718 3300042876 Bacteria 1090
249 Ga0466969_0240362 3300044656 Unclassified 822
250 Ga0466972_0071209 3300044658 Bacteria 1659
251 Ga0453684_0744285 3300044712 Bacteria 1062
252 Ga0466960_0067686 3300044901 Bacteria 1769
253 Ga0466967_0037476 3300045976 Bacteria 4150
254 Ga0495580_0487962 3300046472 Bacteria 823
255 Ga0495616_0046374 3300046513 Bacteria 2194
256 Ga0495620_0085668 3300046515 Bacteria 1270
257 Ga0495663_0002011 3300046525 Bacteria 6248
258 Ga0495663_0183377 3300046525 Bacteria 726
259 Ga0495598_0132708 3300046537 Bacteria 855
260 Ga0495621_0002203 3300046539 Bacteria 5194
261 Ga0495621_0004551 3300046539 Bacteria 3911
262 Ga0495668_0007206 3300046616 Bacteria 7145
263 Ga0495668_0018230 3300046616 Bacteria 4057
264 Ga0495659_0068923 3300046664 Bacteria 1322
265 Ga0495659_0257592 3300046664 Bacteria 728
266 Ga0495658_0054501 3300046683 Bacteria 2275
267 Ga0495669_0004671 3300046684 Bacteria 5677
268 Ga0495669_0029506 3300046684 Bacteria 2405
269 Ga0495669_0044364 3300046684 Bacteria 1980
270 Ga0495669_0081168 3300046684 Bacteria 1488
271 Ga0495670_0280512 3300046691 Bacteria 891
272 Ga0495670_0439290 3300046691 Bacteria 707
273 Ga0495677_0188625 3300047445 Bacteria 800
274 Ga0496103_0132074 3300048906 Bacteria 1595
275 Ga0496106_0300616 3300048909 Bacteria 1287
276 Ga0496107_0604442 3300048910 Bacteria 810
277 Ga0496109_0194149 3300048912 Bacteria 1908
278 Ga0496109_0350366 3300048912 Bacteria 1395
279 Ga0496117_0019656 3300048920 Bacteria 5538
280 Ga0496118_0000332 3300048921 Bacteria 80480
281 Ga0501032_0004180 3300049569 Bacteria 10937
282 Ga0501034_0236677 3300049571 Bacteria 1773
283 Ga0501037_0079623 3300049573 Bacteria 2378
284 Ga0501038_0151970 3300049574 Bacteria 1887
285 Ga0501043_0003618 3300049579 Bacteria 12698
286 Ga0501046_0001373 3300049580 Bacteria 23444
287 Ga0501072_0276146 3300049588 Unclassified 1337
288 Ga0501075_1069000 3300049591 Unclassified 613
289 Ga0501077_0327593 3300049593 Bacteria 977
290 Ga0501079_0396298 3300049741 Unclassified 1083
291 Ga0501081_0831067 3300049743 Bacteria 696
292 Ga0501035_0125286 3300049822 Bacteria 2243
293 Ga0501045_1370592 3300049824 Unclassified 514
294 nmdc:mga08y16_535553_c1 3300050511 Bacteria 1186
295 Ga0495655_0002753 3300053083 Bacteria 2826
296 Ga0500643_000259 3300053087 Bacteria 47194
297 Ga0500658_0000261 3300053134 Bacteria 24255
298 Ga0466962_0207400 3300061719 Bacteria 958
299 Ga0530510_0326764 3300061734 Bacteria 1150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0327593 Ga0501077_0327593_423_797 122
2 3300005328 Ga0070676_11515789 Ga0070676_115157891 132
3 3300005339 Ga0070660_100082446 Ga0070660_1000824462 132
4 3300005539 Ga0068853_100687391 Ga0068853_1006873911 132
5 3300005547 Ga0070693_100194843 Ga0070693_1001948432 132
6 3300009177 Ga0105248_10771329 Ga0105248_107713291 132
7 3300025907 Ga0207645_10003650 Ga0207645_100036502 132
8 3300025919 Ga0207657_10040707 Ga0207657_100407073 132
9 3300026067 Ga0207678_10132855 Ga0207678_101328552 132
10 3300005366 Ga0070659_100220705 Ga0070659_1002207052 141
11 3300005458 Ga0070681_10466326 Ga0070681_104663262 141
12 3300005530 Ga0070679_100227413 Ga0070679_1002274132 141
13 3300025921 Ga0207652_10189017 Ga0207652_101890172 141
14 3300025932 Ga0207690_10770043 Ga0207690_107700432 141
15 3300061734 Ga0530510_0326764 Ga0530510_0326764_697_1134 141
16 iso_pu_bacteria 2643221577 2643894669 144
17 iso_pu_bacteria 2643221622 2644126193 144
18 iso_pu_bacteria 2643221685 2644476818 144
19 3300013105 Ga0157369_10019843 Ga0157369_100198434 147
20 3300025909 Ga0207705_10134511 Ga0207705_101345112 147
21 3300004625 Ga0055543_1020675 Ga0055543_10206752 148
22 3300005262 Ga0065165_1005265 Ga0065165_10052656 148
23 3300005289 Ga0065704_10087424 Ga0065704_100874242 148
24 3300005290 Ga0065712_10081144 Ga0065712_100811444 148
25 3300005295 Ga0065707_10470187 Ga0065707_104701871 148
26 3300005327 Ga0070658_10957274 Ga0070658_109572741 148
27 3300005331 Ga0070670_100000016 Ga0070670_10000001673 148
28 3300005335 Ga0070666_10109678 Ga0070666_101096782 148
29 3300005335 Ga0070666_10179206 Ga0070666_101792061 148
30 3300005336 Ga0070680_100002910 Ga0070680_1000029103 148
31 3300005336 Ga0070680_100069192 Ga0070680_1000691924 148
32 3300005336 Ga0070680_101483781 Ga0070680_1014837811 148
33 3300005337 Ga0070682_100593153 Ga0070682_1005931531 148
34 3300005338 Ga0068868_100183789 Ga0068868_1001837893 148
35 3300005339 Ga0070660_100004955 Ga0070660_1000049556 148
36 3300005344 Ga0070661_100279384 Ga0070661_1002793842 148
37 3300005345 Ga0070692_10960721 Ga0070692_109607211 148
38 3300005353 Ga0070669_100064339 Ga0070669_1000643393 148
39 3300005354 Ga0070675_100843471 Ga0070675_1008434712 148
40 3300005355 Ga0070671_100068998 Ga0070671_1000689984 148
41 3300005364 Ga0070673_100046407 Ga0070673_1000464074 148
42 3300005366 Ga0070659_100043122 Ga0070659_1000431224 148
43 3300005367 Ga0070667_100000425 Ga0070667_10000042511 148
44 3300005367 Ga0070667_100069704 Ga0070667_1000697042 148
45 3300005367 Ga0070667_101014191 Ga0070667_1010141912 148
46 3300005435 Ga0070714_101347569 Ga0070714_1013475692 148
47 3300005435 Ga0070714_101724398 Ga0070714_1017243981 148
48 3300005455 Ga0070663_100162654 Ga0070663_1001626541 148
49 3300005457 Ga0070662_100392843 Ga0070662_1003928432 148
50 3300005458 Ga0070681_10067981 Ga0070681_100679812 148
51 3300005458 Ga0070681_10233501 Ga0070681_102335012 148
52 3300005459 Ga0068867_100987071 Ga0068867_1009870712 148
53 3300005530 Ga0070679_100276189 Ga0070679_1002761891 148
54 3300005530 Ga0070679_101250550 Ga0070679_1012505502 148
55 3300005535 Ga0070684_100510266 Ga0070684_1005102662 148
56 3300005548 Ga0070665_100059602 Ga0070665_1000596023 148
57 3300005563 Ga0068855_100031905 Ga0068855_1000319054 148
58 3300005563 Ga0068855_100164794 Ga0068855_1001647942 148
59 3300005563 Ga0068855_100374024 Ga0068855_1003740242 148
60 3300005563 Ga0068855_100651683 Ga0068855_1006516832 148
61 3300005564 Ga0070664_100541692 Ga0070664_1005416922 148
62 3300005578 Ga0068854_100114054 Ga0068854_1001140544 148
63 3300005578 Ga0068854_100122221 Ga0068854_1001222213 148
64 3300005578 Ga0068854_100567394 Ga0068854_1005673941 148
65 3300005614 Ga0068856_100444177 Ga0068856_1004441772 148
66 3300005614 Ga0068856_100694938 Ga0068856_1006949382 148
67 3300005614 Ga0068856_101354134 Ga0068856_1013541342 148
68 3300005616 Ga0068852_100095052 Ga0068852_1000950523 148
69 3300005617 Ga0068859_100921605 Ga0068859_1009216052 148
70 3300005617 Ga0068859_101315938 Ga0068859_1013159381 148
71 3300005618 Ga0068864_100000017 Ga0068864_100000017216 148
72 3300005618 Ga0068864_101368992 Ga0068864_1013689922 148
73 3300005834 Ga0068851_10138990 Ga0068851_101389902 148
74 3300005841 Ga0068863_100000018 Ga0068863_100000018136 148
75 3300005842 Ga0068858_100510060 Ga0068858_1005100602 148
76 3300005842 Ga0068858_100690396 Ga0068858_1006903961 148
77 3300005842 Ga0068858_100744192 Ga0068858_1007441922 148
78 3300005844 Ga0068862_100000010 Ga0068862_10000001095 148
79 3300006931 Ga0097620_100921828 Ga0097620_1009218282 148
80 3300006931 Ga0097620_101316047 Ga0097620_1013160471 148
81 3300009011 Ga0105251_10002120 Ga0105251_1000212015 148
82 3300009093 Ga0105240_10048454 Ga0105240_100484542 148
83 3300009101 Ga0105247_10017958 Ga0105247_100179584 148
84 3300009174 Ga0105241_11092456 Ga0105241_110924561 148
85 3300009177 Ga0105248_10000001 Ga0105248_100000011461 148
86 3300009177 Ga0105248_10000128 Ga0105248_1000012895 148
87 3300009177 Ga0105248_10040998 Ga0105248_100409983 148
88 3300009551 Ga0105238_10343490 Ga0105238_103434902 148
89 3300009553 Ga0105249_10000726 Ga0105249_1000072611 148
90 3300009553 Ga0105249_10050288 Ga0105249_100502882 148
91 3300010375 Ga0105239_10899405 Ga0105239_108994053 148
92 3300013100 Ga0157373_10071537 Ga0157373_100715372 148
93 3300013100 Ga0157373_10159853 Ga0157373_101598532 148
94 3300013102 Ga0157371_10047584 Ga0157371_100475843 148
95 3300013102 Ga0157371_10417643 Ga0157371_104176432 148
96 3300013104 Ga0157370_10253538 Ga0157370_102535382 148
97 3300013105 Ga0157369_10519990 Ga0157369_105199902 148
98 3300013105 Ga0157369_10608173 Ga0157369_106081731 148
99 3300013306 Ga0163162_10178354 Ga0163162_101783542 148
100 3300013306 Ga0163162_10368792 Ga0163162_103687922 148
101 3300013307 Ga0157372_10097975 Ga0157372_100979752 148
102 3300013307 Ga0157372_11604680 Ga0157372_116046802 148
103 3300014325 Ga0163163_10167435 Ga0163163_101674353 148
104 3300014968 Ga0157379_10793029 Ga0157379_107930292 148
105 3300025315 Ga0207697_10008985 Ga0207697_100089855 148
106 3300025735 Ga0207713_1007194 Ga0207713_10071945 148
107 3300025900 Ga0207710_10006016 Ga0207710_100060164 148
108 3300025903 Ga0207680_10068884 Ga0207680_100688842 148
109 3300025903 Ga0207680_10280964 Ga0207680_102809642 148
110 3300025909 Ga0207705_10000929 Ga0207705_1000092919 148
111 3300025909 Ga0207705_10130140 Ga0207705_101301402 148
112 3300025909 Ga0207705_10454554 Ga0207705_104545541 148
113 3300025909 Ga0207705_11053464 Ga0207705_110534641 148
114 3300025913 Ga0207695_10252946 Ga0207695_102529462 148
115 3300025917 Ga0207660_10001261 Ga0207660_100012617 148
116 3300025917 Ga0207660_10003546 Ga0207660_100035462 148
117 3300025919 Ga0207657_10000498 Ga0207657_1000049815 148
118 3300025920 Ga0207649_10363633 Ga0207649_103636332 148
119 3300025921 Ga0207652_10317686 Ga0207652_103176863 148
120 3300025921 Ga0207652_10816591 Ga0207652_108165912 148
121 3300025923 Ga0207681_10050696 Ga0207681_100506962 148
122 3300025925 Ga0207650_10000057 Ga0207650_1000005774 148
123 3300025925 Ga0207650_10089450 Ga0207650_100894501 148
124 3300025926 Ga0207659_10007909 Ga0207659_100079093 148
125 3300025929 Ga0207664_11099302 Ga0207664_110993022 148
126 3300025931 Ga0207644_10414438 Ga0207644_104144381 148
127 3300025931 Ga0207644_10683645 Ga0207644_106836452 148
128 3300025932 Ga0207690_10239882 Ga0207690_102398823 148
129 3300025932 Ga0207690_10342534 Ga0207690_103425342 148
130 3300025933 Ga0207706_10018262 Ga0207706_100182624 148
131 3300025933 Ga0207706_11097938 Ga0207706_110979382 148
132 3300025937 Ga0207669_10088836 Ga0207669_100888362 148
133 3300025941 Ga0207711_10000001 Ga0207711_10000001413 148
134 3300025941 Ga0207711_10000031 Ga0207711_1000003195 148
135 3300025941 Ga0207711_10023655 Ga0207711_100236553 148
136 3300025945 Ga0207679_10020851 Ga0207679_100208515 148
137 3300025949 Ga0207667_10182383 Ga0207667_101823831 148
138 3300025960 Ga0207651_11544311 Ga0207651_115443112 148
139 3300025960 Ga0207651_11613997 Ga0207651_116139971 148
140 3300025961 Ga0207712_10000565 Ga0207712_1000056511 148
141 3300025972 Ga0207668_10190029 Ga0207668_101900292 148
142 3300025981 Ga0207640_10059457 Ga0207640_100594572 148
143 3300025986 Ga0207658_10001980 Ga0207658_1000198015 148
144 3300026035 Ga0207703_10453637 Ga0207703_104536372 148
145 3300026035 Ga0207703_10581202 Ga0207703_105812022 148
146 3300026041 Ga0207639_10132001 Ga0207639_101320014 148
147 3300026078 Ga0207702_10206833 Ga0207702_102068332 148
148 3300026078 Ga0207702_10268191 Ga0207702_102681912 148
149 3300026078 Ga0207702_11774366 Ga0207702_117743662 148
150 3300026088 Ga0207641_10000002 Ga0207641_10000002391 148
151 3300026089 Ga0207648_10927798 Ga0207648_109277982 148
152 3300026095 Ga0207676_10000005 Ga0207676_10000005417 148
153 3300026142 Ga0207698_10544437 Ga0207698_105444372 148
154 3300028379 Ga0268266_10137560 Ga0268266_101375602 148
155 3300028380 Ga0268265_10000003 Ga0268265_10000003599 148
156 3300028380 Ga0268265_10108157 Ga0268265_101081572 148
157 3300030733 Ga0314311_1257367 Ga0314311_12573675 148
158 3300031852 Ga0307410_10240230 Ga0307410_102402302 148
159 3300031995 Ga0307409_100868839 Ga0307409_1008688392 148
160 3300031995 Ga0307409_101165414 Ga0307409_1011654142 148
161 3300037312 Ga0395899_0054770 Ga0395899_0054770_1566_2012 148
162 3300037418 Ga0395900_0720829 Ga0395900_0720829_442_891 148
163 3300037466 Ga0395898_0086427 Ga0395898_0086427_1759_2205 148
164 3300037471 Ga0395905_0042384 Ga0395905_0042384_3736_4182 148
165 3300038443 Ga0395901_0039511 Ga0395901_0039511_1136_1582 148
166 3300038443 Ga0395901_0133526 Ga0395901_0133526_1496_1945 148
167 3300038443 Ga0395901_0137154 Ga0395901_0137154_172_621 148
168 3300041404 Ga0439436_0025434 Ga0439436_0025434_546_1004 148
169 3300041406 Ga0439439_0004329 Ga0439439_0004329_2076_2534 148
170 3300041410 Ga0439461_0004396 Ga0439461_0004396_414_872 148
171 3300041411 Ga0439466_0115760 Ga0439466_0115760_34_492 148
172 3300041413 Ga0439465_0002284 Ga0439465_0002284_3684_4142 148
173 3300041997 Ga0439431_0008890 Ga0439431_0008890_1093_1551 148
174 3300042006 Ga0439432_006593 Ga0439432_006593_2077_2535 148
175 3300042007 Ga0439449_0090101 Ga0439449_0090101_300_758 148
176 3300042010 Ga0439452_069280 Ga0439452_069280_194_652 148
177 3300042014 Ga0439457_004374 Ga0439457_004374_2865_3323 148
178 3300042015 Ga0439462_0015072 Ga0439462_0015072_317_775 148
179 3300042435 Ga0439434_0006247 Ga0439434_0006247_275_733 148
180 3300044656 Ga0466969_0240362 Ga0466969_0240362_310_756 148
181 3300045976 Ga0466967_0037476 Ga0466967_0037476_93_542 148
182 3300046513 Ga0495616_0046374 Ga0495616_0046374_540_995 148
183 3300046515 Ga0495620_0085668 Ga0495620_0085668_536_991 148
184 3300046525 Ga0495663_0183377 Ga0495663_0183377_89_544 148
185 3300046616 Ga0495668_0007206 Ga0495668_0007206_444_899 148
186 3300046616 Ga0495668_0018230 Ga0495668_0018230_1611_2066 148
187 3300046664 Ga0495659_0068923 Ga0495659_0068923_533_979 148
188 3300046684 Ga0495669_0004671 Ga0495669_0004671_3612_4067 148
189 3300046684 Ga0495669_0044364 Ga0495669_0044364_693_1148 148
190 3300046684 Ga0495669_0081168 Ga0495669_0081168_15_470 148
191 3300046691 Ga0495670_0439290 Ga0495670_0439290_118_564 148
192 3300048906 Ga0496103_0132074 Ga0496103_0132074_1007_1456 148
193 3300048909 Ga0496106_0300616 Ga0496106_0300616_826_1272 148
194 3300048910 Ga0496107_0604442 Ga0496107_0604442_69_515 148
195 3300048912 Ga0496109_0194149 Ga0496109_0194149_618_1064 148
196 3300048920 Ga0496117_0019656 Ga0496117_0019656_2208_2657 148
197 3300048921 Ga0496118_0000332 Ga0496118_0000332_11063_11512 148
198 3300049569 Ga0501032_0004180 Ga0501032_0004180_1608_2060 148
199 3300049571 Ga0501034_0236677 Ga0501034_0236677_426_878 148
200 3300049573 Ga0501037_0079623 Ga0501037_0079623_1853_2305 148
201 3300049574 Ga0501038_0151970 Ga0501038_0151970_781_1233 148
202 3300049579 Ga0501043_0003618 Ga0501043_0003618_9406_9858 148
203 3300049580 Ga0501046_0001373 Ga0501046_0001373_12311_12763 148
204 3300049822 Ga0501035_0125286 Ga0501035_0125286_174_626 148
205 3300053087 Ga0500643_000259 Ga0500643_000259_33108_33557 148
206 3300053134 Ga0500658_0000261 Ga0500658_0000261_6091_6549 148
207 3300061719 Ga0466962_0207400 Ga0466962_0207400_242_697 148
208 3300005536 Ga0070697_100624380 Ga0070697_1006243801 149
209 3300013104 Ga0157370_10290860 Ga0157370_102908602 149
210 3300025298 Ga0209050_1012797 Ga0209050_10127974 149
211 3300042876 Ga0451577_0511718 Ga0451577_0511718_51_509 149
212 3300044712 Ga0453684_0744285 Ga0453684_0744285_144_602 149
213 3300049588 Ga0501072_0276146 Ga0501072_0276146_451_915 149
214 3300049591 Ga0501075_1069000 Ga0501075_1069000_93_557 149
215 3300049741 Ga0501079_0396298 Ga0501079_0396298_113_577 149
216 3300049743 Ga0501081_0831067 Ga0501081_0831067_70_534 149
217 3300049824 Ga0501045_1370592 Ga0501045_1370592_13_477 149
218 3300053083 Ga0495655_0002753 Ga0495655_0002753_809_1327 149
219 3300035171 Ga0373946_0538017 Ga0373946_0538017_116_580 151
220 3300035725 Ga0373947_0221547 Ga0373947_0221547_389_853 151
221 3300046472 Ga0495580_0487962 Ga0495580_0487962_136_600 151
222 3300046683 Ga0495658_0054501 Ga0495658_0054501_230_694 151
223 3300005353 Ga0070669_100174740 Ga0070669_1001747403 152
224 3300005844 Ga0068862_100928146 Ga0068862_1009281462 152
225 3300009094 Ga0111539_11599036 Ga0111539_115990362 152
226 3300025923 Ga0207681_10213152 Ga0207681_102131522 152
227 3300028380 Ga0268265_10876130 Ga0268265_108761302 152
228 3300031824 Ga0307413_10001941 Ga0307413_100019417 152
229 3300031852 Ga0307410_10000937 Ga0307410_1000093720 152
230 3300031903 Ga0307407_10011250 Ga0307407_100112504 152
231 3300031995 Ga0307409_100026559 Ga0307409_1000265593 152
232 3300032004 Ga0307414_10004546 Ga0307414_100045468 152
233 3300032005 Ga0307411_11026642 Ga0307411_110266421 152
234 3300037471 Ga0395905_0031077 Ga0395905_0031077_1526_1993 152
235 3300046525 Ga0495663_0002011 Ga0495663_0002011_2193_2651 152
236 3300046537 Ga0495598_0132708 Ga0495598_0132708_345_803 152
237 3300046539 Ga0495621_0002203 Ga0495621_0002203_1112_1570 152
238 3300046539 Ga0495621_0004551 Ga0495621_0004551_2007_2465 152
239 3300046664 Ga0495659_0257592 Ga0495659_0257592_142_600 152
240 3300046691 Ga0495670_0280512 Ga0495670_0280512_61_519 152
241 3300047445 Ga0495677_0188625 Ga0495677_0188625_313_771 152
242 3300050511 nmdc:mga08y16_535553_c1 nmdc:mga08y16_535553_c1_43_501 152
243 3300021384 Ga0213876_10005598 Ga0213876_100055983 154
244 3300031911 Ga0307412_10012463 Ga0307412_100124634 154
245 3300032002 Ga0307416_100095943 Ga0307416_1000959433 154
246 3300032126 Ga0307415_100007081 Ga0307415_1000070812 154
247 3300039437 Ga0436365_0137032 Ga0436365_0137032_5011_5475 154
248 3300005577 Ga0068857_101580082 Ga0068857_1015800821 155
249 3300025904 Ga0207647_10003324 Ga0207647_100033249 157
250 3300001991 JGI24743J22301_10031591 JGI24743J22301_100315912 158
251 3300005327 Ga0070658_10003845 Ga0070658_1000384512 158
252 3300005328 Ga0070676_10016884 Ga0070676_100168844 158
253 3300005330 Ga0070690_100025929 Ga0070690_1000259292 158
254 3300005335 Ga0070666_10751899 Ga0070666_107518991 158
255 3300005338 Ga0068868_100303496 Ga0068868_1003034962 158
256 3300005339 Ga0070660_100038880 Ga0070660_1000388802 158
257 3300005355 Ga0070671_100013831 Ga0070671_10001383110 158
258 3300005364 Ga0070673_100020625 Ga0070673_1000206254 158
259 3300005366 Ga0070659_100001058 Ga0070659_1000010587 158
260 3300005366 Ga0070659_101154846 Ga0070659_1011548461 158
261 3300005367 Ga0070667_100042609 Ga0070667_1000426094 158
262 3300005457 Ga0070662_100173143 Ga0070662_1001731432 158
263 3300005459 Ga0068867_100368804 Ga0068867_1003688042 158
264 3300005466 Ga0070685_10492586 Ga0070685_104925861 158
265 3300005539 Ga0068853_100053054 Ga0068853_1000530543 158
266 3300005544 Ga0070686_100119413 Ga0070686_1001194132 158
267 3300005548 Ga0070665_102254487 Ga0070665_1022544871 158
268 3300005564 Ga0070664_100013519 Ga0070664_1000135194 158
269 3300005578 Ga0068854_101106074 Ga0068854_1011060742 158
270 3300005616 Ga0068852_100588840 Ga0068852_1005888402 158
271 3300005617 Ga0068859_100516916 Ga0068859_1005169162 158
272 3300005718 Ga0068866_10466516 Ga0068866_104665162 158
273 3300005842 Ga0068858_100008141 Ga0068858_1000081419 158
274 3300005843 Ga0068860_101433956 Ga0068860_1014339562 158
275 3300006881 Ga0068865_100560257 Ga0068865_1005602572 158
276 3300006931 Ga0097620_100516999 Ga0097620_1005169992 158
277 3300009098 Ga0105245_10011260 Ga0105245_100112604 158
278 3300009174 Ga0105241_12530976 Ga0105241_125309761 158
279 3300009177 Ga0105248_10391910 Ga0105248_103919102 158
280 3300013105 Ga0157369_11646847 Ga0157369_116468472 158
281 3300013297 Ga0157378_10240229 Ga0157378_102402292 158
282 3300014968 Ga0157379_10211568 Ga0157379_102115682 158
283 3300025907 Ga0207645_10162560 Ga0207645_101625602 158
284 3300025909 Ga0207705_10006704 Ga0207705_100067049 158
285 3300025919 Ga0207657_10002291 Ga0207657_100022917 158
286 3300025927 Ga0207687_10021225 Ga0207687_100212252 158
287 3300025931 Ga0207644_10144097 Ga0207644_101440972 158
288 3300025932 Ga0207690_10049447 Ga0207690_100494472 158
289 3300025932 Ga0207690_10773518 Ga0207690_107735182 158
290 3300025933 Ga0207706_10063866 Ga0207706_100638662 158
291 3300025941 Ga0207711_10003771 Ga0207711_100037714 158
292 3300025945 Ga0207679_10264197 Ga0207679_102641971 158
293 3300025981 Ga0207640_11071983 Ga0207640_110719831 158
294 3300025986 Ga0207658_10042081 Ga0207658_100420814 158
295 3300026023 Ga0207677_10018043 Ga0207677_100180432 158
296 3300026035 Ga0207703_10002473 Ga0207703_1000247312 158
297 3300026041 Ga0207639_10093361 Ga0207639_100933612 158
298 3300028379 Ga0268266_10816074 Ga0268266_108160741 158
299 3300044658 Ga0466972_0071209 Ga0466972_0071209_437_913 158
300 3300044901 Ga0466960_0067686 Ga0466960_0067686_876_1352 158
301 3300046684 Ga0495669_0029506 Ga0495669_0029506_58_534 158
302 3300048912 Ga0496109_0350366 Ga0496109_0350366_496_972 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

45

118

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9372 2 150
8awp-assembly1.cif.gz_A crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant 208 (v19i/r23h/m38i/i60f/c106q) 0.8937 1 118
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8874 41 119
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8873 41 122
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.8858 1 119
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9181 41 120 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.892 28 140 2.60.120.10
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8881 2 150 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8865 42 118 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8801 40 121 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q2YQ73-F1-model_v4 Cupin domain-containing protein 0.9945 1 121 GO:0005886
GO:0015171
AF-A0A4Q2YMQ0-F1-model_v4 Cupin domain-containing protein 0.985 1 126 GO:0046872
AF-A0A850SZD5-F1-model_v4 Cupin domain-containing protein 0.9791 1 119 GO:0046872
AF-A0A4U9HFH2-F1-model_v4 Uncharacterized conserved protein, contains double-stranded beta-helix domain 0.9773 38 117
AF-A0A2T6KQ38-F1-model_v4 Cupin domain-containing protein 0.9764 44 122 GO:0046872

Feature Viewer

pLDDT pTM Quality
91.64 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map