F396255

General Info

Members Datasets Scaffolds Average Seq Length
302 195 299 263

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10006484|JGI24751J29686_100064843
Length 306
Sequence MAETGRLTAPAAPMVSQVILLTWEAVAASGLLFRDVVPSLIVIGRALVELLTEATYYWHLGVTAGEIGSALLIGGLAGLAVGIALGANPLLSRSFEAFLYYLGPTPKIIFFPVMIMWFGVGPGSKVAMGVLSCFFPVALSAAAGMRGIDKVLIRVGRSFRASTWQMVTKIYLPAMRMPILNGVRLGLGXXVALSAAAGMRGIDKVLIRVGRSFRASTWQMVTKIYLPAMRMPILNGVRLGLGVAIIGTLLAETKLSNRGLGFLIINAYSTFNMPRMYALLIVLFVLSIGVNALIGRLGGVDSRRTR

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
195 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 0
Rhizoplane 5.3
Rhizosphere 88.74
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10014539 3300002077 Bacteria 1579
2 JGI24751J29686_10006484 3300002459 Bacteria 2386
3 Ga0070658_10117244 3300005327 Bacteria 2210
4 Ga0070658_10117554 3300005327 Bacteria 2207
5 Ga0070676_10251735 3300005328 Bacteria 1179
6 Ga0070683_100039920 3300005329 Bacteria 4312
7 Ga0070683_100198782 3300005329 Bacteria 1904
8 Ga0070690_100028020 3300005330 Bacteria 3486
9 Ga0070690_100283810 3300005330 Bacteria 1182
10 Ga0070670_100034180 3300005331 Bacteria 4375
11 Ga0070670_100107121 3300005331 Bacteria 2409
12 Ga0070670_100527832 3300005331 Bacteria 1052
13 Ga0070670_100708465 3300005331 Bacteria 905
14 Ga0070677_10013350 3300005333 Bacteria 2871
15 Ga0070666_10079847 3300005335 Bacteria 2235
16 Ga0068868_100019650 3300005338 Bacteria 5065
17 Ga0068868_100290949 3300005338 Bacteria 1385
18 Ga0070660_100002008 3300005339 Bacteria 14027
19 Ga0070660_100322698 3300005339 Bacteria 1269
20 Ga0070689_100005467 3300005340 Bacteria 8681
21 Ga0070689_100640370 3300005340 Bacteria 924
22 Ga0070687_100039745 3300005343 Bacteria 2366
23 Ga0070661_100003386 3300005344 Bacteria 10996
24 Ga0070661_100074383 3300005344 Bacteria 2502
25 Ga0070661_100338201 3300005344 Bacteria 1179
26 Ga0070669_100184076 3300005353 Bacteria 1636
27 Ga0070669_100542130 3300005353 Bacteria 969
28 Ga0070675_100158809 3300005354 Bacteria 1943
29 Ga0070675_100298648 3300005354 Bacteria 1418
30 Ga0070671_100011555 3300005355 Bacteria 7102
31 Ga0070671_100486304 3300005355 Bacteria 1061
32 Ga0070671_100627197 3300005355 Unclassified 930
33 Ga0070674_100173506 3300005356 Bacteria 1646
34 Ga0070673_100521527 3300005364 Bacteria 1077
35 Ga0070659_100004641 3300005366 Bacteria 9815
36 Ga0070659_100031113 3300005366 Bacteria 4133
37 Ga0070701_10212600 3300005438 Bacteria 1149
38 Ga0070700_100097163 3300005441 Bacteria 1934
39 Ga0070694_100178560 3300005444 Bacteria 1569
40 Ga0070663_100102662 3300005455 Bacteria 2136
41 Ga0070663_100329416 3300005455 Bacteria 1230
42 Ga0070678_100033184 3300005456 Bacteria 3581
43 Ga0070678_100218586 3300005456 Unclassified 1583
44 Ga0070678_100253639 3300005456 Bacteria 1476
45 Ga0070662_100000028 3300005457 Bacteria 83508
46 Ga0070662_100143735 3300005457 Bacteria 1851
47 Ga0068867_100099139 3300005459 Bacteria 2222
48 Ga0068867_100118901 3300005459 Bacteria 2039
49 Ga0068867_100556831 3300005459 Bacteria 994
50 Ga0070685_10082035 3300005466 Bacteria 1934
51 Ga0070707_100077215 3300005468 Bacteria 3213
52 Ga0070698_100233306 3300005471 Bacteria 1773
53 Ga0070699_100039487 3300005518 Bacteria 4086
54 Ga0070679_100029491 3300005530 Bacteria 5413
55 Ga0070679_100137875 3300005530 Bacteria 2421
56 Ga0070697_100164553 3300005536 Bacteria 1875
57 Ga0068853_100031484 3300005539 Bacteria 4486
58 Ga0068853_100038566 3300005539 Bacteria 4070
59 Ga0070672_100034392 3300005543 Bacteria 3846
60 Ga0070686_100038405 3300005544 Bacteria 2976
61 Ga0070686_100144838 3300005544 Bacteria 1658
62 Ga0070665_100138227 3300005548 Bacteria 2439
63 Ga0070665_100672225 3300005548 Bacteria 1049
64 Ga0068855_100003756 3300005563 Bacteria 18559
65 Ga0070664_100005823 3300005564 Bacteria 9942
66 Ga0070664_100013715 3300005564 Bacteria 6604
67 Ga0070664_100060815 3300005564 Bacteria 3218
68 Ga0070664_100194846 3300005564 Bacteria 1806
69 Ga0068857_100307084 3300005577 Bacteria 1463
70 Ga0068857_100609285 3300005577 Bacteria 1033
71 Ga0068854_100004450 3300005578 Bacteria 8837
72 Ga0068856_100005723 3300005614 Bacteria 12245
73 Ga0068856_100109201 3300005614 Bacteria 2762
74 Ga0068856_100153156 3300005614 Bacteria 2315
75 Ga0070702_100145991 3300005615 Bacteria 1513
76 Ga0068852_100069518 3300005616 Bacteria 3087
77 Ga0068852_100148699 3300005616 Bacteria 2176
78 Ga0068864_100157015 3300005618 Bacteria 2065
79 Ga0068864_100504041 3300005618 Bacteria 1165
80 Ga0068861_100063039 3300005719 Bacteria 2849
81 Ga0068861_100239743 3300005719 Bacteria 1542
82 Ga0068851_10076729 3300005834 Bacteria 1738
83 Ga0068870_10030116 3300005840 Bacteria 2741
84 Ga0068870_10101950 3300005840 Bacteria 1624
85 Ga0068863_100169349 3300005841 Bacteria 2094
86 Ga0068863_100404983 3300005841 Bacteria 1335
87 Ga0068858_100137124 3300005842 Bacteria 2296
88 Ga0068862_100039456 3300005844 Bacteria 4010
89 Ga0068862_100430831 3300005844 Bacteria 1239
90 Ga0081538_10039370 3300005981 Bacteria 3033
91 Ga0081540_1025535 3300005983 Bacteria 3396
92 Ga0081540_1105998 3300005983 Bacteria 1199
93 Ga0081539_10008490 3300005985 Bacteria 8923
94 Ga0075365_10149920 3300006038 Bacteria 1622
95 Ga0075363_100164463 3300006048 Bacteria 1257
96 Ga0075364_10179695 3300006051 Unclassified 1431
97 Ga0075362_10042772 3300006177 Bacteria 2004
98 Ga0075366_10120011 3300006195 Bacteria 1584
99 Ga0075366_10302325 3300006195 Unclassified 979
100 Ga0068871_100115027 3300006358 Bacteria 2267
101 Ga0068871_100374479 3300006358 Bacteria 1264
102 Ga0075428_100268419 3300006844 Bacteria 1836
103 Ga0075428_101029891 3300006844 Bacteria 871
104 Ga0075430_100267907 3300006846 Bacteria 1414
105 Ga0075431_100128797 3300006847 Bacteria 2612
106 Ga0075431_100371132 3300006847 Unclassified 1436
107 Ga0075429_100022580 3300006880 Bacteria 5455
108 Ga0068865_100069017 3300006881 Bacteria 2500
109 Ga0075436_100165504 3300006914 Bacteria 1560
110 Ga0105240_10018218 3300009093 Bacteria 9439
111 Ga0111539_10078244 3300009094 Bacteria 3891
112 Ga0105245_10187765 3300009098 Bacteria 1978
113 Ga0105245_10268435 3300009098 Bacteria 1663
114 Ga0105243_10133615 3300009148 Bacteria 2108
115 Ga0105241_10077808 3300009174 Bacteria 2590
116 Ga0105242_10034192 3300009176 Bacteria 4075
117 Ga0105242_10676352 3300009176 Bacteria 1007
118 Ga0105248_10084236 3300009177 Bacteria 3576
119 Ga0105248_10090543 3300009177 Bacteria 3445
120 Ga0105237_10197089 3300009545 Bacteria 2014
121 Ga0105238_10186258 3300009551 Bacteria 2052
122 Ga0105249_10147993 3300009553 Bacteria 2258
123 Ga0157373_10000984 3300013100 Bacteria 22034
124 Ga0157371_10001860 3300013102 Bacteria 21168
125 Ga0157371_10342788 3300013102 Bacteria 1087
126 Ga0157370_10016819 3300013104 Bacteria 7394
127 Ga0157369_10001142 3300013105 Bacteria 33120
128 Ga0157369_10030029 3300013105 Bacteria 5998
129 Ga0157369_10115347 3300013105 Bacteria 2852
130 Ga0157374_10016749 3300013296 Bacteria 6449
131 Ga0157374_10054895 3300013296 Bacteria 3717
132 Ga0157378_10002036 3300013297 Bacteria 18105
133 Ga0157378_10748420 3300013297 Unclassified 1000
134 Ga0163162_10364736 3300013306 Bacteria 1577
135 Ga0157372_10000433 3300013307 Bacteria 46142
136 Ga0157372_10018596 3300013307 Bacteria 7474
137 Ga0157372_10124558 3300013307 Bacteria 2962
138 Ga0157372_10403056 3300013307 Bacteria 1594
139 Ga0163163_10165197 3300014325 Bacteria 2260
140 Ga0163163_10276256 3300014325 Bacteria 1731
141 Ga0157377_10053734 3300014745 Bacteria 2279
142 Ga0157379_10040688 3300014968 Bacteria 4149
143 Ga0157379_10249171 3300014968 Bacteria 1612
144 Ga0157376_10034786 3300014969 Bacteria 4071
145 Ga0157376_10098068 3300014969 Bacteria 2554
146 Ga0157376_10123521 3300014969 Bacteria 2298
147 Ga0163161_10049131 3300017792 Bacteria 3048
148 Ga0163161_10139158 3300017792 Unclassified 1837
149 Ga0213876_10006426 3300021384 Bacteria 6410
150 Ga0213875_10000007 3300021388 Bacteria 562717
151 Ga0207666_1007422 3300025271 Bacteria 1444
152 Ga0209758_1036663 3300025297 Bacteria 1909
153 Ga0207697_10000341 3300025315 Bacteria 25964
154 Ga0207656_10001951 3300025321 Bacteria 6857
155 Ga0207656_10030297 3300025321 Bacteria 2234
156 Ga0207682_10000162 3300025893 Bacteria 30380
157 Ga0207688_10000957 3300025901 Bacteria 14672
158 Ga0207688_10267357 3300025901 Bacteria 1039
159 Ga0207647_10162172 3300025904 Bacteria 1304
160 Ga0207645_10003016 3300025907 Bacteria 13006
161 Ga0207645_10260947 3300025907 Bacteria 1148
162 Ga0207643_10000330 3300025908 Bacteria 32431
163 Ga0207643_10050560 3300025908 Bacteria 2357
164 Ga0207695_10036491 3300025913 Bacteria 5314
165 Ga0207657_10001368 3300025919 Bacteria 26012
166 Ga0207657_10141352 3300025919 Bacteria 1966
167 Ga0207649_10006746 3300025920 Bacteria 6236
168 Ga0207649_10029593 3300025920 Bacteria 3235
169 Ga0207649_10124717 3300025920 Bacteria 1741
170 Ga0207646_10000871 3300025922 Bacteria 38971
171 Ga0207681_10416227 3300025923 Bacteria 1088
172 Ga0207650_10099833 3300025925 Bacteria 2232
173 Ga0207650_10145472 3300025925 Bacteria 1866
174 Ga0207650_10182412 3300025925 Bacteria 1673
175 Ga0207659_10415839 3300025926 Bacteria 1127
176 Ga0207644_10021514 3300025931 Bacteria 4394
177 Ga0207644_10029335 3300025931 Bacteria 3816
178 Ga0207644_10580196 3300025931 Bacteria 930
179 Ga0207690_10002734 3300025932 Bacteria 10650
180 Ga0207690_10054157 3300025932 Bacteria 2696
181 Ga0207690_10095327 3300025932 Bacteria 2113
182 Ga0207706_10001562 3300025933 Bacteria 22713
183 Ga0207706_10016573 3300025933 Bacteria 6652
184 Ga0207706_10069716 3300025933 Bacteria 3092
185 Ga0207686_10054268 3300025934 Bacteria 2510
186 Ga0207709_10374697 3300025935 Bacteria 1081
187 Ga0207670_10317839 3300025936 Bacteria 1224
188 Ga0207669_10036707 3300025937 Bacteria 2804
189 Ga0207669_10156326 3300025937 Bacteria 1604
190 Ga0207691_10011501 3300025940 Bacteria 8493
191 Ga0207691_10287639 3300025940 Bacteria 1414
192 Ga0207711_10046686 3300025941 Bacteria 3701
193 Ga0207711_10150118 3300025941 Bacteria 2102
194 Ga0207689_10003140 3300025942 Bacteria 15164
195 Ga0207689_10177620 3300025942 Bacteria 1756
196 Ga0207661_10176197 3300025944 Bacteria 1864
197 Ga0207679_10015009 3300025945 Bacteria 5106
198 Ga0207679_10101209 3300025945 Bacteria 2254
199 Ga0207679_10142185 3300025945 Bacteria 1941
200 Ga0207667_10012759 3300025949 Bacteria 9649
201 Ga0207651_10028683 3300025960 Bacteria 3515
202 Ga0207651_10253042 3300025960 Bacteria 1442
203 Ga0207712_10186630 3300025961 Bacteria 1633
204 Ga0207668_10105587 3300025972 Bacteria 2103
205 Ga0207640_10041304 3300025981 Bacteria 2933
206 Ga0207640_10079551 3300025981 Bacteria 2235
207 Ga0207658_10536824 3300025986 Unclassified 1045
208 Ga0207677_10192757 3300026023 Bacteria 1613
209 Ga0207639_10067273 3300026041 Bacteria 2787
210 Ga0207639_10087806 3300026041 Bacteria 2480
211 Ga0207678_10000463 3300026067 Bacteria 36837
212 Ga0207678_10002064 3300026067 Bacteria 18221
213 Ga0207678_10253373 3300026067 Bacteria 1508
214 Ga0207708_10000744 3300026075 Bacteria 24435
215 Ga0207702_10150906 3300026078 Bacteria 2114
216 Ga0207641_10047158 3300026088 Bacteria 3633
217 Ga0207641_10511964 3300026088 Bacteria 1167
218 Ga0207648_10021480 3300026089 Bacteria 5801
219 Ga0207648_10483312 3300026089 Bacteria 1131
220 Ga0207648_10498843 3300026089 Bacteria 1114
221 Ga0207674_10110565 3300026116 Bacteria 2723
222 Ga0207675_100002013 3300026118 Bacteria 20272
223 Ga0207675_100160909 3300026118 Bacteria 2141
224 Ga0207675_100347369 3300026118 Unclassified 1453
225 Ga0207683_10006988 3300026121 Bacteria 9677
226 Ga0207683_10135152 3300026121 Bacteria 2220
227 Ga0207683_10198192 3300026121 Bacteria 1825
228 Ga0207683_10233367 3300026121 Bacteria 1678
229 Ga0207698_10006753 3300026142 Bacteria 7168
230 Ga0207698_10064401 3300026142 Bacteria 2873
231 Ga0207698_10069474 3300026142 Bacteria 2786
232 Ga0207698_10238616 3300026142 Bacteria 1655
233 Ga0209969_1006246 3300027360 Bacteria 1677
234 Ga0209971_1004257 3300027682 Bacteria 3398
235 Ga0209966_1011003 3300027695 Bacteria 1642
236 Ga0209974_10013851 3300027876 Bacteria 2687
237 Ga0268266_10055783 3300028379 Bacteria 3397
238 Ga0268266_10484534 3300028379 Unclassified 1179
239 Ga0307508_10008048 3300031616 Bacteria 9772
240 Ga0265314_10129466 3300031711 Bacteria 1577
241 Ga0373935_0236940 3300035692 Bacteria 1273
242 Ga0373927_0115271 3300035695 Bacteria 1752
243 Ga0373927_0133342 3300035695 Bacteria 1623
244 Ga0373947_0024441 3300035725 Bacteria 3521
245 Ga0373937_0038814 3300036401 Bacteria 4339
246 Ga0373937_0208983 3300036401 Bacteria 1836
247 Ga0373925_0023077 3300037068 Bacteria 4540
248 Ga0395900_0215744 3300037418 Bacteria 1936
249 Ga0395898_0075862 3300037466 Bacteria 3247
250 Ga0395901_0114405 3300038443 Bacteria 2834
251 Ga0436363_1104748 3300039450 Bacteria 1605
252 Ga0495632_0091263 3300046519 Bacteria 1444
253 Ga0495621_0024845 3300046539 Bacteria 2006
254 Ga0495684_0402305 3300047471 Unclassified 961
255 Ga0496100_0242478 3300048903 Bacteria 1330
256 Ga0496101_0163506 3300048904 Bacteria 1708
257 Ga0496101_0171451 3300048904 Bacteria 1668
258 Ga0496103_0028419 3300048906 Bacteria 3393
259 Ga0496104_0075650 3300048907 Bacteria 3206
260 Ga0496105_0163925 3300048908 Bacteria 1824
261 Ga0496106_0040658 3300048909 Bacteria 3483
262 Ga0496107_0034322 3300048910 Bacteria 3634
263 Ga0496108_0066825 3300048911 Bacteria 3032
264 Ga0496108_0538823 3300048911 Bacteria 1019
265 Ga0496109_0196434 3300048912 Bacteria 1896
266 Ga0496110_0086102 3300048913 Bacteria 2805
267 Ga0496111_0063118 3300048914 Bacteria 2687
268 Ga0496113_0363544 3300048916 Bacteria 1161
269 Ga0496114_0143409 3300048917 Bacteria 2069
270 Ga0496114_0354970 3300048917 Bacteria 1297
271 Ga0501031_0027882 3300049568 Bacteria 3681
272 Ga0501034_0383631 3300049571 Bacteria 1330
273 Ga0501036_0033208 3300049572 Bacteria 4364
274 Ga0501039_0513924 3300049575 Bacteria 940
275 Ga0501040_0058748 3300049576 Bacteria 2642
276 Ga0501041_0024625 3300049577 Bacteria 3613
277 Ga0501042_0016874 3300049578 Bacteria 5024
278 Ga0501046_0010778 3300049580 Bacteria 7839
279 Ga0501075_0565074 3300049591 Bacteria 868
280 Ga0501076_0157114 3300049592 Bacteria 1852
281 Ga0501076_0162857 3300049592 Bacteria 1818
282 Ga0501079_0111275 3300049741 Bacteria 2128
283 Ga0501045_0073784 3300049824 Bacteria 2513
284 nmdc:mga06z11_10848_c1 3300050494 Bacteria 3901
285 nmdc:mga04h51_126916_c1 3300050495 Bacteria 956
286 nmdc:mga04h51_42349_c1 3300050495 Bacteria 1493
287 nmdc:mga09592_25437_c1 3300050508 Bacteria 4899
288 nmdc:mga06r32_18139_c1 3300050510 Bacteria 6438
289 nmdc:mga06r32_437455_c1 3300050510 Unclassified 1288
290 nmdc:mga06r32_498527_c1 3300050510 Bacteria 1195
291 nmdc:mga08y16_35749_c1 3300050511 Bacteria 5217
292 nmdc:mga0n895_404710_c1 3300050512 Bacteria 1380
293 nmdc:mga08x19_102848_c1 3300050514 Bacteria 1897
294 nmdc:mga0a205_387479_c1 3300050515 Bacteria 1262
295 Ga0500652_000003 3300053131 Bacteria 221528
296 Ga0500616_0000072 3300053153 Bacteria 231471
297 Ga0500616_0060015 3300053153 Bacteria 1973
298 Ga0501082_0203643 3300060353 Bacteria 1722
299 Ga0530510_0042668 3300061734 Bacteria 3277

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025901 Ga0207688_10267357 Ga0207688_102673572 215
2 3300050495 nmdc:mga04h51_126916_c1 nmdc:mga04h51_126916_c1_204_944 224
3 3300026118 Ga0207675_100160909 Ga0207675_1001609093 228
4 3300050515 nmdc:mga0a205_387479_c1 nmdc:mga0a205_387479_c1_175_897 231
5 3300035695 Ga0373927_0115271 Ga0373927_0115271_136_903 232
6 3300049571 Ga0501034_0383631 Ga0501034_0383631_144_866 232
7 3300014968 Ga0157379_10249171 Ga0157379_102491712 233
8 3300005340 Ga0070689_100640370 Ga0070689_1006403702 235
9 3300005719 Ga0068861_100239743 Ga0068861_1002397431 235
10 3300009098 Ga0105245_10187765 Ga0105245_101877651 235
11 3300036401 Ga0373937_0208983 Ga0373937_0208983_855_1595 235
12 3300005354 Ga0070675_100158809 Ga0070675_1001588091 236
13 3300013307 Ga0157372_10403056 Ga0157372_104030562 237
14 3300048911 Ga0496108_0538823 Ga0496108_0538823_41_793 237
15 3300005335 Ga0070666_10079847 Ga0070666_100798472 239
16 3300013306 Ga0163162_10364736 Ga0163162_103647362 239
17 3300035695 Ga0373927_0133342 Ga0373927_0133342_691_1434 239
18 3300035725 Ga0373947_0024441 Ga0373947_0024441_1654_2397 239
19 3300036401 Ga0373937_0038814 Ga0373937_0038814_2778_3521 239
20 3300037068 Ga0373925_0023077 Ga0373925_0023077_1837_2580 239
21 3300047471 Ga0495684_0402305 Ga0495684_0402305_132_875 239
22 3300048917 Ga0496114_0354970 Ga0496114_0354970_24_767 239
23 3300009174 Ga0105241_10077808 Ga0105241_100778083 241
24 3300009551 Ga0105238_10186258 Ga0105238_101862583 241
25 3300005330 Ga0070690_100283810 Ga0070690_1002838102 243
26 3300005353 Ga0070669_100184076 Ga0070669_1001840762 243
27 3300005444 Ga0070694_100178560 Ga0070694_1001785602 243
28 3300005456 Ga0070678_100033184 Ga0070678_1000331842 243
29 3300005459 Ga0068867_100118901 Ga0068867_1001189012 243
30 3300005543 Ga0070672_100034392 Ga0070672_1000343924 243
31 3300005544 Ga0070686_100144838 Ga0070686_1001448382 243
32 3300005840 Ga0068870_10101950 Ga0068870_101019502 243
33 3300005841 Ga0068863_100404983 Ga0068863_1004049832 243
34 3300005844 Ga0068862_100430831 Ga0068862_1004308311 243
35 3300006358 Ga0068871_100374479 Ga0068871_1003744792 243
36 3300009148 Ga0105243_10133615 Ga0105243_101336153 243
37 3300009177 Ga0105248_10090543 Ga0105248_100905433 243
38 3300013297 Ga0157378_10748420 Ga0157378_107484202 243
39 3300014969 Ga0157376_10123521 Ga0157376_101235213 243
40 3300025908 Ga0207643_10050560 Ga0207643_100505602 243
41 3300025937 Ga0207669_10036707 Ga0207669_100367072 243
42 3300025940 Ga0207691_10011501 Ga0207691_100115016 243
43 3300025942 Ga0207689_10177620 Ga0207689_101776202 243
44 3300025960 Ga0207651_10253042 Ga0207651_102530422 243
45 3300025972 Ga0207668_10105587 Ga0207668_101055873 243
46 3300026088 Ga0207641_10047158 Ga0207641_100471583 243
47 3300026089 Ga0207648_10021480 Ga0207648_100214803 243
48 3300026118 Ga0207675_100347369 Ga0207675_1003473692 243
49 3300026121 Ga0207683_10006988 Ga0207683_100069887 243
50 3300049591 Ga0501075_0565074 Ga0501075_0565074_98_853 243
51 3300053153 Ga0500616_0060015 Ga0500616_0060015_680_1453 243
52 3300002459 JGI24751J29686_10006484 JGI24751J29686_100064843 244
53 3300006847 Ga0075431_100371132 Ga0075431_1003711322 244
54 3300027695 Ga0209966_1011003 Ga0209966_10110032 244
55 3300027876 Ga0209974_10013851 Ga0209974_100138513 244
56 3300049575 Ga0501039_0513924 Ga0501039_0513924_80_856 244
57 3300050510 nmdc:mga06r32_437455_c1 nmdc:mga06r32_437455_c1_470_1246 244
58 3300061734 Ga0530510_0042668 Ga0530510_0042668_1552_2328 244
59 3300005614 Ga0068856_100109201 Ga0068856_1001092014 245
60 3300025940 Ga0207691_10287639 Ga0207691_102876392 245
61 iso_pu_bacteria 8005314921 8005316007 245
62 3300005331 Ga0070670_100034180 Ga0070670_1000341803 246
63 3300005356 Ga0070674_100173506 Ga0070674_1001735063 246
64 3300005456 Ga0070678_100218586 Ga0070678_1002185863 246
65 3300005459 Ga0068867_100556831 Ga0068867_1005568312 246
66 3300005548 Ga0070665_100138227 Ga0070665_1001382272 246
67 3300005841 Ga0068863_100169349 Ga0068863_1001693492 246
68 3300005981 Ga0081538_10039370 Ga0081538_100393702 246
69 3300005983 Ga0081540_1105998 Ga0081540_11059982 246
70 3300009177 Ga0105248_10084236 Ga0105248_100842363 246
71 3300014325 Ga0163163_10276256 Ga0163163_102762562 246
72 3300014969 Ga0157376_10034786 Ga0157376_100347862 246
73 3300025926 Ga0207659_10415839 Ga0207659_104158391 246
74 3300025937 Ga0207669_10156326 Ga0207669_101563262 246
75 3300025986 Ga0207658_10536824 Ga0207658_105368242 246
76 3300026089 Ga0207648_10483312 Ga0207648_104833122 246
77 3300026121 Ga0207683_10233367 Ga0207683_102333672 246
78 3300021384 Ga0213876_10006426 Ga0213876_100064263 247
79 3300005455 Ga0070663_100329416 Ga0070663_1003294162 248
80 3300013102 Ga0157371_10342788 Ga0157371_103427882 248
81 3300025297 Ga0209758_1036663 Ga0209758_10366632 248
82 3300026067 Ga0207678_10253373 Ga0207678_102533732 248
83 3300037418 Ga0395900_0215744 Ga0395900_0215744_862_1641 248
84 3300037466 Ga0395898_0075862 Ga0395898_0075862_1267_2046 248
85 3300038443 Ga0395901_0114405 Ga0395901_0114405_1401_2180 248
86 iso_pu_bacteria 2775507049 2776911770 248
87 3300005355 Ga0070671_100011555 Ga0070671_1000115554 249
88 3300005457 Ga0070662_100143735 Ga0070662_1001437352 249
89 3300006844 Ga0075428_100268419 Ga0075428_1002684191 249
90 3300006846 Ga0075430_100267907 Ga0075430_1002679071 249
91 3300006880 Ga0075429_100022580 Ga0075429_1000225805 249
92 3300009098 Ga0105245_10268435 Ga0105245_102684352 249
93 3300013297 Ga0157378_10002036 Ga0157378_1000203614 249
94 3300017792 Ga0163161_10139158 Ga0163161_101391582 249
95 3300025933 Ga0207706_10016573 Ga0207706_100165735 249
96 3300026088 Ga0207641_10511964 Ga0207641_105119642 249
97 3300031616 Ga0307508_10008048 Ga0307508_100080488 249
98 3300050508 nmdc:mga09592_25437_c1 nmdc:mga09592_25437_c1_3489_4283 249
99 3300050510 nmdc:mga06r32_18139_c1 nmdc:mga06r32_18139_c1_4879_5673 249
100 3300005468 Ga0070707_100077215 Ga0070707_1000772152 250
101 3300005471 Ga0070698_100233306 Ga0070698_1002333062 250
102 3300005518 Ga0070699_100039487 Ga0070699_1000394874 250
103 3300005536 Ga0070697_100164553 Ga0070697_1001645533 250
104 3300006844 Ga0075428_101029891 Ga0075428_1010298912 250
105 3300025922 Ga0207646_10000871 Ga0207646_1000087117 250
106 3300050512 nmdc:mga0n895_404710_c1 nmdc:mga0n895_404710_c1_347_1126 250
107 3300005327 Ga0070658_10117244 Ga0070658_101172441 252
108 3300006038 Ga0075365_10149920 Ga0075365_101499202 252
109 3300006048 Ga0075363_100164463 Ga0075363_1001644632 252
110 3300006051 Ga0075364_10179695 Ga0075364_101796952 252
111 3300006177 Ga0075362_10042772 Ga0075362_100427722 252
112 3300006195 Ga0075366_10120011 Ga0075366_101200112 252
113 3300014325 Ga0163163_10165197 Ga0163163_101651972 252
114 3300027360 Ga0209969_1006246 Ga0209969_10062463 252
115 3300027682 Ga0209971_1004257 Ga0209971_10042574 252
116 3300031711 Ga0265314_10129466 Ga0265314_101294662 252
117 3300050495 nmdc:mga04h51_42349_c1 nmdc:mga04h51_42349_c1_138_962 252
118 iso_pu_bacteria 2510917026 2511174088 252
119 3300005331 Ga0070670_100527832 Ga0070670_1005278322 253
120 3300005344 Ga0070661_100074383 Ga0070661_1000743833 253
121 3300005354 Ga0070675_100298648 Ga0070675_1002986482 253
122 3300005564 Ga0070664_100060815 Ga0070664_1000608152 253
123 3300005577 Ga0068857_100307084 Ga0068857_1003070842 253
124 3300006195 Ga0075366_10302325 Ga0075366_103023252 253
125 3300025941 Ga0207711_10046686 Ga0207711_100466865 253
126 3300025945 Ga0207679_10101209 Ga0207679_101012092 253
127 3300028379 Ga0268266_10484534 Ga0268266_104845343 253
128 3300049568 Ga0501031_0027882 Ga0501031_0027882_1997_2782 253
129 3300049572 Ga0501036_0033208 Ga0501036_0033208_2629_3414 253
130 3300049576 Ga0501040_0058748 Ga0501040_0058748_319_1104 253
131 3300049577 Ga0501041_0024625 Ga0501041_0024625_981_1766 253
132 3300049578 Ga0501042_0016874 Ga0501042_0016874_631_1416 253
133 3300049580 Ga0501046_0010778 Ga0501046_0010778_690_1475 253
134 3300049592 Ga0501076_0162857 Ga0501076_0162857_356_1141 253
135 3300049741 Ga0501079_0111275 Ga0501079_0111275_1146_1931 253
136 3300049824 Ga0501045_0073784 Ga0501045_0073784_1191_1976 253
137 3300050494 nmdc:mga06z11_10848_c1 nmdc:mga06z11_10848_c1_2635_3441 253
138 3300060353 Ga0501082_0203643 Ga0501082_0203643_142_927 253
139 3300005329 Ga0070683_100198782 Ga0070683_1001987822 254
140 3300005355 Ga0070671_100627197 Ga0070671_1006271971 254
141 3300009093 Ga0105240_10018218 Ga0105240_100182183 254
142 3300009176 Ga0105242_10034192 Ga0105242_100341925 254
143 3300009545 Ga0105237_10197089 Ga0105237_101970892 254
144 3300021388 Ga0213875_10000007 Ga0213875_1000000744 254
145 3300025913 Ga0207695_10036491 Ga0207695_100364913 254
146 3300025931 Ga0207644_10580196 Ga0207644_105801961 254
147 3300025934 Ga0207686_10054268 Ga0207686_100542683 254
148 3300026041 Ga0207639_10067273 Ga0207639_100672733 254
149 3300006847 Ga0075431_100128797 Ga0075431_1001287972 255
150 3300049592 Ga0501076_0157114 Ga0501076_0157114_978_1772 255
151 3300005530 Ga0070679_100137875 Ga0070679_1001378752 256
152 3300005983 Ga0081540_1025535 Ga0081540_10255352 256
153 3300005985 Ga0081539_10008490 Ga0081539_100084903 256
154 3300006914 Ga0075436_100165504 Ga0075436_1001655041 256
155 3300035692 Ga0373935_0236940 Ga0373935_0236940_198_998 256
156 3300050510 nmdc:mga06r32_498527_c1 nmdc:mga06r32_498527_c1_160_954 256
157 3300050514 nmdc:mga08x19_102848_c1 nmdc:mga08x19_102848_c1_112_906 256
158 3300053153 Ga0500616_0000072 Ga0500616_0000072_4688_5512 256
159 3300005328 Ga0070676_10251735 Ga0070676_102517352 257
160 3300005339 Ga0070660_100002008 Ga0070660_1000020089 257
161 3300005353 Ga0070669_100542130 Ga0070669_1005421301 257
162 3300005366 Ga0070659_100004641 Ga0070659_1000046415 257
163 3300005456 Ga0070678_100253639 Ga0070678_1002536392 257
164 3300005457 Ga0070662_100000028 Ga0070662_10000002824 257
165 3300005539 Ga0068853_100031484 Ga0068853_1000314843 257
166 3300005563 Ga0068855_100003756 Ga0068855_10000375610 257
167 3300005564 Ga0070664_100005823 Ga0070664_1000058237 257
168 3300005614 Ga0068856_100005723 Ga0068856_1000057235 257
169 3300005616 Ga0068852_100148699 Ga0068852_1001486993 257
170 3300005618 Ga0068864_100504041 Ga0068864_1005040411 257
171 3300013100 Ga0157373_10000984 Ga0157373_1000098413 257
172 3300013102 Ga0157371_10001860 Ga0157371_1000186011 257
173 3300013105 Ga0157369_10115347 Ga0157369_101153472 257
174 3300013307 Ga0157372_10000433 Ga0157372_1000043337 257
175 3300025907 Ga0207645_10260947 Ga0207645_102609472 257
176 3300025919 Ga0207657_10001368 Ga0207657_1000136829 257
177 3300025920 Ga0207649_10006746 Ga0207649_100067462 257
178 3300025923 Ga0207681_10416227 Ga0207681_104162272 257
179 3300025931 Ga0207644_10029335 Ga0207644_100293352 257
180 3300025932 Ga0207690_10002734 Ga0207690_1000273411 257
181 3300025933 Ga0207706_10001562 Ga0207706_1000156211 257
182 3300025945 Ga0207679_10015009 Ga0207679_100150094 257
183 3300025949 Ga0207667_10012759 Ga0207667_100127595 257
184 3300025960 Ga0207651_10028683 Ga0207651_100286832 257
185 3300025981 Ga0207640_10041304 Ga0207640_100413043 257
186 3300026041 Ga0207639_10087806 Ga0207639_100878063 257
187 3300026067 Ga0207678_10002064 Ga0207678_100020645 257
188 3300026121 Ga0207683_10135152 Ga0207683_101351523 257
189 3300026142 Ga0207698_10006753 Ga0207698_100067534 257
190 3300048904 Ga0496101_0171451 Ga0496101_0171451_361_1164 257
191 3300048906 Ga0496103_0028419 Ga0496103_0028419_2146_2949 257
192 3300048910 Ga0496107_0034322 Ga0496107_0034322_1068_1871 257
193 3300026089 Ga0207648_10498843 Ga0207648_104988432 258
194 3300039450 Ga0436363_1104748 Ga0436363_1104748_524_1324 258
195 3300046519 Ga0495632_0091263 Ga0495632_0091263_278_1078 258
196 3300005327 Ga0070658_10117554 Ga0070658_101175542 259
197 3300005530 Ga0070679_100029491 Ga0070679_1000294914 259
198 3300005616 Ga0068852_100069518 Ga0068852_1000695183 259
199 3300025920 Ga0207649_10124717 Ga0207649_101247172 259
200 3300026142 Ga0207698_10069474 Ga0207698_100694742 259
201 3300053131 Ga0500652_000003 Ga0500652_000003_147737_148549 261
202 3300013104 Ga0157370_10016819 Ga0157370_100168194 269
203 3300013105 Ga0157369_10001142 Ga0157369_1000114227 269
204 3300013307 Ga0157372_10124558 Ga0157372_101245583 269
205 3300002077 JGI24744J21845_10014539 JGI24744J21845_100145391 270
206 3300005329 Ga0070683_100039920 Ga0070683_1000399202 270
207 3300005330 Ga0070690_100028020 Ga0070690_1000280203 270
208 3300005331 Ga0070670_100107121 Ga0070670_1001071213 270
209 3300005331 Ga0070670_100708465 Ga0070670_1007084651 270
210 3300005333 Ga0070677_10013350 Ga0070677_100133503 270
211 3300005338 Ga0068868_100019650 Ga0068868_1000196504 270
212 3300005338 Ga0068868_100290949 Ga0068868_1002909491 270
213 3300005339 Ga0070660_100322698 Ga0070660_1003226981 270
214 3300005340 Ga0070689_100005467 Ga0070689_1000054676 270
215 3300005343 Ga0070687_100039745 Ga0070687_1000397452 270
216 3300005344 Ga0070661_100003386 Ga0070661_1000033869 270
217 3300005344 Ga0070661_100338201 Ga0070661_1003382011 270
218 3300005355 Ga0070671_100486304 Ga0070671_1004863042 270
219 3300005364 Ga0070673_100521527 Ga0070673_1005215272 270
220 3300005366 Ga0070659_100031113 Ga0070659_1000311132 270
221 3300005438 Ga0070701_10212600 Ga0070701_102126002 270
222 3300005441 Ga0070700_100097163 Ga0070700_1000971632 270
223 3300005455 Ga0070663_100102662 Ga0070663_1001026621 270
224 3300005459 Ga0068867_100099139 Ga0068867_1000991393 270
225 3300005466 Ga0070685_10082035 Ga0070685_100820351 270
226 3300005539 Ga0068853_100038566 Ga0068853_1000385664 270
227 3300005544 Ga0070686_100038405 Ga0070686_1000384052 270
228 3300005548 Ga0070665_100672225 Ga0070665_1006722252 270
229 3300005564 Ga0070664_100013715 Ga0070664_1000137156 270
230 3300005564 Ga0070664_100194846 Ga0070664_1001948462 270
231 3300005577 Ga0068857_100609285 Ga0068857_1006092852 270
232 3300005578 Ga0068854_100004450 Ga0068854_1000044508 270
233 3300005614 Ga0068856_100153156 Ga0068856_1001531563 270
234 3300005615 Ga0070702_100145991 Ga0070702_1001459912 270
235 3300005618 Ga0068864_100157015 Ga0068864_1001570153 270
236 3300005719 Ga0068861_100063039 Ga0068861_1000630392 270
237 3300005834 Ga0068851_10076729 Ga0068851_100767292 270
238 3300005840 Ga0068870_10030116 Ga0068870_100301164 270
239 3300005842 Ga0068858_100137124 Ga0068858_1001371242 270
240 3300005844 Ga0068862_100039456 Ga0068862_1000394565 270
241 3300006358 Ga0068871_100115027 Ga0068871_1001150272 270
242 3300006881 Ga0068865_100069017 Ga0068865_1000690172 270
243 3300009094 Ga0111539_10078244 Ga0111539_100782443 270
244 3300009176 Ga0105242_10676352 Ga0105242_106763521 270
245 3300009553 Ga0105249_10147993 Ga0105249_101479933 270
246 3300013105 Ga0157369_10030029 Ga0157369_100300296 270
247 3300013296 Ga0157374_10016749 Ga0157374_100167491 270
248 3300013296 Ga0157374_10054895 Ga0157374_100548954 270
249 3300013307 Ga0157372_10018596 Ga0157372_100185966 270
250 3300014745 Ga0157377_10053734 Ga0157377_100537343 270
251 3300014968 Ga0157379_10040688 Ga0157379_100406883 270
252 3300014969 Ga0157376_10098068 Ga0157376_100980683 270
253 3300017792 Ga0163161_10049131 Ga0163161_100491312 270
254 3300025271 Ga0207666_1007422 Ga0207666_10074222 270
255 3300025315 Ga0207697_10000341 Ga0207697_100003412 270
256 3300025321 Ga0207656_10001951 Ga0207656_100019516 270
257 3300025321 Ga0207656_10030297 Ga0207656_100302971 270
258 3300025893 Ga0207682_10000162 Ga0207682_1000016213 270
259 3300025901 Ga0207688_10000957 Ga0207688_1000095712 270
260 3300025904 Ga0207647_10162172 Ga0207647_101621722 270
261 3300025907 Ga0207645_10003016 Ga0207645_1000301614 270
262 3300025908 Ga0207643_10000330 Ga0207643_100003303 270
263 3300025919 Ga0207657_10141352 Ga0207657_101413522 270
264 3300025920 Ga0207649_10029593 Ga0207649_100295934 270
265 3300025925 Ga0207650_10099833 Ga0207650_100998331 270
266 3300025925 Ga0207650_10145472 Ga0207650_101454722 270
267 3300025925 Ga0207650_10182412 Ga0207650_101824121 270
268 3300025931 Ga0207644_10021514 Ga0207644_100215143 270
269 3300025932 Ga0207690_10054157 Ga0207690_100541573 270
270 3300025932 Ga0207690_10095327 Ga0207690_100953273 270
271 3300025933 Ga0207706_10069716 Ga0207706_100697163 270
272 3300025935 Ga0207709_10374697 Ga0207709_103746971 270
273 3300025936 Ga0207670_10317839 Ga0207670_103178391 270
274 3300025941 Ga0207711_10150118 Ga0207711_101501181 270
275 3300025942 Ga0207689_10003140 Ga0207689_100031405 270
276 3300025944 Ga0207661_10176197 Ga0207661_101761973 270
277 3300025945 Ga0207679_10142185 Ga0207679_101421853 270
278 3300025961 Ga0207712_10186630 Ga0207712_101866302 270
279 3300025981 Ga0207640_10079551 Ga0207640_100795512 270
280 3300026023 Ga0207677_10192757 Ga0207677_101927571 270
281 3300026067 Ga0207678_10000463 Ga0207678_1000046317 270
282 3300026075 Ga0207708_10000744 Ga0207708_1000074417 270
283 3300026078 Ga0207702_10150906 Ga0207702_101509062 270
284 3300026116 Ga0207674_10110565 Ga0207674_101105651 270
285 3300026118 Ga0207675_100002013 Ga0207675_1000020139 270
286 3300026121 Ga0207683_10198192 Ga0207683_101981922 270
287 3300026142 Ga0207698_10064401 Ga0207698_100644013 270
288 3300026142 Ga0207698_10238616 Ga0207698_102386161 270
289 3300028379 Ga0268266_10055783 Ga0268266_100557832 270
290 3300046539 Ga0495621_0024845 Ga0495621_0024845_1099_1935 270
291 3300048903 Ga0496100_0242478 Ga0496100_0242478_233_1069 270
292 3300048904 Ga0496101_0163506 Ga0496101_0163506_616_1452 270
293 3300048907 Ga0496104_0075650 Ga0496104_0075650_1635_2471 270
294 3300048908 Ga0496105_0163925 Ga0496105_0163925_871_1707 270
295 3300048909 Ga0496106_0040658 Ga0496106_0040658_998_1834 270
296 3300048911 Ga0496108_0066825 Ga0496108_0066825_305_1141 270
297 3300048912 Ga0496109_0196434 Ga0496109_0196434_612_1448 270
298 3300048913 Ga0496110_0086102 Ga0496110_0086102_1098_1934 270
299 3300048914 Ga0496111_0063118 Ga0496111_0063118_188_1024 270
300 3300048916 Ga0496113_0363544 Ga0496113_0363544_296_1132 270
301 3300048917 Ga0496114_0143409 Ga0496114_0143409_90_926 270
302 3300050511 nmdc:mga08y16_35749_c1 nmdc:mga08y16_35749_c1_1110_1946 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

72

199

0.93

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

185

304

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7573 41 262
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7388 68 264
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.7189 71 254
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7065 66 264
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6999 82 262
ID Description Score Start End Superfamily
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8774 83 262 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8524 80 262 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8477 80 268 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.844 80 262 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8399 79 262 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A542AGC5-F1-model_v4 NitT/TauT family transport system permease protein 0.9378 33 270 GO:0005886
GO:0055085
AF-A0A6L5FJC4-F1-model_v4 ABC transporter permease subunit 0.9336 37 268 GO:0005886
GO:0055085
AF-B9JM56-F1-model_v4 Taurine uptake ABC transporter 0.9264 37 270 GO:0005886
GO:0055085
AF-A0A368LB89-F1-model_v4 ABC transporter permease 0.9201 56 264 GO:0005886
GO:0055085
AF-A0A351G5Y2-F1-model_v4 Taurine ABC transporter permease 0.9181 27 264 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
80.53 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map