F396255
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 195 | 299 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300002459|JGI24751J29686_10006484|JGI24751J29686_100064843 |
| Length | 306 |
| Sequence | MAETGRLTAPAAPMVSQVILLTWEAVAASGLLFRDVVPSLIVIGRALVELLTEATYYWHLGVTAGEIGSALLIGGLAGLAVGIALGANPLLSRSFEAFLYYLGPTPKIIFFPVMIMWFGVGPGSKVAMGVLSCFFPVALSAAAGMRGIDKVLIRVGRSFRASTWQMVTKIYLPAMRMPILNGVRLGLGXXVALSAAAGMRGIDKVLIRVGRSFRASTWQMVTKIYLPAMRMPILNGVRLGLGVAIIGTLLAETKLSNRGLGFLIINAYSTFNMPRMYALLIVLFVLSIGVNALIGRLGGVDSRRTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 2 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 93 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 94 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 145 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 148 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 152 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 155 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 169 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 184 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 185 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 192 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 193 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 195 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0 |
| Isolates | 0.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.3 |
| Nodule | 0 |
| Rhizoplane | 5.3 |
| Rhizosphere | 88.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10014539 | 3300002077 | Bacteria | 1579 |
| 2 | JGI24751J29686_10006484 | 3300002459 | Bacteria | 2386 |
| 3 | Ga0070658_10117244 | 3300005327 | Bacteria | 2210 |
| 4 | Ga0070658_10117554 | 3300005327 | Bacteria | 2207 |
| 5 | Ga0070676_10251735 | 3300005328 | Bacteria | 1179 |
| 6 | Ga0070683_100039920 | 3300005329 | Bacteria | 4312 |
| 7 | Ga0070683_100198782 | 3300005329 | Bacteria | 1904 |
| 8 | Ga0070690_100028020 | 3300005330 | Bacteria | 3486 |
| 9 | Ga0070690_100283810 | 3300005330 | Bacteria | 1182 |
| 10 | Ga0070670_100034180 | 3300005331 | Bacteria | 4375 |
| 11 | Ga0070670_100107121 | 3300005331 | Bacteria | 2409 |
| 12 | Ga0070670_100527832 | 3300005331 | Bacteria | 1052 |
| 13 | Ga0070670_100708465 | 3300005331 | Bacteria | 905 |
| 14 | Ga0070677_10013350 | 3300005333 | Bacteria | 2871 |
| 15 | Ga0070666_10079847 | 3300005335 | Bacteria | 2235 |
| 16 | Ga0068868_100019650 | 3300005338 | Bacteria | 5065 |
| 17 | Ga0068868_100290949 | 3300005338 | Bacteria | 1385 |
| 18 | Ga0070660_100002008 | 3300005339 | Bacteria | 14027 |
| 19 | Ga0070660_100322698 | 3300005339 | Bacteria | 1269 |
| 20 | Ga0070689_100005467 | 3300005340 | Bacteria | 8681 |
| 21 | Ga0070689_100640370 | 3300005340 | Bacteria | 924 |
| 22 | Ga0070687_100039745 | 3300005343 | Bacteria | 2366 |
| 23 | Ga0070661_100003386 | 3300005344 | Bacteria | 10996 |
| 24 | Ga0070661_100074383 | 3300005344 | Bacteria | 2502 |
| 25 | Ga0070661_100338201 | 3300005344 | Bacteria | 1179 |
| 26 | Ga0070669_100184076 | 3300005353 | Bacteria | 1636 |
| 27 | Ga0070669_100542130 | 3300005353 | Bacteria | 969 |
| 28 | Ga0070675_100158809 | 3300005354 | Bacteria | 1943 |
| 29 | Ga0070675_100298648 | 3300005354 | Bacteria | 1418 |
| 30 | Ga0070671_100011555 | 3300005355 | Bacteria | 7102 |
| 31 | Ga0070671_100486304 | 3300005355 | Bacteria | 1061 |
| 32 | Ga0070671_100627197 | 3300005355 | Unclassified | 930 |
| 33 | Ga0070674_100173506 | 3300005356 | Bacteria | 1646 |
| 34 | Ga0070673_100521527 | 3300005364 | Bacteria | 1077 |
| 35 | Ga0070659_100004641 | 3300005366 | Bacteria | 9815 |
| 36 | Ga0070659_100031113 | 3300005366 | Bacteria | 4133 |
| 37 | Ga0070701_10212600 | 3300005438 | Bacteria | 1149 |
| 38 | Ga0070700_100097163 | 3300005441 | Bacteria | 1934 |
| 39 | Ga0070694_100178560 | 3300005444 | Bacteria | 1569 |
| 40 | Ga0070663_100102662 | 3300005455 | Bacteria | 2136 |
| 41 | Ga0070663_100329416 | 3300005455 | Bacteria | 1230 |
| 42 | Ga0070678_100033184 | 3300005456 | Bacteria | 3581 |
| 43 | Ga0070678_100218586 | 3300005456 | Unclassified | 1583 |
| 44 | Ga0070678_100253639 | 3300005456 | Bacteria | 1476 |
| 45 | Ga0070662_100000028 | 3300005457 | Bacteria | 83508 |
| 46 | Ga0070662_100143735 | 3300005457 | Bacteria | 1851 |
| 47 | Ga0068867_100099139 | 3300005459 | Bacteria | 2222 |
| 48 | Ga0068867_100118901 | 3300005459 | Bacteria | 2039 |
| 49 | Ga0068867_100556831 | 3300005459 | Bacteria | 994 |
| 50 | Ga0070685_10082035 | 3300005466 | Bacteria | 1934 |
| 51 | Ga0070707_100077215 | 3300005468 | Bacteria | 3213 |
| 52 | Ga0070698_100233306 | 3300005471 | Bacteria | 1773 |
| 53 | Ga0070699_100039487 | 3300005518 | Bacteria | 4086 |
| 54 | Ga0070679_100029491 | 3300005530 | Bacteria | 5413 |
| 55 | Ga0070679_100137875 | 3300005530 | Bacteria | 2421 |
| 56 | Ga0070697_100164553 | 3300005536 | Bacteria | 1875 |
| 57 | Ga0068853_100031484 | 3300005539 | Bacteria | 4486 |
| 58 | Ga0068853_100038566 | 3300005539 | Bacteria | 4070 |
| 59 | Ga0070672_100034392 | 3300005543 | Bacteria | 3846 |
| 60 | Ga0070686_100038405 | 3300005544 | Bacteria | 2976 |
| 61 | Ga0070686_100144838 | 3300005544 | Bacteria | 1658 |
| 62 | Ga0070665_100138227 | 3300005548 | Bacteria | 2439 |
| 63 | Ga0070665_100672225 | 3300005548 | Bacteria | 1049 |
| 64 | Ga0068855_100003756 | 3300005563 | Bacteria | 18559 |
| 65 | Ga0070664_100005823 | 3300005564 | Bacteria | 9942 |
| 66 | Ga0070664_100013715 | 3300005564 | Bacteria | 6604 |
| 67 | Ga0070664_100060815 | 3300005564 | Bacteria | 3218 |
| 68 | Ga0070664_100194846 | 3300005564 | Bacteria | 1806 |
| 69 | Ga0068857_100307084 | 3300005577 | Bacteria | 1463 |
| 70 | Ga0068857_100609285 | 3300005577 | Bacteria | 1033 |
| 71 | Ga0068854_100004450 | 3300005578 | Bacteria | 8837 |
| 72 | Ga0068856_100005723 | 3300005614 | Bacteria | 12245 |
| 73 | Ga0068856_100109201 | 3300005614 | Bacteria | 2762 |
| 74 | Ga0068856_100153156 | 3300005614 | Bacteria | 2315 |
| 75 | Ga0070702_100145991 | 3300005615 | Bacteria | 1513 |
| 76 | Ga0068852_100069518 | 3300005616 | Bacteria | 3087 |
| 77 | Ga0068852_100148699 | 3300005616 | Bacteria | 2176 |
| 78 | Ga0068864_100157015 | 3300005618 | Bacteria | 2065 |
| 79 | Ga0068864_100504041 | 3300005618 | Bacteria | 1165 |
| 80 | Ga0068861_100063039 | 3300005719 | Bacteria | 2849 |
| 81 | Ga0068861_100239743 | 3300005719 | Bacteria | 1542 |
| 82 | Ga0068851_10076729 | 3300005834 | Bacteria | 1738 |
| 83 | Ga0068870_10030116 | 3300005840 | Bacteria | 2741 |
| 84 | Ga0068870_10101950 | 3300005840 | Bacteria | 1624 |
| 85 | Ga0068863_100169349 | 3300005841 | Bacteria | 2094 |
| 86 | Ga0068863_100404983 | 3300005841 | Bacteria | 1335 |
| 87 | Ga0068858_100137124 | 3300005842 | Bacteria | 2296 |
| 88 | Ga0068862_100039456 | 3300005844 | Bacteria | 4010 |
| 89 | Ga0068862_100430831 | 3300005844 | Bacteria | 1239 |
| 90 | Ga0081538_10039370 | 3300005981 | Bacteria | 3033 |
| 91 | Ga0081540_1025535 | 3300005983 | Bacteria | 3396 |
| 92 | Ga0081540_1105998 | 3300005983 | Bacteria | 1199 |
| 93 | Ga0081539_10008490 | 3300005985 | Bacteria | 8923 |
| 94 | Ga0075365_10149920 | 3300006038 | Bacteria | 1622 |
| 95 | Ga0075363_100164463 | 3300006048 | Bacteria | 1257 |
| 96 | Ga0075364_10179695 | 3300006051 | Unclassified | 1431 |
| 97 | Ga0075362_10042772 | 3300006177 | Bacteria | 2004 |
| 98 | Ga0075366_10120011 | 3300006195 | Bacteria | 1584 |
| 99 | Ga0075366_10302325 | 3300006195 | Unclassified | 979 |
| 100 | Ga0068871_100115027 | 3300006358 | Bacteria | 2267 |
| 101 | Ga0068871_100374479 | 3300006358 | Bacteria | 1264 |
| 102 | Ga0075428_100268419 | 3300006844 | Bacteria | 1836 |
| 103 | Ga0075428_101029891 | 3300006844 | Bacteria | 871 |
| 104 | Ga0075430_100267907 | 3300006846 | Bacteria | 1414 |
| 105 | Ga0075431_100128797 | 3300006847 | Bacteria | 2612 |
| 106 | Ga0075431_100371132 | 3300006847 | Unclassified | 1436 |
| 107 | Ga0075429_100022580 | 3300006880 | Bacteria | 5455 |
| 108 | Ga0068865_100069017 | 3300006881 | Bacteria | 2500 |
| 109 | Ga0075436_100165504 | 3300006914 | Bacteria | 1560 |
| 110 | Ga0105240_10018218 | 3300009093 | Bacteria | 9439 |
| 111 | Ga0111539_10078244 | 3300009094 | Bacteria | 3891 |
| 112 | Ga0105245_10187765 | 3300009098 | Bacteria | 1978 |
| 113 | Ga0105245_10268435 | 3300009098 | Bacteria | 1663 |
| 114 | Ga0105243_10133615 | 3300009148 | Bacteria | 2108 |
| 115 | Ga0105241_10077808 | 3300009174 | Bacteria | 2590 |
| 116 | Ga0105242_10034192 | 3300009176 | Bacteria | 4075 |
| 117 | Ga0105242_10676352 | 3300009176 | Bacteria | 1007 |
| 118 | Ga0105248_10084236 | 3300009177 | Bacteria | 3576 |
| 119 | Ga0105248_10090543 | 3300009177 | Bacteria | 3445 |
| 120 | Ga0105237_10197089 | 3300009545 | Bacteria | 2014 |
| 121 | Ga0105238_10186258 | 3300009551 | Bacteria | 2052 |
| 122 | Ga0105249_10147993 | 3300009553 | Bacteria | 2258 |
| 123 | Ga0157373_10000984 | 3300013100 | Bacteria | 22034 |
| 124 | Ga0157371_10001860 | 3300013102 | Bacteria | 21168 |
| 125 | Ga0157371_10342788 | 3300013102 | Bacteria | 1087 |
| 126 | Ga0157370_10016819 | 3300013104 | Bacteria | 7394 |
| 127 | Ga0157369_10001142 | 3300013105 | Bacteria | 33120 |
| 128 | Ga0157369_10030029 | 3300013105 | Bacteria | 5998 |
| 129 | Ga0157369_10115347 | 3300013105 | Bacteria | 2852 |
| 130 | Ga0157374_10016749 | 3300013296 | Bacteria | 6449 |
| 131 | Ga0157374_10054895 | 3300013296 | Bacteria | 3717 |
| 132 | Ga0157378_10002036 | 3300013297 | Bacteria | 18105 |
| 133 | Ga0157378_10748420 | 3300013297 | Unclassified | 1000 |
| 134 | Ga0163162_10364736 | 3300013306 | Bacteria | 1577 |
| 135 | Ga0157372_10000433 | 3300013307 | Bacteria | 46142 |
| 136 | Ga0157372_10018596 | 3300013307 | Bacteria | 7474 |
| 137 | Ga0157372_10124558 | 3300013307 | Bacteria | 2962 |
| 138 | Ga0157372_10403056 | 3300013307 | Bacteria | 1594 |
| 139 | Ga0163163_10165197 | 3300014325 | Bacteria | 2260 |
| 140 | Ga0163163_10276256 | 3300014325 | Bacteria | 1731 |
| 141 | Ga0157377_10053734 | 3300014745 | Bacteria | 2279 |
| 142 | Ga0157379_10040688 | 3300014968 | Bacteria | 4149 |
| 143 | Ga0157379_10249171 | 3300014968 | Bacteria | 1612 |
| 144 | Ga0157376_10034786 | 3300014969 | Bacteria | 4071 |
| 145 | Ga0157376_10098068 | 3300014969 | Bacteria | 2554 |
| 146 | Ga0157376_10123521 | 3300014969 | Bacteria | 2298 |
| 147 | Ga0163161_10049131 | 3300017792 | Bacteria | 3048 |
| 148 | Ga0163161_10139158 | 3300017792 | Unclassified | 1837 |
| 149 | Ga0213876_10006426 | 3300021384 | Bacteria | 6410 |
| 150 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 151 | Ga0207666_1007422 | 3300025271 | Bacteria | 1444 |
| 152 | Ga0209758_1036663 | 3300025297 | Bacteria | 1909 |
| 153 | Ga0207697_10000341 | 3300025315 | Bacteria | 25964 |
| 154 | Ga0207656_10001951 | 3300025321 | Bacteria | 6857 |
| 155 | Ga0207656_10030297 | 3300025321 | Bacteria | 2234 |
| 156 | Ga0207682_10000162 | 3300025893 | Bacteria | 30380 |
| 157 | Ga0207688_10000957 | 3300025901 | Bacteria | 14672 |
| 158 | Ga0207688_10267357 | 3300025901 | Bacteria | 1039 |
| 159 | Ga0207647_10162172 | 3300025904 | Bacteria | 1304 |
| 160 | Ga0207645_10003016 | 3300025907 | Bacteria | 13006 |
| 161 | Ga0207645_10260947 | 3300025907 | Bacteria | 1148 |
| 162 | Ga0207643_10000330 | 3300025908 | Bacteria | 32431 |
| 163 | Ga0207643_10050560 | 3300025908 | Bacteria | 2357 |
| 164 | Ga0207695_10036491 | 3300025913 | Bacteria | 5314 |
| 165 | Ga0207657_10001368 | 3300025919 | Bacteria | 26012 |
| 166 | Ga0207657_10141352 | 3300025919 | Bacteria | 1966 |
| 167 | Ga0207649_10006746 | 3300025920 | Bacteria | 6236 |
| 168 | Ga0207649_10029593 | 3300025920 | Bacteria | 3235 |
| 169 | Ga0207649_10124717 | 3300025920 | Bacteria | 1741 |
| 170 | Ga0207646_10000871 | 3300025922 | Bacteria | 38971 |
| 171 | Ga0207681_10416227 | 3300025923 | Bacteria | 1088 |
| 172 | Ga0207650_10099833 | 3300025925 | Bacteria | 2232 |
| 173 | Ga0207650_10145472 | 3300025925 | Bacteria | 1866 |
| 174 | Ga0207650_10182412 | 3300025925 | Bacteria | 1673 |
| 175 | Ga0207659_10415839 | 3300025926 | Bacteria | 1127 |
| 176 | Ga0207644_10021514 | 3300025931 | Bacteria | 4394 |
| 177 | Ga0207644_10029335 | 3300025931 | Bacteria | 3816 |
| 178 | Ga0207644_10580196 | 3300025931 | Bacteria | 930 |
| 179 | Ga0207690_10002734 | 3300025932 | Bacteria | 10650 |
| 180 | Ga0207690_10054157 | 3300025932 | Bacteria | 2696 |
| 181 | Ga0207690_10095327 | 3300025932 | Bacteria | 2113 |
| 182 | Ga0207706_10001562 | 3300025933 | Bacteria | 22713 |
| 183 | Ga0207706_10016573 | 3300025933 | Bacteria | 6652 |
| 184 | Ga0207706_10069716 | 3300025933 | Bacteria | 3092 |
| 185 | Ga0207686_10054268 | 3300025934 | Bacteria | 2510 |
| 186 | Ga0207709_10374697 | 3300025935 | Bacteria | 1081 |
| 187 | Ga0207670_10317839 | 3300025936 | Bacteria | 1224 |
| 188 | Ga0207669_10036707 | 3300025937 | Bacteria | 2804 |
| 189 | Ga0207669_10156326 | 3300025937 | Bacteria | 1604 |
| 190 | Ga0207691_10011501 | 3300025940 | Bacteria | 8493 |
| 191 | Ga0207691_10287639 | 3300025940 | Bacteria | 1414 |
| 192 | Ga0207711_10046686 | 3300025941 | Bacteria | 3701 |
| 193 | Ga0207711_10150118 | 3300025941 | Bacteria | 2102 |
| 194 | Ga0207689_10003140 | 3300025942 | Bacteria | 15164 |
| 195 | Ga0207689_10177620 | 3300025942 | Bacteria | 1756 |
| 196 | Ga0207661_10176197 | 3300025944 | Bacteria | 1864 |
| 197 | Ga0207679_10015009 | 3300025945 | Bacteria | 5106 |
| 198 | Ga0207679_10101209 | 3300025945 | Bacteria | 2254 |
| 199 | Ga0207679_10142185 | 3300025945 | Bacteria | 1941 |
| 200 | Ga0207667_10012759 | 3300025949 | Bacteria | 9649 |
| 201 | Ga0207651_10028683 | 3300025960 | Bacteria | 3515 |
| 202 | Ga0207651_10253042 | 3300025960 | Bacteria | 1442 |
| 203 | Ga0207712_10186630 | 3300025961 | Bacteria | 1633 |
| 204 | Ga0207668_10105587 | 3300025972 | Bacteria | 2103 |
| 205 | Ga0207640_10041304 | 3300025981 | Bacteria | 2933 |
| 206 | Ga0207640_10079551 | 3300025981 | Bacteria | 2235 |
| 207 | Ga0207658_10536824 | 3300025986 | Unclassified | 1045 |
| 208 | Ga0207677_10192757 | 3300026023 | Bacteria | 1613 |
| 209 | Ga0207639_10067273 | 3300026041 | Bacteria | 2787 |
| 210 | Ga0207639_10087806 | 3300026041 | Bacteria | 2480 |
| 211 | Ga0207678_10000463 | 3300026067 | Bacteria | 36837 |
| 212 | Ga0207678_10002064 | 3300026067 | Bacteria | 18221 |
| 213 | Ga0207678_10253373 | 3300026067 | Bacteria | 1508 |
| 214 | Ga0207708_10000744 | 3300026075 | Bacteria | 24435 |
| 215 | Ga0207702_10150906 | 3300026078 | Bacteria | 2114 |
| 216 | Ga0207641_10047158 | 3300026088 | Bacteria | 3633 |
| 217 | Ga0207641_10511964 | 3300026088 | Bacteria | 1167 |
| 218 | Ga0207648_10021480 | 3300026089 | Bacteria | 5801 |
| 219 | Ga0207648_10483312 | 3300026089 | Bacteria | 1131 |
| 220 | Ga0207648_10498843 | 3300026089 | Bacteria | 1114 |
| 221 | Ga0207674_10110565 | 3300026116 | Bacteria | 2723 |
| 222 | Ga0207675_100002013 | 3300026118 | Bacteria | 20272 |
| 223 | Ga0207675_100160909 | 3300026118 | Bacteria | 2141 |
| 224 | Ga0207675_100347369 | 3300026118 | Unclassified | 1453 |
| 225 | Ga0207683_10006988 | 3300026121 | Bacteria | 9677 |
| 226 | Ga0207683_10135152 | 3300026121 | Bacteria | 2220 |
| 227 | Ga0207683_10198192 | 3300026121 | Bacteria | 1825 |
| 228 | Ga0207683_10233367 | 3300026121 | Bacteria | 1678 |
| 229 | Ga0207698_10006753 | 3300026142 | Bacteria | 7168 |
| 230 | Ga0207698_10064401 | 3300026142 | Bacteria | 2873 |
| 231 | Ga0207698_10069474 | 3300026142 | Bacteria | 2786 |
| 232 | Ga0207698_10238616 | 3300026142 | Bacteria | 1655 |
| 233 | Ga0209969_1006246 | 3300027360 | Bacteria | 1677 |
| 234 | Ga0209971_1004257 | 3300027682 | Bacteria | 3398 |
| 235 | Ga0209966_1011003 | 3300027695 | Bacteria | 1642 |
| 236 | Ga0209974_10013851 | 3300027876 | Bacteria | 2687 |
| 237 | Ga0268266_10055783 | 3300028379 | Bacteria | 3397 |
| 238 | Ga0268266_10484534 | 3300028379 | Unclassified | 1179 |
| 239 | Ga0307508_10008048 | 3300031616 | Bacteria | 9772 |
| 240 | Ga0265314_10129466 | 3300031711 | Bacteria | 1577 |
| 241 | Ga0373935_0236940 | 3300035692 | Bacteria | 1273 |
| 242 | Ga0373927_0115271 | 3300035695 | Bacteria | 1752 |
| 243 | Ga0373927_0133342 | 3300035695 | Bacteria | 1623 |
| 244 | Ga0373947_0024441 | 3300035725 | Bacteria | 3521 |
| 245 | Ga0373937_0038814 | 3300036401 | Bacteria | 4339 |
| 246 | Ga0373937_0208983 | 3300036401 | Bacteria | 1836 |
| 247 | Ga0373925_0023077 | 3300037068 | Bacteria | 4540 |
| 248 | Ga0395900_0215744 | 3300037418 | Bacteria | 1936 |
| 249 | Ga0395898_0075862 | 3300037466 | Bacteria | 3247 |
| 250 | Ga0395901_0114405 | 3300038443 | Bacteria | 2834 |
| 251 | Ga0436363_1104748 | 3300039450 | Bacteria | 1605 |
| 252 | Ga0495632_0091263 | 3300046519 | Bacteria | 1444 |
| 253 | Ga0495621_0024845 | 3300046539 | Bacteria | 2006 |
| 254 | Ga0495684_0402305 | 3300047471 | Unclassified | 961 |
| 255 | Ga0496100_0242478 | 3300048903 | Bacteria | 1330 |
| 256 | Ga0496101_0163506 | 3300048904 | Bacteria | 1708 |
| 257 | Ga0496101_0171451 | 3300048904 | Bacteria | 1668 |
| 258 | Ga0496103_0028419 | 3300048906 | Bacteria | 3393 |
| 259 | Ga0496104_0075650 | 3300048907 | Bacteria | 3206 |
| 260 | Ga0496105_0163925 | 3300048908 | Bacteria | 1824 |
| 261 | Ga0496106_0040658 | 3300048909 | Bacteria | 3483 |
| 262 | Ga0496107_0034322 | 3300048910 | Bacteria | 3634 |
| 263 | Ga0496108_0066825 | 3300048911 | Bacteria | 3032 |
| 264 | Ga0496108_0538823 | 3300048911 | Bacteria | 1019 |
| 265 | Ga0496109_0196434 | 3300048912 | Bacteria | 1896 |
| 266 | Ga0496110_0086102 | 3300048913 | Bacteria | 2805 |
| 267 | Ga0496111_0063118 | 3300048914 | Bacteria | 2687 |
| 268 | Ga0496113_0363544 | 3300048916 | Bacteria | 1161 |
| 269 | Ga0496114_0143409 | 3300048917 | Bacteria | 2069 |
| 270 | Ga0496114_0354970 | 3300048917 | Bacteria | 1297 |
| 271 | Ga0501031_0027882 | 3300049568 | Bacteria | 3681 |
| 272 | Ga0501034_0383631 | 3300049571 | Bacteria | 1330 |
| 273 | Ga0501036_0033208 | 3300049572 | Bacteria | 4364 |
| 274 | Ga0501039_0513924 | 3300049575 | Bacteria | 940 |
| 275 | Ga0501040_0058748 | 3300049576 | Bacteria | 2642 |
| 276 | Ga0501041_0024625 | 3300049577 | Bacteria | 3613 |
| 277 | Ga0501042_0016874 | 3300049578 | Bacteria | 5024 |
| 278 | Ga0501046_0010778 | 3300049580 | Bacteria | 7839 |
| 279 | Ga0501075_0565074 | 3300049591 | Bacteria | 868 |
| 280 | Ga0501076_0157114 | 3300049592 | Bacteria | 1852 |
| 281 | Ga0501076_0162857 | 3300049592 | Bacteria | 1818 |
| 282 | Ga0501079_0111275 | 3300049741 | Bacteria | 2128 |
| 283 | Ga0501045_0073784 | 3300049824 | Bacteria | 2513 |
| 284 | nmdc:mga06z11_10848_c1 | 3300050494 | Bacteria | 3901 |
| 285 | nmdc:mga04h51_126916_c1 | 3300050495 | Bacteria | 956 |
| 286 | nmdc:mga04h51_42349_c1 | 3300050495 | Bacteria | 1493 |
| 287 | nmdc:mga09592_25437_c1 | 3300050508 | Bacteria | 4899 |
| 288 | nmdc:mga06r32_18139_c1 | 3300050510 | Bacteria | 6438 |
| 289 | nmdc:mga06r32_437455_c1 | 3300050510 | Unclassified | 1288 |
| 290 | nmdc:mga06r32_498527_c1 | 3300050510 | Bacteria | 1195 |
| 291 | nmdc:mga08y16_35749_c1 | 3300050511 | Bacteria | 5217 |
| 292 | nmdc:mga0n895_404710_c1 | 3300050512 | Bacteria | 1380 |
| 293 | nmdc:mga08x19_102848_c1 | 3300050514 | Bacteria | 1897 |
| 294 | nmdc:mga0a205_387479_c1 | 3300050515 | Bacteria | 1262 |
| 295 | Ga0500652_000003 | 3300053131 | Bacteria | 221528 |
| 296 | Ga0500616_0000072 | 3300053153 | Bacteria | 231471 |
| 297 | Ga0500616_0060015 | 3300053153 | Bacteria | 1973 |
| 298 | Ga0501082_0203643 | 3300060353 | Bacteria | 1722 |
| 299 | Ga0530510_0042668 | 3300061734 | Bacteria | 3277 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025901 | Ga0207688_10267357 | Ga0207688_102673572 | 215 |
| 2 | 3300050495 | nmdc:mga04h51_126916_c1 | nmdc:mga04h51_126916_c1_204_944 | 224 |
| 3 | 3300026118 | Ga0207675_100160909 | Ga0207675_1001609093 | 228 |
| 4 | 3300050515 | nmdc:mga0a205_387479_c1 | nmdc:mga0a205_387479_c1_175_897 | 231 |
| 5 | 3300035695 | Ga0373927_0115271 | Ga0373927_0115271_136_903 | 232 |
| 6 | 3300049571 | Ga0501034_0383631 | Ga0501034_0383631_144_866 | 232 |
| 7 | 3300014968 | Ga0157379_10249171 | Ga0157379_102491712 | 233 |
| 8 | 3300005340 | Ga0070689_100640370 | Ga0070689_1006403702 | 235 |
| 9 | 3300005719 | Ga0068861_100239743 | Ga0068861_1002397431 | 235 |
| 10 | 3300009098 | Ga0105245_10187765 | Ga0105245_101877651 | 235 |
| 11 | 3300036401 | Ga0373937_0208983 | Ga0373937_0208983_855_1595 | 235 |
| 12 | 3300005354 | Ga0070675_100158809 | Ga0070675_1001588091 | 236 |
| 13 | 3300013307 | Ga0157372_10403056 | Ga0157372_104030562 | 237 |
| 14 | 3300048911 | Ga0496108_0538823 | Ga0496108_0538823_41_793 | 237 |
| 15 | 3300005335 | Ga0070666_10079847 | Ga0070666_100798472 | 239 |
| 16 | 3300013306 | Ga0163162_10364736 | Ga0163162_103647362 | 239 |
| 17 | 3300035695 | Ga0373927_0133342 | Ga0373927_0133342_691_1434 | 239 |
| 18 | 3300035725 | Ga0373947_0024441 | Ga0373947_0024441_1654_2397 | 239 |
| 19 | 3300036401 | Ga0373937_0038814 | Ga0373937_0038814_2778_3521 | 239 |
| 20 | 3300037068 | Ga0373925_0023077 | Ga0373925_0023077_1837_2580 | 239 |
| 21 | 3300047471 | Ga0495684_0402305 | Ga0495684_0402305_132_875 | 239 |
| 22 | 3300048917 | Ga0496114_0354970 | Ga0496114_0354970_24_767 | 239 |
| 23 | 3300009174 | Ga0105241_10077808 | Ga0105241_100778083 | 241 |
| 24 | 3300009551 | Ga0105238_10186258 | Ga0105238_101862583 | 241 |
| 25 | 3300005330 | Ga0070690_100283810 | Ga0070690_1002838102 | 243 |
| 26 | 3300005353 | Ga0070669_100184076 | Ga0070669_1001840762 | 243 |
| 27 | 3300005444 | Ga0070694_100178560 | Ga0070694_1001785602 | 243 |
| 28 | 3300005456 | Ga0070678_100033184 | Ga0070678_1000331842 | 243 |
| 29 | 3300005459 | Ga0068867_100118901 | Ga0068867_1001189012 | 243 |
| 30 | 3300005543 | Ga0070672_100034392 | Ga0070672_1000343924 | 243 |
| 31 | 3300005544 | Ga0070686_100144838 | Ga0070686_1001448382 | 243 |
| 32 | 3300005840 | Ga0068870_10101950 | Ga0068870_101019502 | 243 |
| 33 | 3300005841 | Ga0068863_100404983 | Ga0068863_1004049832 | 243 |
| 34 | 3300005844 | Ga0068862_100430831 | Ga0068862_1004308311 | 243 |
| 35 | 3300006358 | Ga0068871_100374479 | Ga0068871_1003744792 | 243 |
| 36 | 3300009148 | Ga0105243_10133615 | Ga0105243_101336153 | 243 |
| 37 | 3300009177 | Ga0105248_10090543 | Ga0105248_100905433 | 243 |
| 38 | 3300013297 | Ga0157378_10748420 | Ga0157378_107484202 | 243 |
| 39 | 3300014969 | Ga0157376_10123521 | Ga0157376_101235213 | 243 |
| 40 | 3300025908 | Ga0207643_10050560 | Ga0207643_100505602 | 243 |
| 41 | 3300025937 | Ga0207669_10036707 | Ga0207669_100367072 | 243 |
| 42 | 3300025940 | Ga0207691_10011501 | Ga0207691_100115016 | 243 |
| 43 | 3300025942 | Ga0207689_10177620 | Ga0207689_101776202 | 243 |
| 44 | 3300025960 | Ga0207651_10253042 | Ga0207651_102530422 | 243 |
| 45 | 3300025972 | Ga0207668_10105587 | Ga0207668_101055873 | 243 |
| 46 | 3300026088 | Ga0207641_10047158 | Ga0207641_100471583 | 243 |
| 47 | 3300026089 | Ga0207648_10021480 | Ga0207648_100214803 | 243 |
| 48 | 3300026118 | Ga0207675_100347369 | Ga0207675_1003473692 | 243 |
| 49 | 3300026121 | Ga0207683_10006988 | Ga0207683_100069887 | 243 |
| 50 | 3300049591 | Ga0501075_0565074 | Ga0501075_0565074_98_853 | 243 |
| 51 | 3300053153 | Ga0500616_0060015 | Ga0500616_0060015_680_1453 | 243 |
| 52 | 3300002459 | JGI24751J29686_10006484 | JGI24751J29686_100064843 | 244 |
| 53 | 3300006847 | Ga0075431_100371132 | Ga0075431_1003711322 | 244 |
| 54 | 3300027695 | Ga0209966_1011003 | Ga0209966_10110032 | 244 |
| 55 | 3300027876 | Ga0209974_10013851 | Ga0209974_100138513 | 244 |
| 56 | 3300049575 | Ga0501039_0513924 | Ga0501039_0513924_80_856 | 244 |
| 57 | 3300050510 | nmdc:mga06r32_437455_c1 | nmdc:mga06r32_437455_c1_470_1246 | 244 |
| 58 | 3300061734 | Ga0530510_0042668 | Ga0530510_0042668_1552_2328 | 244 |
| 59 | 3300005614 | Ga0068856_100109201 | Ga0068856_1001092014 | 245 |
| 60 | 3300025940 | Ga0207691_10287639 | Ga0207691_102876392 | 245 |
| 61 | iso_pu_bacteria | 8005314921 | 8005316007 | 245 |
| 62 | 3300005331 | Ga0070670_100034180 | Ga0070670_1000341803 | 246 |
| 63 | 3300005356 | Ga0070674_100173506 | Ga0070674_1001735063 | 246 |
| 64 | 3300005456 | Ga0070678_100218586 | Ga0070678_1002185863 | 246 |
| 65 | 3300005459 | Ga0068867_100556831 | Ga0068867_1005568312 | 246 |
| 66 | 3300005548 | Ga0070665_100138227 | Ga0070665_1001382272 | 246 |
| 67 | 3300005841 | Ga0068863_100169349 | Ga0068863_1001693492 | 246 |
| 68 | 3300005981 | Ga0081538_10039370 | Ga0081538_100393702 | 246 |
| 69 | 3300005983 | Ga0081540_1105998 | Ga0081540_11059982 | 246 |
| 70 | 3300009177 | Ga0105248_10084236 | Ga0105248_100842363 | 246 |
| 71 | 3300014325 | Ga0163163_10276256 | Ga0163163_102762562 | 246 |
| 72 | 3300014969 | Ga0157376_10034786 | Ga0157376_100347862 | 246 |
| 73 | 3300025926 | Ga0207659_10415839 | Ga0207659_104158391 | 246 |
| 74 | 3300025937 | Ga0207669_10156326 | Ga0207669_101563262 | 246 |
| 75 | 3300025986 | Ga0207658_10536824 | Ga0207658_105368242 | 246 |
| 76 | 3300026089 | Ga0207648_10483312 | Ga0207648_104833122 | 246 |
| 77 | 3300026121 | Ga0207683_10233367 | Ga0207683_102333672 | 246 |
| 78 | 3300021384 | Ga0213876_10006426 | Ga0213876_100064263 | 247 |
| 79 | 3300005455 | Ga0070663_100329416 | Ga0070663_1003294162 | 248 |
| 80 | 3300013102 | Ga0157371_10342788 | Ga0157371_103427882 | 248 |
| 81 | 3300025297 | Ga0209758_1036663 | Ga0209758_10366632 | 248 |
| 82 | 3300026067 | Ga0207678_10253373 | Ga0207678_102533732 | 248 |
| 83 | 3300037418 | Ga0395900_0215744 | Ga0395900_0215744_862_1641 | 248 |
| 84 | 3300037466 | Ga0395898_0075862 | Ga0395898_0075862_1267_2046 | 248 |
| 85 | 3300038443 | Ga0395901_0114405 | Ga0395901_0114405_1401_2180 | 248 |
| 86 | iso_pu_bacteria | 2775507049 | 2776911770 | 248 |
| 87 | 3300005355 | Ga0070671_100011555 | Ga0070671_1000115554 | 249 |
| 88 | 3300005457 | Ga0070662_100143735 | Ga0070662_1001437352 | 249 |
| 89 | 3300006844 | Ga0075428_100268419 | Ga0075428_1002684191 | 249 |
| 90 | 3300006846 | Ga0075430_100267907 | Ga0075430_1002679071 | 249 |
| 91 | 3300006880 | Ga0075429_100022580 | Ga0075429_1000225805 | 249 |
| 92 | 3300009098 | Ga0105245_10268435 | Ga0105245_102684352 | 249 |
| 93 | 3300013297 | Ga0157378_10002036 | Ga0157378_1000203614 | 249 |
| 94 | 3300017792 | Ga0163161_10139158 | Ga0163161_101391582 | 249 |
| 95 | 3300025933 | Ga0207706_10016573 | Ga0207706_100165735 | 249 |
| 96 | 3300026088 | Ga0207641_10511964 | Ga0207641_105119642 | 249 |
| 97 | 3300031616 | Ga0307508_10008048 | Ga0307508_100080488 | 249 |
| 98 | 3300050508 | nmdc:mga09592_25437_c1 | nmdc:mga09592_25437_c1_3489_4283 | 249 |
| 99 | 3300050510 | nmdc:mga06r32_18139_c1 | nmdc:mga06r32_18139_c1_4879_5673 | 249 |
| 100 | 3300005468 | Ga0070707_100077215 | Ga0070707_1000772152 | 250 |
| 101 | 3300005471 | Ga0070698_100233306 | Ga0070698_1002333062 | 250 |
| 102 | 3300005518 | Ga0070699_100039487 | Ga0070699_1000394874 | 250 |
| 103 | 3300005536 | Ga0070697_100164553 | Ga0070697_1001645533 | 250 |
| 104 | 3300006844 | Ga0075428_101029891 | Ga0075428_1010298912 | 250 |
| 105 | 3300025922 | Ga0207646_10000871 | Ga0207646_1000087117 | 250 |
| 106 | 3300050512 | nmdc:mga0n895_404710_c1 | nmdc:mga0n895_404710_c1_347_1126 | 250 |
| 107 | 3300005327 | Ga0070658_10117244 | Ga0070658_101172441 | 252 |
| 108 | 3300006038 | Ga0075365_10149920 | Ga0075365_101499202 | 252 |
| 109 | 3300006048 | Ga0075363_100164463 | Ga0075363_1001644632 | 252 |
| 110 | 3300006051 | Ga0075364_10179695 | Ga0075364_101796952 | 252 |
| 111 | 3300006177 | Ga0075362_10042772 | Ga0075362_100427722 | 252 |
| 112 | 3300006195 | Ga0075366_10120011 | Ga0075366_101200112 | 252 |
| 113 | 3300014325 | Ga0163163_10165197 | Ga0163163_101651972 | 252 |
| 114 | 3300027360 | Ga0209969_1006246 | Ga0209969_10062463 | 252 |
| 115 | 3300027682 | Ga0209971_1004257 | Ga0209971_10042574 | 252 |
| 116 | 3300031711 | Ga0265314_10129466 | Ga0265314_101294662 | 252 |
| 117 | 3300050495 | nmdc:mga04h51_42349_c1 | nmdc:mga04h51_42349_c1_138_962 | 252 |
| 118 | iso_pu_bacteria | 2510917026 | 2511174088 | 252 |
| 119 | 3300005331 | Ga0070670_100527832 | Ga0070670_1005278322 | 253 |
| 120 | 3300005344 | Ga0070661_100074383 | Ga0070661_1000743833 | 253 |
| 121 | 3300005354 | Ga0070675_100298648 | Ga0070675_1002986482 | 253 |
| 122 | 3300005564 | Ga0070664_100060815 | Ga0070664_1000608152 | 253 |
| 123 | 3300005577 | Ga0068857_100307084 | Ga0068857_1003070842 | 253 |
| 124 | 3300006195 | Ga0075366_10302325 | Ga0075366_103023252 | 253 |
| 125 | 3300025941 | Ga0207711_10046686 | Ga0207711_100466865 | 253 |
| 126 | 3300025945 | Ga0207679_10101209 | Ga0207679_101012092 | 253 |
| 127 | 3300028379 | Ga0268266_10484534 | Ga0268266_104845343 | 253 |
| 128 | 3300049568 | Ga0501031_0027882 | Ga0501031_0027882_1997_2782 | 253 |
| 129 | 3300049572 | Ga0501036_0033208 | Ga0501036_0033208_2629_3414 | 253 |
| 130 | 3300049576 | Ga0501040_0058748 | Ga0501040_0058748_319_1104 | 253 |
| 131 | 3300049577 | Ga0501041_0024625 | Ga0501041_0024625_981_1766 | 253 |
| 132 | 3300049578 | Ga0501042_0016874 | Ga0501042_0016874_631_1416 | 253 |
| 133 | 3300049580 | Ga0501046_0010778 | Ga0501046_0010778_690_1475 | 253 |
| 134 | 3300049592 | Ga0501076_0162857 | Ga0501076_0162857_356_1141 | 253 |
| 135 | 3300049741 | Ga0501079_0111275 | Ga0501079_0111275_1146_1931 | 253 |
| 136 | 3300049824 | Ga0501045_0073784 | Ga0501045_0073784_1191_1976 | 253 |
| 137 | 3300050494 | nmdc:mga06z11_10848_c1 | nmdc:mga06z11_10848_c1_2635_3441 | 253 |
| 138 | 3300060353 | Ga0501082_0203643 | Ga0501082_0203643_142_927 | 253 |
| 139 | 3300005329 | Ga0070683_100198782 | Ga0070683_1001987822 | 254 |
| 140 | 3300005355 | Ga0070671_100627197 | Ga0070671_1006271971 | 254 |
| 141 | 3300009093 | Ga0105240_10018218 | Ga0105240_100182183 | 254 |
| 142 | 3300009176 | Ga0105242_10034192 | Ga0105242_100341925 | 254 |
| 143 | 3300009545 | Ga0105237_10197089 | Ga0105237_101970892 | 254 |
| 144 | 3300021388 | Ga0213875_10000007 | Ga0213875_1000000744 | 254 |
| 145 | 3300025913 | Ga0207695_10036491 | Ga0207695_100364913 | 254 |
| 146 | 3300025931 | Ga0207644_10580196 | Ga0207644_105801961 | 254 |
| 147 | 3300025934 | Ga0207686_10054268 | Ga0207686_100542683 | 254 |
| 148 | 3300026041 | Ga0207639_10067273 | Ga0207639_100672733 | 254 |
| 149 | 3300006847 | Ga0075431_100128797 | Ga0075431_1001287972 | 255 |
| 150 | 3300049592 | Ga0501076_0157114 | Ga0501076_0157114_978_1772 | 255 |
| 151 | 3300005530 | Ga0070679_100137875 | Ga0070679_1001378752 | 256 |
| 152 | 3300005983 | Ga0081540_1025535 | Ga0081540_10255352 | 256 |
| 153 | 3300005985 | Ga0081539_10008490 | Ga0081539_100084903 | 256 |
| 154 | 3300006914 | Ga0075436_100165504 | Ga0075436_1001655041 | 256 |
| 155 | 3300035692 | Ga0373935_0236940 | Ga0373935_0236940_198_998 | 256 |
| 156 | 3300050510 | nmdc:mga06r32_498527_c1 | nmdc:mga06r32_498527_c1_160_954 | 256 |
| 157 | 3300050514 | nmdc:mga08x19_102848_c1 | nmdc:mga08x19_102848_c1_112_906 | 256 |
| 158 | 3300053153 | Ga0500616_0000072 | Ga0500616_0000072_4688_5512 | 256 |
| 159 | 3300005328 | Ga0070676_10251735 | Ga0070676_102517352 | 257 |
| 160 | 3300005339 | Ga0070660_100002008 | Ga0070660_1000020089 | 257 |
| 161 | 3300005353 | Ga0070669_100542130 | Ga0070669_1005421301 | 257 |
| 162 | 3300005366 | Ga0070659_100004641 | Ga0070659_1000046415 | 257 |
| 163 | 3300005456 | Ga0070678_100253639 | Ga0070678_1002536392 | 257 |
| 164 | 3300005457 | Ga0070662_100000028 | Ga0070662_10000002824 | 257 |
| 165 | 3300005539 | Ga0068853_100031484 | Ga0068853_1000314843 | 257 |
| 166 | 3300005563 | Ga0068855_100003756 | Ga0068855_10000375610 | 257 |
| 167 | 3300005564 | Ga0070664_100005823 | Ga0070664_1000058237 | 257 |
| 168 | 3300005614 | Ga0068856_100005723 | Ga0068856_1000057235 | 257 |
| 169 | 3300005616 | Ga0068852_100148699 | Ga0068852_1001486993 | 257 |
| 170 | 3300005618 | Ga0068864_100504041 | Ga0068864_1005040411 | 257 |
| 171 | 3300013100 | Ga0157373_10000984 | Ga0157373_1000098413 | 257 |
| 172 | 3300013102 | Ga0157371_10001860 | Ga0157371_1000186011 | 257 |
| 173 | 3300013105 | Ga0157369_10115347 | Ga0157369_101153472 | 257 |
| 174 | 3300013307 | Ga0157372_10000433 | Ga0157372_1000043337 | 257 |
| 175 | 3300025907 | Ga0207645_10260947 | Ga0207645_102609472 | 257 |
| 176 | 3300025919 | Ga0207657_10001368 | Ga0207657_1000136829 | 257 |
| 177 | 3300025920 | Ga0207649_10006746 | Ga0207649_100067462 | 257 |
| 178 | 3300025923 | Ga0207681_10416227 | Ga0207681_104162272 | 257 |
| 179 | 3300025931 | Ga0207644_10029335 | Ga0207644_100293352 | 257 |
| 180 | 3300025932 | Ga0207690_10002734 | Ga0207690_1000273411 | 257 |
| 181 | 3300025933 | Ga0207706_10001562 | Ga0207706_1000156211 | 257 |
| 182 | 3300025945 | Ga0207679_10015009 | Ga0207679_100150094 | 257 |
| 183 | 3300025949 | Ga0207667_10012759 | Ga0207667_100127595 | 257 |
| 184 | 3300025960 | Ga0207651_10028683 | Ga0207651_100286832 | 257 |
| 185 | 3300025981 | Ga0207640_10041304 | Ga0207640_100413043 | 257 |
| 186 | 3300026041 | Ga0207639_10087806 | Ga0207639_100878063 | 257 |
| 187 | 3300026067 | Ga0207678_10002064 | Ga0207678_100020645 | 257 |
| 188 | 3300026121 | Ga0207683_10135152 | Ga0207683_101351523 | 257 |
| 189 | 3300026142 | Ga0207698_10006753 | Ga0207698_100067534 | 257 |
| 190 | 3300048904 | Ga0496101_0171451 | Ga0496101_0171451_361_1164 | 257 |
| 191 | 3300048906 | Ga0496103_0028419 | Ga0496103_0028419_2146_2949 | 257 |
| 192 | 3300048910 | Ga0496107_0034322 | Ga0496107_0034322_1068_1871 | 257 |
| 193 | 3300026089 | Ga0207648_10498843 | Ga0207648_104988432 | 258 |
| 194 | 3300039450 | Ga0436363_1104748 | Ga0436363_1104748_524_1324 | 258 |
| 195 | 3300046519 | Ga0495632_0091263 | Ga0495632_0091263_278_1078 | 258 |
| 196 | 3300005327 | Ga0070658_10117554 | Ga0070658_101175542 | 259 |
| 197 | 3300005530 | Ga0070679_100029491 | Ga0070679_1000294914 | 259 |
| 198 | 3300005616 | Ga0068852_100069518 | Ga0068852_1000695183 | 259 |
| 199 | 3300025920 | Ga0207649_10124717 | Ga0207649_101247172 | 259 |
| 200 | 3300026142 | Ga0207698_10069474 | Ga0207698_100694742 | 259 |
| 201 | 3300053131 | Ga0500652_000003 | Ga0500652_000003_147737_148549 | 261 |
| 202 | 3300013104 | Ga0157370_10016819 | Ga0157370_100168194 | 269 |
| 203 | 3300013105 | Ga0157369_10001142 | Ga0157369_1000114227 | 269 |
| 204 | 3300013307 | Ga0157372_10124558 | Ga0157372_101245583 | 269 |
| 205 | 3300002077 | JGI24744J21845_10014539 | JGI24744J21845_100145391 | 270 |
| 206 | 3300005329 | Ga0070683_100039920 | Ga0070683_1000399202 | 270 |
| 207 | 3300005330 | Ga0070690_100028020 | Ga0070690_1000280203 | 270 |
| 208 | 3300005331 | Ga0070670_100107121 | Ga0070670_1001071213 | 270 |
| 209 | 3300005331 | Ga0070670_100708465 | Ga0070670_1007084651 | 270 |
| 210 | 3300005333 | Ga0070677_10013350 | Ga0070677_100133503 | 270 |
| 211 | 3300005338 | Ga0068868_100019650 | Ga0068868_1000196504 | 270 |
| 212 | 3300005338 | Ga0068868_100290949 | Ga0068868_1002909491 | 270 |
| 213 | 3300005339 | Ga0070660_100322698 | Ga0070660_1003226981 | 270 |
| 214 | 3300005340 | Ga0070689_100005467 | Ga0070689_1000054676 | 270 |
| 215 | 3300005343 | Ga0070687_100039745 | Ga0070687_1000397452 | 270 |
| 216 | 3300005344 | Ga0070661_100003386 | Ga0070661_1000033869 | 270 |
| 217 | 3300005344 | Ga0070661_100338201 | Ga0070661_1003382011 | 270 |
| 218 | 3300005355 | Ga0070671_100486304 | Ga0070671_1004863042 | 270 |
| 219 | 3300005364 | Ga0070673_100521527 | Ga0070673_1005215272 | 270 |
| 220 | 3300005366 | Ga0070659_100031113 | Ga0070659_1000311132 | 270 |
| 221 | 3300005438 | Ga0070701_10212600 | Ga0070701_102126002 | 270 |
| 222 | 3300005441 | Ga0070700_100097163 | Ga0070700_1000971632 | 270 |
| 223 | 3300005455 | Ga0070663_100102662 | Ga0070663_1001026621 | 270 |
| 224 | 3300005459 | Ga0068867_100099139 | Ga0068867_1000991393 | 270 |
| 225 | 3300005466 | Ga0070685_10082035 | Ga0070685_100820351 | 270 |
| 226 | 3300005539 | Ga0068853_100038566 | Ga0068853_1000385664 | 270 |
| 227 | 3300005544 | Ga0070686_100038405 | Ga0070686_1000384052 | 270 |
| 228 | 3300005548 | Ga0070665_100672225 | Ga0070665_1006722252 | 270 |
| 229 | 3300005564 | Ga0070664_100013715 | Ga0070664_1000137156 | 270 |
| 230 | 3300005564 | Ga0070664_100194846 | Ga0070664_1001948462 | 270 |
| 231 | 3300005577 | Ga0068857_100609285 | Ga0068857_1006092852 | 270 |
| 232 | 3300005578 | Ga0068854_100004450 | Ga0068854_1000044508 | 270 |
| 233 | 3300005614 | Ga0068856_100153156 | Ga0068856_1001531563 | 270 |
| 234 | 3300005615 | Ga0070702_100145991 | Ga0070702_1001459912 | 270 |
| 235 | 3300005618 | Ga0068864_100157015 | Ga0068864_1001570153 | 270 |
| 236 | 3300005719 | Ga0068861_100063039 | Ga0068861_1000630392 | 270 |
| 237 | 3300005834 | Ga0068851_10076729 | Ga0068851_100767292 | 270 |
| 238 | 3300005840 | Ga0068870_10030116 | Ga0068870_100301164 | 270 |
| 239 | 3300005842 | Ga0068858_100137124 | Ga0068858_1001371242 | 270 |
| 240 | 3300005844 | Ga0068862_100039456 | Ga0068862_1000394565 | 270 |
| 241 | 3300006358 | Ga0068871_100115027 | Ga0068871_1001150272 | 270 |
| 242 | 3300006881 | Ga0068865_100069017 | Ga0068865_1000690172 | 270 |
| 243 | 3300009094 | Ga0111539_10078244 | Ga0111539_100782443 | 270 |
| 244 | 3300009176 | Ga0105242_10676352 | Ga0105242_106763521 | 270 |
| 245 | 3300009553 | Ga0105249_10147993 | Ga0105249_101479933 | 270 |
| 246 | 3300013105 | Ga0157369_10030029 | Ga0157369_100300296 | 270 |
| 247 | 3300013296 | Ga0157374_10016749 | Ga0157374_100167491 | 270 |
| 248 | 3300013296 | Ga0157374_10054895 | Ga0157374_100548954 | 270 |
| 249 | 3300013307 | Ga0157372_10018596 | Ga0157372_100185966 | 270 |
| 250 | 3300014745 | Ga0157377_10053734 | Ga0157377_100537343 | 270 |
| 251 | 3300014968 | Ga0157379_10040688 | Ga0157379_100406883 | 270 |
| 252 | 3300014969 | Ga0157376_10098068 | Ga0157376_100980683 | 270 |
| 253 | 3300017792 | Ga0163161_10049131 | Ga0163161_100491312 | 270 |
| 254 | 3300025271 | Ga0207666_1007422 | Ga0207666_10074222 | 270 |
| 255 | 3300025315 | Ga0207697_10000341 | Ga0207697_100003412 | 270 |
| 256 | 3300025321 | Ga0207656_10001951 | Ga0207656_100019516 | 270 |
| 257 | 3300025321 | Ga0207656_10030297 | Ga0207656_100302971 | 270 |
| 258 | 3300025893 | Ga0207682_10000162 | Ga0207682_1000016213 | 270 |
| 259 | 3300025901 | Ga0207688_10000957 | Ga0207688_1000095712 | 270 |
| 260 | 3300025904 | Ga0207647_10162172 | Ga0207647_101621722 | 270 |
| 261 | 3300025907 | Ga0207645_10003016 | Ga0207645_1000301614 | 270 |
| 262 | 3300025908 | Ga0207643_10000330 | Ga0207643_100003303 | 270 |
| 263 | 3300025919 | Ga0207657_10141352 | Ga0207657_101413522 | 270 |
| 264 | 3300025920 | Ga0207649_10029593 | Ga0207649_100295934 | 270 |
| 265 | 3300025925 | Ga0207650_10099833 | Ga0207650_100998331 | 270 |
| 266 | 3300025925 | Ga0207650_10145472 | Ga0207650_101454722 | 270 |
| 267 | 3300025925 | Ga0207650_10182412 | Ga0207650_101824121 | 270 |
| 268 | 3300025931 | Ga0207644_10021514 | Ga0207644_100215143 | 270 |
| 269 | 3300025932 | Ga0207690_10054157 | Ga0207690_100541573 | 270 |
| 270 | 3300025932 | Ga0207690_10095327 | Ga0207690_100953273 | 270 |
| 271 | 3300025933 | Ga0207706_10069716 | Ga0207706_100697163 | 270 |
| 272 | 3300025935 | Ga0207709_10374697 | Ga0207709_103746971 | 270 |
| 273 | 3300025936 | Ga0207670_10317839 | Ga0207670_103178391 | 270 |
| 274 | 3300025941 | Ga0207711_10150118 | Ga0207711_101501181 | 270 |
| 275 | 3300025942 | Ga0207689_10003140 | Ga0207689_100031405 | 270 |
| 276 | 3300025944 | Ga0207661_10176197 | Ga0207661_101761973 | 270 |
| 277 | 3300025945 | Ga0207679_10142185 | Ga0207679_101421853 | 270 |
| 278 | 3300025961 | Ga0207712_10186630 | Ga0207712_101866302 | 270 |
| 279 | 3300025981 | Ga0207640_10079551 | Ga0207640_100795512 | 270 |
| 280 | 3300026023 | Ga0207677_10192757 | Ga0207677_101927571 | 270 |
| 281 | 3300026067 | Ga0207678_10000463 | Ga0207678_1000046317 | 270 |
| 282 | 3300026075 | Ga0207708_10000744 | Ga0207708_1000074417 | 270 |
| 283 | 3300026078 | Ga0207702_10150906 | Ga0207702_101509062 | 270 |
| 284 | 3300026116 | Ga0207674_10110565 | Ga0207674_101105651 | 270 |
| 285 | 3300026118 | Ga0207675_100002013 | Ga0207675_1000020139 | 270 |
| 286 | 3300026121 | Ga0207683_10198192 | Ga0207683_101981922 | 270 |
| 287 | 3300026142 | Ga0207698_10064401 | Ga0207698_100644013 | 270 |
| 288 | 3300026142 | Ga0207698_10238616 | Ga0207698_102386161 | 270 |
| 289 | 3300028379 | Ga0268266_10055783 | Ga0268266_100557832 | 270 |
| 290 | 3300046539 | Ga0495621_0024845 | Ga0495621_0024845_1099_1935 | 270 |
| 291 | 3300048903 | Ga0496100_0242478 | Ga0496100_0242478_233_1069 | 270 |
| 292 | 3300048904 | Ga0496101_0163506 | Ga0496101_0163506_616_1452 | 270 |
| 293 | 3300048907 | Ga0496104_0075650 | Ga0496104_0075650_1635_2471 | 270 |
| 294 | 3300048908 | Ga0496105_0163925 | Ga0496105_0163925_871_1707 | 270 |
| 295 | 3300048909 | Ga0496106_0040658 | Ga0496106_0040658_998_1834 | 270 |
| 296 | 3300048911 | Ga0496108_0066825 | Ga0496108_0066825_305_1141 | 270 |
| 297 | 3300048912 | Ga0496109_0196434 | Ga0496109_0196434_612_1448 | 270 |
| 298 | 3300048913 | Ga0496110_0086102 | Ga0496110_0086102_1098_1934 | 270 |
| 299 | 3300048914 | Ga0496111_0063118 | Ga0496111_0063118_188_1024 | 270 |
| 300 | 3300048916 | Ga0496113_0363544 | Ga0496113_0363544_296_1132 | 270 |
| 301 | 3300048917 | Ga0496114_0143409 | Ga0496114_0143409_90_926 | 270 |
| 302 | 3300050511 | nmdc:mga08y16_35749_c1 | nmdc:mga08y16_35749_c1_1110_1946 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
72
199
0.93
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
185
304
0.92
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.7573 | 41 | 262 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7388 | 68 | 264 |
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.7189 | 71 | 254 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7065 | 66 | 264 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.6999 | 82 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8774 | 83 | 262 | 1.10.3720.10 |
| af_P14176_140_330_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8524 | 80 | 262 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8477 | 80 | 268 | 1.10.3720.10 |
| af_Q2FVG9_10_202_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.844 | 80 | 262 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8399 | 79 | 262 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A542AGC5-F1-model_v4 | NitT/TauT family transport system permease protein | 0.9378 | 33 | 270 |
GO:0005886
GO:0055085 |
| AF-A0A6L5FJC4-F1-model_v4 | ABC transporter permease subunit | 0.9336 | 37 | 268 |
GO:0005886
GO:0055085 |
| AF-B9JM56-F1-model_v4 | Taurine uptake ABC transporter | 0.9264 | 37 | 270 |
GO:0005886
GO:0055085 |
| AF-A0A368LB89-F1-model_v4 | ABC transporter permease | 0.9201 | 56 | 264 |
GO:0005886
GO:0055085 |
| AF-A0A351G5Y2-F1-model_v4 | Taurine ABC transporter permease | 0.9181 | 27 | 264 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar