F396273
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 222 | 604 | 363 |
Family's Representative Sequence
| Representative Sequence | 3300005262|Ga0065165_1022628|Ga0065165_10226282 |
| Length | 381 |
| Sequence | MNMTVSNIDAHVEDVPAKRLKLRASELSKHYGPVIGLDRVSIDVHEGEFVSLLGPSGSGKTTLLTLIAGLVTPDSGQLWINEREATYLPIQKRDLGMVFQNYALFPHLSVAENIAFPLRMREVAETEIRVRVREALETIRLGHIADRLPQALSGGQQQRVALARCLVYKPSIILMDEPLGALDRNLREEMQYEIKELHRTLGTTIIYVTHDQDEAMTMSDRVCLMQSGGIIQLGTPQDLYFQPRTEFAAKFLGDSNFLDGKLIGFENDTAVLETLSGDRVLAPKSPAGLAPGSAVRIMFRPEHGAIGAAGAGPAANQMSAQVRDTVLVGGTRRIFFESPNGSPISLSCLSQFLPEGLERGRTMALSFPVSFTRYFFAGESR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 2 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 36 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 58 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 60 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 89 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 91 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 92 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 93 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 95 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 98 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 99 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 102 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 105 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 108 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 109 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 110 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 111 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 112 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 171 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 172 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 173 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 174 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 175 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 176 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 177 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 178 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 179 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 180 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 188 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 190 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 194 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 195 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 196 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 197 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 198 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 199 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 200 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 201 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 202 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 203 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 204 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 205 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 206 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 207 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 208 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 209 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 210 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 211 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 212 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 213 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 214 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 215 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 216 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 217 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 218 | 2941479691 | |||
| 219 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 220 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 221 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 222 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.39 |
| Metatranscriptomes | 0 |
| Isolates | 8.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.62 |
| Nodule | 1.66 |
| Rhizoplane | 0.33 |
| Rhizosphere | 75.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065165_1022628 | 3300005262 | Bacteria | 2150 |
| 2 | Ga0055529_1000807 | 3300003763 | Bacteria | 19078 |
| 3 | Ga0070676_10003591 | 3300005328 | Bacteria | 8106 |
| 4 | Ga0070677_10014100 | 3300005333 | Bacteria | 2807 |
| 5 | Ga0068869_100001419 | 3300005334 | Bacteria | 14188 |
| 6 | Ga0070666_10106423 | 3300005335 | Bacteria | 1938 |
| 7 | Ga0068868_100123741 | 3300005338 | Bacteria | 2111 |
| 8 | Ga0068868_100266246 | 3300005338 | Bacteria | 1447 |
| 9 | Ga0070668_100000760 | 3300005347 | Bacteria | 22136 |
| 10 | Ga0070669_100003414 | 3300005353 | Bacteria | 11438 |
| 11 | Ga0070671_100227408 | 3300005355 | Bacteria | 1583 |
| 12 | Ga0070674_100002302 | 3300005356 | Bacteria | 10550 |
| 13 | Ga0070667_100004847 | 3300005367 | Bacteria | 11273 |
| 14 | Ga0070705_100029255 | 3300005440 | Bacteria | 3027 |
| 15 | Ga0070708_100032489 | 3300005445 | Bacteria | 4528 |
| 16 | Ga0070708_100039258 | 3300005445 | Bacteria | 4141 |
| 17 | Ga0070663_100111798 | 3300005455 | Bacteria | 2053 |
| 18 | Ga0070678_100150805 | 3300005456 | Bacteria | 1872 |
| 19 | Ga0070662_100009897 | 3300005457 | Bacteria | 6245 |
| 20 | Ga0070662_100366348 | 3300005457 | Bacteria | 1183 |
| 21 | Ga0068867_100014058 | 3300005459 | Bacteria | 5669 |
| 22 | Ga0068867_100056227 | 3300005459 | Bacteria | 2911 |
| 23 | Ga0070706_100051170 | 3300005467 | Bacteria | 3812 |
| 24 | Ga0070707_100174721 | 3300005468 | Bacteria | 2093 |
| 25 | Ga0070698_100065975 | 3300005471 | Bacteria | 3644 |
| 26 | Ga0070699_100036426 | 3300005518 | Bacteria | 4256 |
| 27 | Ga0070684_100410932 | 3300005535 | Bacteria | 1249 |
| 28 | Ga0070697_100198939 | 3300005536 | Bacteria | 1703 |
| 29 | Ga0070672_100003647 | 3300005543 | Bacteria | 10000 |
| 30 | Ga0070664_100166631 | 3300005564 | Bacteria | 1952 |
| 31 | Ga0068854_100145500 | 3300005578 | Bacteria | 1823 |
| 32 | Ga0068852_100061752 | 3300005616 | Bacteria | 3257 |
| 33 | Ga0068864_100002152 | 3300005618 | Bacteria | 16277 |
| 34 | Ga0068864_100029015 | 3300005618 | Bacteria | 4681 |
| 35 | Ga0068866_10000902 | 3300005718 | Bacteria | 13094 |
| 36 | Ga0068861_100004108 | 3300005719 | Bacteria | 9766 |
| 37 | Ga0068863_100000783 | 3300005841 | Bacteria | 31944 |
| 38 | Ga0068863_100059877 | 3300005841 | Bacteria | 3603 |
| 39 | Ga0068858_100001938 | 3300005842 | Bacteria | 21099 |
| 40 | Ga0068858_100042428 | 3300005842 | Bacteria | 4218 |
| 41 | Ga0068860_100009197 | 3300005843 | Bacteria | 9820 |
| 42 | Ga0068860_100245270 | 3300005843 | Bacteria | 1743 |
| 43 | Ga0075365_10018827 | 3300006038 | Bacteria | 4253 |
| 44 | Ga0075363_100020286 | 3300006048 | Bacteria | 3332 |
| 45 | Ga0075364_10000299 | 3300006051 | Bacteria | 24099 |
| 46 | Ga0075364_10109120 | 3300006051 | Bacteria | 1846 |
| 47 | Ga0070716_100002156 | 3300006173 | Bacteria | 9047 |
| 48 | Ga0075362_10021350 | 3300006177 | Bacteria | 2715 |
| 49 | Ga0075367_10019988 | 3300006178 | Bacteria | 3723 |
| 50 | Ga0075366_10028863 | 3300006195 | Bacteria | 3257 |
| 51 | Ga0075434_100005553 | 3300006871 | Bacteria | 11492 |
| 52 | Ga0068865_100013588 | 3300006881 | Bacteria | 5151 |
| 53 | Ga0075435_100003946 | 3300007076 | Bacteria | 10139 |
| 54 | Ga0099794_10034400 | 3300007265 | Bacteria | 2387 |
| 55 | Ga0105244_10010401 | 3300009036 | Bacteria | 5645 |
| 56 | Ga0105245_10061884 | 3300009098 | Bacteria | 3376 |
| 57 | Ga0105245_10448376 | 3300009098 | Bacteria | 1298 |
| 58 | Ga0105243_10009954 | 3300009148 | Bacteria | 7227 |
| 59 | Ga0105243_10155162 | 3300009148 | Bacteria | 1968 |
| 60 | Ga0105242_10007756 | 3300009176 | Bacteria | 8258 |
| 61 | Ga0105237_10015728 | 3300009545 | Bacteria | 7866 |
| 62 | Ga0105238_10451517 | 3300009551 | Bacteria | 1282 |
| 63 | Ga0105249_10006557 | 3300009553 | Bacteria | 10128 |
| 64 | Ga0105239_10010483 | 3300010375 | Bacteria | 10361 |
| 65 | Ga0157373_10023224 | 3300013100 | Bacteria | 4497 |
| 66 | Ga0163162_10003129 | 3300013306 | Bacteria | 15806 |
| 67 | Ga0163162_10005956 | 3300013306 | Bacteria | 11803 |
| 68 | Ga0163162_10165487 | 3300013306 | Bacteria | 2335 |
| 69 | Ga0163162_10196280 | 3300013306 | Bacteria | 2147 |
| 70 | Ga0157380_10016242 | 3300014326 | Bacteria | 5484 |
| 71 | Ga0183361_10002 | 3300016635 | Bacteria | 907642 |
| 72 | Ga0163161_10000072 | 3300017792 | Bacteria | 102352 |
| 73 | Ga0209435_106846 | 3300025206 | Bacteria | 1266 |
| 74 | Ga0209258_103435 | 3300025242 | Bacteria | 3415 |
| 75 | Ga0209455_1000325 | 3300025272 | Bacteria | 46601 |
| 76 | Ga0209051_1030421 | 3300025303 | Bacteria | 2095 |
| 77 | Ga0207642_10013080 | 3300025899 | Bacteria | 3016 |
| 78 | Ga0207680_10194608 | 3300025903 | Bacteria | 1378 |
| 79 | Ga0207645_10000991 | 3300025907 | Bacteria | 23445 |
| 80 | Ga0207684_10044273 | 3300025910 | Bacteria | 3774 |
| 81 | Ga0207662_10004569 | 3300025918 | Bacteria | 7296 |
| 82 | Ga0207681_10002446 | 3300025923 | Bacteria | 11773 |
| 83 | Ga0207659_10002725 | 3300025926 | Bacteria | 10535 |
| 84 | Ga0207644_10036139 | 3300025931 | Bacteria | 3466 |
| 85 | Ga0207706_10020215 | 3300025933 | Bacteria | 5985 |
| 86 | Ga0207686_10008385 | 3300025934 | Bacteria | 5578 |
| 87 | Ga0207669_10001042 | 3300025937 | Bacteria | 11839 |
| 88 | Ga0207704_10000481 | 3300025938 | Bacteria | 17780 |
| 89 | Ga0207665_10031010 | 3300025939 | Bacteria | 3537 |
| 90 | Ga0207691_10007506 | 3300025940 | Bacteria | 10495 |
| 91 | Ga0207689_10001694 | 3300025942 | Bacteria | 20950 |
| 92 | Ga0207712_10001131 | 3300025961 | Bacteria | 18584 |
| 93 | Ga0207658_10000803 | 3300025986 | Bacteria | 26405 |
| 94 | Ga0207658_10093806 | 3300025986 | Bacteria | 2334 |
| 95 | Ga0207641_10004330 | 3300026088 | Bacteria | 12325 |
| 96 | Ga0207641_10163086 | 3300026088 | Bacteria | 2028 |
| 97 | Ga0207648_10008467 | 3300026089 | Bacteria | 9955 |
| 98 | Ga0207675_100001498 | 3300026118 | Bacteria | 23384 |
| 99 | Ga0207675_100259001 | 3300026118 | Bacteria | 1685 |
| 100 | Ga0207683_10018928 | 3300026121 | Bacteria | 5875 |
| 101 | Ga0207698_10251639 | 3300026142 | Bacteria | 1617 |
| 102 | Ga0209371_1008314 | 3300027312 | Bacteria | 3469 |
| 103 | Ga0268265_10020427 | 3300028380 | Bacteria | 4622 |
| 104 | Ga0268264_10050889 | 3300028381 | Bacteria | 3451 |
| 105 | Ga0307515_10000996 | 3300028794 | Bacteria | 64755 |
| 106 | Ga0307515_10111856 | 3300028794 | Bacteria | 3182 |
| 107 | Ga0307515_10289692 | 3300028794 | Bacteria | 1334 |
| 108 | Ga0268256_1008629 | 3300030500 | Bacteria | 3469 |
| 109 | Ga0307513_10005429 | 3300031456 | Bacteria | 16849 |
| 110 | Ga0307513_10039824 | 3300031456 | Bacteria | 5204 |
| 111 | Ga0307513_10188647 | 3300031456 | Bacteria | 1916 |
| 112 | Ga0307408_100024536 | 3300031548 | Bacteria | 4119 |
| 113 | Ga0307408_100063070 | 3300031548 | Bacteria | 2710 |
| 114 | Ga0307514_10003801 | 3300031649 | Bacteria | 14211 |
| 115 | Ga0307405_10020113 | 3300031731 | Bacteria | 3724 |
| 116 | Ga0307405_10020510 | 3300031731 | Bacteria | 3695 |
| 117 | Ga0307405_10033490 | 3300031731 | Bacteria | 3048 |
| 118 | Ga0307410_10011303 | 3300031852 | Bacteria | 5100 |
| 119 | Ga0307406_10020170 | 3300031901 | Bacteria | 3921 |
| 120 | Ga0307412_10000123 | 3300031911 | Bacteria | 59156 |
| 121 | Ga0307412_10058908 | 3300031911 | Bacteria | 2571 |
| 122 | Ga0307409_100008411 | 3300031995 | Bacteria | 6260 |
| 123 | Ga0307416_100001236 | 3300032002 | Bacteria | 13784 |
| 124 | Ga0307416_100022454 | 3300032002 | Bacteria | 4556 |
| 125 | Ga0307414_10071871 | 3300032004 | Bacteria | 2497 |
| 126 | Ga0307411_10010139 | 3300032005 | Bacteria | 5004 |
| 127 | Ga0307411_10018282 | 3300032005 | Bacteria | 4017 |
| 128 | Ga0307415_100003696 | 3300032126 | Bacteria | 7830 |
| 129 | Ga0395899_0031512 | 3300037312 | Bacteria | 3984 |
| 130 | Ga0395900_0016916 | 3300037418 | Bacteria | 7444 |
| 131 | Ga0395898_0002270 | 3300037466 | Bacteria | 23261 |
| 132 | Ga0395905_0000025 | 3300037471 | Bacteria | 317571 |
| 133 | Ga0395905_0186163 | 3300037471 | Bacteria | 1948 |
| 134 | Ga0395905_0310467 | 3300037471 | Bacteria | 1465 |
| 135 | Ga0395901_0000434 | 3300038443 | Bacteria | 48945 |
| 136 | Ga0395901_0691174 | 3300038443 | Bacteria | 1019 |
| 137 | Ga0439436_0022954 | 3300041404 | Bacteria | 1847 |
| 138 | Ga0439461_0005238 | 3300041410 | Bacteria | 2202 |
| 139 | Ga0439458_0021233 | 3300042157 | Bacteria | 1502 |
| 140 | Ga0439464_0007090 | 3300042439 | Bacteria | 2929 |
| 141 | Ga0466977_0002085 | 3300044666 | Bacteria | 8893 |
| 142 | Ga0495592_0000229 | 3300046454 | Bacteria | 48485 |
| 143 | Ga0495592_0035485 | 3300046454 | Bacteria | 3758 |
| 144 | Ga0495603_0031347 | 3300046455 | Bacteria | 3200 |
| 145 | Ga0495591_000101 | 3300046458 | Bacteria | 99240 |
| 146 | Ga0495629_0001559 | 3300046459 | Bacteria | 18009 |
| 147 | Ga0495629_0003820 | 3300046459 | Bacteria | 11357 |
| 148 | Ga0495629_0089034 | 3300046459 | Bacteria | 2154 |
| 149 | Ga0495651_0000858 | 3300046462 | Bacteria | 23552 |
| 150 | Ga0495653_0016140 | 3300046463 | Bacteria | 6084 |
| 151 | Ga0495580_0001309 | 3300046472 | Bacteria | 21990 |
| 152 | Ga0495580_0004199 | 3300046472 | Bacteria | 12113 |
| 153 | Ga0495582_0001818 | 3300046473 | Bacteria | 12061 |
| 154 | Ga0495582_0034808 | 3300046473 | Bacteria | 2768 |
| 155 | Ga0495662_0002777 | 3300046476 | Bacteria | 8858 |
| 156 | Ga0495662_0050527 | 3300046476 | Bacteria | 2007 |
| 157 | Ga0495664_0000769 | 3300046477 | Bacteria | 16399 |
| 158 | Ga0495664_0049382 | 3300046477 | Bacteria | 2497 |
| 159 | Ga0495596_0000146 | 3300046500 | Bacteria | 48977 |
| 160 | Ga0495607_0000004 | 3300046501 | Bacteria | 317271 |
| 161 | Ga0495606_0115558 | 3300046507 | Bacteria | 1613 |
| 162 | Ga0495608_0000241 | 3300046511 | Bacteria | 39695 |
| 163 | Ga0495618_0009655 | 3300046514 | Bacteria | 5825 |
| 164 | Ga0495618_0011848 | 3300046514 | Bacteria | 5292 |
| 165 | Ga0495628_0003810 | 3300046516 | Bacteria | 13432 |
| 166 | Ga0495628_0014739 | 3300046516 | Bacteria | 6543 |
| 167 | Ga0495628_0145454 | 3300046516 | Bacteria | 1807 |
| 168 | Ga0495630_0000147 | 3300046517 | Bacteria | 54656 |
| 169 | Ga0495632_0018795 | 3300046519 | Bacteria | 3782 |
| 170 | Ga0495648_0000164 | 3300046524 | Bacteria | 78546 |
| 171 | Ga0495648_0002963 | 3300046524 | Bacteria | 15236 |
| 172 | Ga0495666_0002105 | 3300046526 | Bacteria | 9868 |
| 173 | Ga0495666_0005907 | 3300046526 | Bacteria | 6167 |
| 174 | Ga0495652_0012866 | 3300046529 | Bacteria | 7538 |
| 175 | Ga0495665_0001305 | 3300046531 | Bacteria | 13281 |
| 176 | Ga0495665_0003673 | 3300046531 | Bacteria | 8320 |
| 177 | Ga0495640_0008654 | 3300046533 | Bacteria | 7976 |
| 178 | Ga0495640_0008786 | 3300046533 | Bacteria | 7906 |
| 179 | Ga0495586_0004455 | 3300046535 | Bacteria | 7479 |
| 180 | Ga0495587_0001027 | 3300046536 | Bacteria | 18351 |
| 181 | Ga0495587_0003706 | 3300046536 | Bacteria | 10152 |
| 182 | Ga0495645_0011019 | 3300046543 | Bacteria | 6354 |
| 183 | Ga0495645_0177412 | 3300046543 | Bacteria | 1462 |
| 184 | Ga0495622_0000029 | 3300046557 | Bacteria | 130861 |
| 185 | Ga0495633_0001934 | 3300046558 | Bacteria | 15069 |
| 186 | Ga0495667_0020927 | 3300046559 | Bacteria | 4414 |
| 187 | Ga0495634_0001293 | 3300046642 | Bacteria | 22871 |
| 188 | Ga0495634_0008067 | 3300046642 | Bacteria | 7855 |
| 189 | Ga0495611_0108723 | 3300046648 | Bacteria | 1290 |
| 190 | Ga0495625_0034028 | 3300046660 | Bacteria | 3762 |
| 191 | Ga0495635_0000218 | 3300046663 | Bacteria | 36175 |
| 192 | Ga0495635_0003794 | 3300046663 | Bacteria | 10498 |
| 193 | Ga0495661_0001002 | 3300046665 | Bacteria | 25389 |
| 194 | Ga0495661_0063652 | 3300046665 | Bacteria | 2179 |
| 195 | Ga0495599_0006962 | 3300046678 | Bacteria | 6840 |
| 196 | Ga0495623_0002426 | 3300046679 | Bacteria | 12354 |
| 197 | Ga0495646_0000478 | 3300046680 | Bacteria | 21305 |
| 198 | Ga0495646_0012026 | 3300046680 | Bacteria | 5506 |
| 199 | Ga0495613_0000604 | 3300046689 | Bacteria | 28806 |
| 200 | Ga0495613_0001125 | 3300046689 | Bacteria | 20365 |
| 201 | Ga0495613_0022227 | 3300046689 | Bacteria | 4726 |
| 202 | Ga0495624_0000869 | 3300046690 | Bacteria | 23955 |
| 203 | Ga0495624_0028916 | 3300046690 | Bacteria | 3617 |
| 204 | Ga0495649_0001856 | 3300046694 | Bacteria | 15480 |
| 205 | Ga0495589_0000213 | 3300046794 | Bacteria | 49333 |
| 206 | Ga0495589_0012173 | 3300046794 | Bacteria | 4461 |
| 207 | Ga0495600_0000806 | 3300046809 | Bacteria | 16629 |
| 208 | Ga0495600_0096949 | 3300046809 | Bacteria | 1922 |
| 209 | Ga0495600_0170852 | 3300046809 | Bacteria | 1403 |
| 210 | Ga0495581_0001660 | 3300047315 | Bacteria | 12396 |
| 211 | Ga0495581_0008200 | 3300047315 | Bacteria | 6053 |
| 212 | Ga0495604_0002038 | 3300047317 | Bacteria | 16329 |
| 213 | Ga0495604_0002559 | 3300047317 | Bacteria | 14545 |
| 214 | Ga0495674_0007831 | 3300047319 | Bacteria | 10200 |
| 215 | Ga0495672_0001483 | 3300047320 | Bacteria | 23008 |
| 216 | Ga0495676_0001988 | 3300047321 | Bacteria | 17979 |
| 217 | Ga0495676_0010010 | 3300047321 | Bacteria | 8613 |
| 218 | Ga0495680_0011396 | 3300047322 | Bacteria | 7870 |
| 219 | Ga0495680_0034984 | 3300047322 | Bacteria | 4050 |
| 220 | Ga0495683_0000936 | 3300047323 | Bacteria | 20571 |
| 221 | Ga0495687_021513 | 3300047443 | Bacteria | 3117 |
| 222 | Ga0495675_0000151 | 3300047444 | Bacteria | 48734 |
| 223 | Ga0495675_0003462 | 3300047444 | Bacteria | 9513 |
| 224 | Ga0495679_000093 | 3300047446 | Bacteria | 81614 |
| 225 | Ga0495679_001596 | 3300047446 | Bacteria | 12737 |
| 226 | Ga0495673_0002273 | 3300047469 | Bacteria | 13779 |
| 227 | Ga0495681_0007809 | 3300047470 | Bacteria | 6776 |
| 228 | Ga0495681_0040708 | 3300047470 | Bacteria | 2261 |
| 229 | Ga0495686_0000044 | 3300047472 | Bacteria | 288079 |
| 230 | Ga0495593_0000339 | 3300047673 | Bacteria | 25912 |
| 231 | Ga0495593_0002241 | 3300047673 | Bacteria | 11594 |
| 232 | Ga0495602_0011631 | 3300048088 | Bacteria | 9090 |
| 233 | Ga0495614_0004341 | 3300048089 | Bacteria | 6391 |
| 234 | Ga0495614_0037528 | 3300048089 | Bacteria | 2078 |
| 235 | Ga0496116_0000570 | 3300048919 | Bacteria | 49416 |
| 236 | Ga0496117_0007098 | 3300048920 | Bacteria | 11071 |
| 237 | Ga0496117_0094958 | 3300048920 | Bacteria | 1907 |
| 238 | Ga0496118_0000175 | 3300048921 | Bacteria | 115396 |
| 239 | Ga0496118_0023359 | 3300048921 | Bacteria | 5372 |
| 240 | Ga0496118_0027029 | 3300048921 | Bacteria | 4867 |
| 241 | Ga0496119_0035795 | 3300048922 | Bacteria | 3248 |
| 242 | Ga0496119_0044176 | 3300048922 | Bacteria | 2808 |
| 243 | Ga0496120_0012275 | 3300048923 | Bacteria | 5839 |
| 244 | Ga0496121_0008395 | 3300048924 | Bacteria | 12174 |
| 245 | Ga0496121_0034168 | 3300048924 | Bacteria | 4581 |
| 246 | Ga0496122_0002024 | 3300048925 | Bacteria | 30109 |
| 247 | Ga0496122_0051723 | 3300048925 | Bacteria | 3118 |
| 248 | Ga0496122_0103729 | 3300048925 | Bacteria | 1891 |
| 249 | Ga0496123_0001765 | 3300048926 | Bacteria | 28531 |
| 250 | Ga0496123_0014547 | 3300048926 | Bacteria | 6513 |
| 251 | Ga0496125_0000023 | 3300048928 | Bacteria | 449042 |
| 252 | Ga0496125_0018655 | 3300048928 | Bacteria | 6582 |
| 253 | Ga0496125_0040144 | 3300048928 | Bacteria | 4018 |
| 254 | Ga0496125_0061704 | 3300048928 | Bacteria | 3005 |
| 255 | Ga0496126_0164938 | 3300048929 | Bacteria | 1891 |
| 256 | Ga0495682_0007807 | 3300049460 | Bacteria | 4238 |
| 257 | Ga0501033_0028707 | 3300049570 | Bacteria | 4180 |
| 258 | Ga0501033_0121876 | 3300049570 | Bacteria | 1892 |
| 259 | Ga0501037_0205042 | 3300049573 | Bacteria | 1392 |
| 260 | Ga0501070_0000156 | 3300049586 | Bacteria | 62807 |
| 261 | Ga0501080_0000994 | 3300049742 | Bacteria | 23239 |
| 262 | Ga0501035_0017646 | 3300049822 | Bacteria | 6583 |
| 263 | Ga0501044_0014922 | 3300049823 | Bacteria | 8377 |
| 264 | Ga0501044_0023059 | 3300049823 | Bacteria | 6625 |
| 265 | nmdc:mga03n38_96655_c1 | 3300050490 | Bacteria | 1417 |
| 266 | nmdc:mga00v17_4775_c1 | 3300050491 | Bacteria | 7094 |
| 267 | nmdc:mga00v17_5415_c1 | 3300050491 | Bacteria | 6723 |
| 268 | nmdc:mga06z11_3766_c1 | 3300050494 | Bacteria | 5897 |
| 269 | nmdc:mga0rr50_31684_c1 | 3300050513 | Bacteria | 3759 |
| 270 | Ga0500644_0001936 | 3300053088 | Bacteria | 5299 |
| 271 | Ga0500618_000107 | 3300053125 | Bacteria | 67707 |
| 272 | Ga0500618_004481 | 3300053125 | Bacteria | 4446 |
| 273 | Ga0500658_0000873 | 3300053134 | Bacteria | 12373 |
| 274 | Ga0500590_003715 | 3300053148 | Bacteria | 7090 |
| 275 | Ga0500616_0014537 | 3300053153 | Bacteria | 4521 |
| 276 | Ga0500634_0000005 | 3300053161 | Bacteria | 184092 |
| 277 | 2501075628 | 2501025501 | Bacteria | 7768574 |
| 278 | 2501407482 | 2501025504 | Bacteria | 8008976 |
| 279 | 2511097354 | 2510917014 | Bacteria | 8296963 |
| 280 | 2511105703 | 2510917015 | Bacteria | 7950052 |
| 281 | 2511383219 | 2511231026 | Bacteria | 5225445 |
| 282 | 2513591633 | 2513237087 | Bacteria | 5817514 |
| 283 | 2585324325 | 2582581315 | Bacteria | 7318924 |
| 284 | 2599100603 | 2597490356 | Bacteria | 7030811 |
| 285 | 2599905956 | 2599185292 | Bacteria | 6290804 |
| 286 | 2644122921 | 2643221621 | Bacteria | 6212786 |
| 287 | 2644147912 | 2643221626 | Bacteria | 8069654 |
| 288 | 2723877181 | 2721755763 | Bacteria | 4464185 |
| 289 | 2746087699 | 2744054900 | Bacteria | 8399525 |
| 290 | 2746098973 | 2744054901 | Bacteria | 8397047 |
| 291 | 2842327646 | 2842324504 | Bacteria | 9364110 |
| 292 | 2842351747 | 2842348783 | Bacteria | 9002918 |
| 293 | 2842460729 | 2842454564 | Bacteria | 8730687 |
| 294 | 2848863585 | 2848858292 | Bacteria | 7391279 |
| 295 | 2856293404 | 2856287931 | Bacteria | 7223934 |
| 296 | 2857578711 | 2857576091 | Bacteria | 5465855 |
| 297 | 2901312929 | 2901300506 | Bacteria | 8463898 |
| 298 | 2941479694 | |||
| 299 | 2941503091 | 2941499720 | Bacteria | 7599444 |
| 300 | 8016593505 | 8016583857 | Bacteria | 10421953 |
| 301 | 8046772848 | 8046767195 | Bacteria | 7547379 |
| 302 | 8054005736 | 8054002106 | Bacteria | 7987183 |
| 303 | Ga0065165_1022628 | |||
| 304 | Ga0055529_1000807 | |||
| 305 | Ga0070676_10003591 | |||
| 306 | Ga0070677_10014100 | |||
| 307 | Ga0068869_100001419 | |||
| 308 | Ga0070666_10106423 | |||
| 309 | Ga0068868_100123741 | |||
| 310 | Ga0068868_100266246 | |||
| 311 | Ga0070668_100000760 | |||
| 312 | Ga0070669_100003414 | |||
| 313 | Ga0070671_100227408 | |||
| 314 | Ga0070674_100002302 | |||
| 315 | Ga0070667_100004847 | |||
| 316 | Ga0070705_100029255 | |||
| 317 | Ga0070708_100032489 | |||
| 318 | Ga0070708_100039258 | |||
| 319 | Ga0070663_100111798 | |||
| 320 | Ga0070678_100150805 | |||
| 321 | Ga0070662_100009897 | |||
| 322 | Ga0070662_100366348 | |||
| 323 | Ga0068867_100014058 | |||
| 324 | Ga0068867_100056227 | |||
| 325 | Ga0070706_100051170 | |||
| 326 | Ga0070707_100174721 | |||
| 327 | Ga0070698_100065975 | |||
| 328 | Ga0070699_100036426 | |||
| 329 | Ga0070684_100410932 | |||
| 330 | Ga0070697_100198939 | |||
| 331 | Ga0070672_100003647 | |||
| 332 | Ga0070664_100166631 | |||
| 333 | Ga0068854_100145500 | |||
| 334 | Ga0068852_100061752 | |||
| 335 | Ga0068864_100002152 | |||
| 336 | Ga0068864_100029015 | |||
| 337 | Ga0068866_10000902 | |||
| 338 | Ga0068861_100004108 | |||
| 339 | Ga0068863_100000783 | |||
| 340 | Ga0068863_100059877 | |||
| 341 | Ga0068858_100001938 | |||
| 342 | Ga0068858_100042428 | |||
| 343 | Ga0068860_100009197 | |||
| 344 | Ga0068860_100245270 | |||
| 345 | Ga0075365_10018827 | |||
| 346 | Ga0075363_100020286 | |||
| 347 | Ga0075364_10000299 | |||
| 348 | Ga0075364_10109120 | |||
| 349 | Ga0070716_100002156 | |||
| 350 | Ga0075362_10021350 | |||
| 351 | Ga0075367_10019988 | |||
| 352 | Ga0075366_10028863 | |||
| 353 | Ga0075434_100005553 | |||
| 354 | Ga0068865_100013588 | |||
| 355 | Ga0075435_100003946 | |||
| 356 | Ga0099794_10034400 | |||
| 357 | Ga0105244_10010401 | |||
| 358 | Ga0105245_10061884 | |||
| 359 | Ga0105245_10448376 | |||
| 360 | Ga0105243_10009954 | |||
| 361 | Ga0105243_10155162 | |||
| 362 | Ga0105242_10007756 | |||
| 363 | Ga0105237_10015728 | |||
| 364 | Ga0105238_10451517 | |||
| 365 | Ga0105249_10006557 | |||
| 366 | Ga0105239_10010483 | |||
| 367 | Ga0157373_10023224 | |||
| 368 | Ga0163162_10003129 | |||
| 369 | Ga0163162_10005956 | |||
| 370 | Ga0163162_10165487 | |||
| 371 | Ga0163162_10196280 | |||
| 372 | Ga0157380_10016242 | |||
| 373 | Ga0183361_10002 | |||
| 374 | Ga0163161_10000072 | |||
| 375 | Ga0209435_106846 | |||
| 376 | Ga0209258_103435 | |||
| 377 | Ga0209455_1000325 | |||
| 378 | Ga0209051_1030421 | |||
| 379 | Ga0207642_10013080 | |||
| 380 | Ga0207680_10194608 | |||
| 381 | Ga0207645_10000991 | |||
| 382 | Ga0207684_10044273 | |||
| 383 | Ga0207662_10004569 | |||
| 384 | Ga0207681_10002446 | |||
| 385 | Ga0207659_10002725 | |||
| 386 | Ga0207644_10036139 | |||
| 387 | Ga0207706_10020215 | |||
| 388 | Ga0207686_10008385 | |||
| 389 | Ga0207669_10001042 | |||
| 390 | Ga0207704_10000481 | |||
| 391 | Ga0207665_10031010 | |||
| 392 | Ga0207691_10007506 | |||
| 393 | Ga0207689_10001694 | |||
| 394 | Ga0207712_10001131 | |||
| 395 | Ga0207658_10000803 | |||
| 396 | Ga0207658_10093806 | |||
| 397 | Ga0207641_10004330 | |||
| 398 | Ga0207641_10163086 | |||
| 399 | Ga0207648_10008467 | |||
| 400 | Ga0207675_100001498 | |||
| 401 | Ga0207675_100259001 | |||
| 402 | Ga0207683_10018928 | |||
| 403 | Ga0207698_10251639 | |||
| 404 | Ga0209371_1008314 | |||
| 405 | Ga0268265_10020427 | |||
| 406 | Ga0268264_10050889 | |||
| 407 | Ga0307515_10000996 | |||
| 408 | Ga0307515_10111856 | |||
| 409 | Ga0307515_10289692 | |||
| 410 | Ga0268256_1008629 | |||
| 411 | Ga0307513_10005429 | |||
| 412 | Ga0307513_10039824 | |||
| 413 | Ga0307513_10188647 | |||
| 414 | Ga0307408_100024536 | |||
| 415 | Ga0307408_100063070 | |||
| 416 | Ga0307514_10003801 | |||
| 417 | Ga0307405_10020113 | |||
| 418 | Ga0307405_10020510 | |||
| 419 | Ga0307405_10033490 | |||
| 420 | Ga0307410_10011303 | |||
| 421 | Ga0307406_10020170 | |||
| 422 | Ga0307412_10000123 | |||
| 423 | Ga0307412_10058908 | |||
| 424 | Ga0307409_100008411 | |||
| 425 | Ga0307416_100001236 | |||
| 426 | Ga0307416_100022454 | |||
| 427 | Ga0307414_10071871 | |||
| 428 | Ga0307411_10010139 | |||
| 429 | Ga0307411_10018282 | |||
| 430 | Ga0307415_100003696 | |||
| 431 | Ga0395899_0031512 | |||
| 432 | Ga0395900_0016916 | |||
| 433 | Ga0395898_0002270 | |||
| 434 | Ga0395905_0000025 | |||
| 435 | Ga0395905_0186163 | |||
| 436 | Ga0395905_0310467 | |||
| 437 | Ga0395901_0000434 | |||
| 438 | Ga0395901_0691174 | |||
| 439 | Ga0439436_0022954 | |||
| 440 | Ga0439461_0005238 | |||
| 441 | Ga0439458_0021233 | |||
| 442 | Ga0439464_0007090 | |||
| 443 | Ga0466977_0002085 | |||
| 444 | Ga0495592_0000229 | |||
| 445 | Ga0495592_0035485 | |||
| 446 | Ga0495603_0031347 | |||
| 447 | Ga0495591_000101 | |||
| 448 | Ga0495629_0001559 | |||
| 449 | Ga0495629_0003820 | |||
| 450 | Ga0495629_0089034 | |||
| 451 | Ga0495651_0000858 | |||
| 452 | Ga0495653_0016140 | |||
| 453 | Ga0495580_0001309 | |||
| 454 | Ga0495580_0004199 | |||
| 455 | Ga0495582_0001818 | |||
| 456 | Ga0495582_0034808 | |||
| 457 | Ga0495662_0002777 | |||
| 458 | Ga0495662_0050527 | |||
| 459 | Ga0495664_0000769 | |||
| 460 | Ga0495664_0049382 | |||
| 461 | Ga0495596_0000146 | |||
| 462 | Ga0495607_0000004 | |||
| 463 | Ga0495606_0115558 | |||
| 464 | Ga0495608_0000241 | |||
| 465 | Ga0495618_0009655 | |||
| 466 | Ga0495618_0011848 | |||
| 467 | Ga0495628_0003810 | |||
| 468 | Ga0495628_0014739 | |||
| 469 | Ga0495628_0145454 | |||
| 470 | Ga0495630_0000147 | |||
| 471 | Ga0495632_0018795 | |||
| 472 | Ga0495648_0000164 | |||
| 473 | Ga0495648_0002963 | |||
| 474 | Ga0495666_0002105 | |||
| 475 | Ga0495666_0005907 | |||
| 476 | Ga0495652_0012866 | |||
| 477 | Ga0495665_0001305 | |||
| 478 | Ga0495665_0003673 | |||
| 479 | Ga0495640_0008654 | |||
| 480 | Ga0495640_0008786 | |||
| 481 | Ga0495586_0004455 | |||
| 482 | Ga0495587_0001027 | |||
| 483 | Ga0495587_0003706 | |||
| 484 | Ga0495645_0011019 | |||
| 485 | Ga0495645_0177412 | |||
| 486 | Ga0495622_0000029 | |||
| 487 | Ga0495633_0001934 | |||
| 488 | Ga0495667_0020927 | |||
| 489 | Ga0495634_0001293 | |||
| 490 | Ga0495634_0008067 | |||
| 491 | Ga0495611_0108723 | |||
| 492 | Ga0495625_0034028 | |||
| 493 | Ga0495635_0000218 | |||
| 494 | Ga0495635_0003794 | |||
| 495 | Ga0495661_0001002 | |||
| 496 | Ga0495661_0063652 | |||
| 497 | Ga0495599_0006962 | |||
| 498 | Ga0495623_0002426 | |||
| 499 | Ga0495646_0000478 | |||
| 500 | Ga0495646_0012026 | |||
| 501 | Ga0495613_0000604 | |||
| 502 | Ga0495613_0001125 | |||
| 503 | Ga0495613_0022227 | |||
| 504 | Ga0495624_0000869 | |||
| 505 | Ga0495624_0028916 | |||
| 506 | Ga0495649_0001856 | |||
| 507 | Ga0495589_0000213 | |||
| 508 | Ga0495589_0012173 | |||
| 509 | Ga0495600_0000806 | |||
| 510 | Ga0495600_0096949 | |||
| 511 | Ga0495600_0170852 | |||
| 512 | Ga0495581_0001660 | |||
| 513 | Ga0495581_0008200 | |||
| 514 | Ga0495604_0002038 | |||
| 515 | Ga0495604_0002559 | |||
| 516 | Ga0495674_0007831 | |||
| 517 | Ga0495672_0001483 | |||
| 518 | Ga0495676_0001988 | |||
| 519 | Ga0495676_0010010 | |||
| 520 | Ga0495680_0011396 | |||
| 521 | Ga0495680_0034984 | |||
| 522 | Ga0495683_0000936 | |||
| 523 | Ga0495687_021513 | |||
| 524 | Ga0495675_0000151 | |||
| 525 | Ga0495675_0003462 | |||
| 526 | Ga0495679_000093 | |||
| 527 | Ga0495679_001596 | |||
| 528 | Ga0495673_0002273 | |||
| 529 | Ga0495681_0007809 | |||
| 530 | Ga0495681_0040708 | |||
| 531 | Ga0495686_0000044 | |||
| 532 | Ga0495593_0000339 | |||
| 533 | Ga0495593_0002241 | |||
| 534 | Ga0495602_0011631 | |||
| 535 | Ga0495614_0004341 | |||
| 536 | Ga0495614_0037528 | |||
| 537 | Ga0496116_0000570 | |||
| 538 | Ga0496117_0007098 | |||
| 539 | Ga0496117_0094958 | |||
| 540 | Ga0496118_0000175 | |||
| 541 | Ga0496118_0023359 | |||
| 542 | Ga0496118_0027029 | |||
| 543 | Ga0496119_0035795 | |||
| 544 | Ga0496119_0044176 | |||
| 545 | Ga0496120_0012275 | |||
| 546 | Ga0496121_0008395 | |||
| 547 | Ga0496121_0034168 | |||
| 548 | Ga0496122_0002024 | |||
| 549 | Ga0496122_0051723 | |||
| 550 | Ga0496122_0103729 | |||
| 551 | Ga0496123_0001765 | |||
| 552 | Ga0496123_0014547 | |||
| 553 | Ga0496125_0000023 | |||
| 554 | Ga0496125_0018655 | |||
| 555 | Ga0496125_0040144 | |||
| 556 | Ga0496125_0061704 | |||
| 557 | Ga0496126_0164938 | |||
| 558 | Ga0495682_0007807 | |||
| 559 | Ga0501033_0028707 | |||
| 560 | Ga0501033_0121876 | |||
| 561 | Ga0501037_0205042 | |||
| 562 | Ga0501070_0000156 | |||
| 563 | Ga0501080_0000994 | |||
| 564 | Ga0501035_0017646 | |||
| 565 | Ga0501044_0014922 | |||
| 566 | Ga0501044_0023059 | |||
| 567 | nmdc:mga03n38_96655_c1 | |||
| 568 | nmdc:mga00v17_4775_c1 | |||
| 569 | nmdc:mga00v17_5415_c1 | |||
| 570 | nmdc:mga06z11_3766_c1 | |||
| 571 | nmdc:mga0rr50_31684_c1 | |||
| 572 | Ga0500644_0001936 | |||
| 573 | Ga0500618_000107 | |||
| 574 | Ga0500618_004481 | |||
| 575 | Ga0500658_0000873 | |||
| 576 | Ga0500590_003715 | |||
| 577 | Ga0500616_0014537 | |||
| 578 | Ga0500634_0000005 | |||
| 579 | 2501075628 | |||
| 580 | 2501407482 | |||
| 581 | 2511097354 | |||
| 582 | 2511105703 | |||
| 583 | 2511383219 | |||
| 584 | 2513591633 | |||
| 585 | 2585324325 | |||
| 586 | 2599100603 | |||
| 587 | 2599905956 | |||
| 588 | 2644122921 | |||
| 589 | 2644147912 | |||
| 590 | 2723877181 | |||
| 591 | 2746087699 | |||
| 592 | 2746098973 | |||
| 593 | 2842327646 | |||
| 594 | 2842351747 | |||
| 595 | 2842460729 | |||
| 596 | 2848863585 | |||
| 597 | 2856293404 | |||
| 598 | 2857578711 | |||
| 599 | 2901312929 | |||
| 600 | 2941479694 | |||
| 601 | 2941503091 | |||
| 602 | 8016593505 | |||
| 603 | 8046772848 | |||
| 604 | 8054005736 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9506 | 5 | 236 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9464 | 3 | 219 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9453 | 4 | 217 |
| 6mit-assembly2.cif.gz_E | lptbfgc from enterobacter cloacae | 0.9412 | 6 | 223 |
| 6mjp-assembly1.cif.gz_B | lptb(e163q)fgc from vibrio cholerae | 0.938 | 6 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9763 | 4 | 219 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9699 | 6 | 237 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9653 | 6 | 218 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9632 | 4 | 219 | 3.40.50.300 |
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.961 | 6 | 217 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E7V6G1-F1-model_v4 | Spermidine/putrescine ABC transporter ATP-binding protein | 0.9913 | 2 | 218 |
GO:0005524
GO:0016887 |
| AF-A0A5J4F8B2-F1-model_v4 | Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) | 0.984 | 6 | 242 |
GO:0005524
GO:0015419 GO:0016887 GO:0043190 |
| AF-A0A2N5A791-F1-model_v4 | Fe3+/spermidine/putrescine ABC transporter ATP-binding protein | 0.9814 | 4 | 214 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A379D261-F1-model_v4 | deleted | 0.9802 | 4 | 236 |
|
| AF-A0A7J9YE84-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9778 | 6 | 223 |
GO:0005524
GO:0016887 GO:0055052 |