F396273

General Info

Members Datasets Scaffolds Average Seq Length
302 222 604 363

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1022628|Ga0065165_10226282
Length 381
Sequence MNMTVSNIDAHVEDVPAKRLKLRASELSKHYGPVIGLDRVSIDVHEGEFVSLLGPSGSGKTTLLTLIAGLVTPDSGQLWINEREATYLPIQKRDLGMVFQNYALFPHLSVAENIAFPLRMREVAETEIRVRVREALETIRLGHIADRLPQALSGGQQQRVALARCLVYKPSIILMDEPLGALDRNLREEMQYEIKELHRTLGTTIIYVTHDQDEAMTMSDRVCLMQSGGIIQLGTPQDLYFQPRTEFAAKFLGDSNFLDGKLIGFENDTAVLETLSGDRVLAPKSPAGLAPGSAVRIMFRPEHGAIGAAGAGPAANQMSAQVRDTVLVGGTRRIFFESPNGSPISLSCLSQFLPEGLERGRTMALSFPVSFTRYFFAGESR

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
108 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
109 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
110 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
111 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
192 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
197 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
198 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
199 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
200 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
201 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
202 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
203 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
204 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
205 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
206 2643221621 Achromobacter sp. Root83 Isolate Unclassified
207 2643221626 Ensifer sp. Root31 Isolate Unclassified
208 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
209 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
210 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
211 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
212 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
213 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
214 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
215 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
216 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
217 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
218 2941479691
219 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
220 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
221 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
222 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.39
Metatranscriptomes 0
Isolates 8.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.62
Nodule 1.66
Rhizoplane 0.33
Rhizosphere 75.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1022628 3300005262 Bacteria 2150
2 Ga0055529_1000807 3300003763 Bacteria 19078
3 Ga0070676_10003591 3300005328 Bacteria 8106
4 Ga0070677_10014100 3300005333 Bacteria 2807
5 Ga0068869_100001419 3300005334 Bacteria 14188
6 Ga0070666_10106423 3300005335 Bacteria 1938
7 Ga0068868_100123741 3300005338 Bacteria 2111
8 Ga0068868_100266246 3300005338 Bacteria 1447
9 Ga0070668_100000760 3300005347 Bacteria 22136
10 Ga0070669_100003414 3300005353 Bacteria 11438
11 Ga0070671_100227408 3300005355 Bacteria 1583
12 Ga0070674_100002302 3300005356 Bacteria 10550
13 Ga0070667_100004847 3300005367 Bacteria 11273
14 Ga0070705_100029255 3300005440 Bacteria 3027
15 Ga0070708_100032489 3300005445 Bacteria 4528
16 Ga0070708_100039258 3300005445 Bacteria 4141
17 Ga0070663_100111798 3300005455 Bacteria 2053
18 Ga0070678_100150805 3300005456 Bacteria 1872
19 Ga0070662_100009897 3300005457 Bacteria 6245
20 Ga0070662_100366348 3300005457 Bacteria 1183
21 Ga0068867_100014058 3300005459 Bacteria 5669
22 Ga0068867_100056227 3300005459 Bacteria 2911
23 Ga0070706_100051170 3300005467 Bacteria 3812
24 Ga0070707_100174721 3300005468 Bacteria 2093
25 Ga0070698_100065975 3300005471 Bacteria 3644
26 Ga0070699_100036426 3300005518 Bacteria 4256
27 Ga0070684_100410932 3300005535 Bacteria 1249
28 Ga0070697_100198939 3300005536 Bacteria 1703
29 Ga0070672_100003647 3300005543 Bacteria 10000
30 Ga0070664_100166631 3300005564 Bacteria 1952
31 Ga0068854_100145500 3300005578 Bacteria 1823
32 Ga0068852_100061752 3300005616 Bacteria 3257
33 Ga0068864_100002152 3300005618 Bacteria 16277
34 Ga0068864_100029015 3300005618 Bacteria 4681
35 Ga0068866_10000902 3300005718 Bacteria 13094
36 Ga0068861_100004108 3300005719 Bacteria 9766
37 Ga0068863_100000783 3300005841 Bacteria 31944
38 Ga0068863_100059877 3300005841 Bacteria 3603
39 Ga0068858_100001938 3300005842 Bacteria 21099
40 Ga0068858_100042428 3300005842 Bacteria 4218
41 Ga0068860_100009197 3300005843 Bacteria 9820
42 Ga0068860_100245270 3300005843 Bacteria 1743
43 Ga0075365_10018827 3300006038 Bacteria 4253
44 Ga0075363_100020286 3300006048 Bacteria 3332
45 Ga0075364_10000299 3300006051 Bacteria 24099
46 Ga0075364_10109120 3300006051 Bacteria 1846
47 Ga0070716_100002156 3300006173 Bacteria 9047
48 Ga0075362_10021350 3300006177 Bacteria 2715
49 Ga0075367_10019988 3300006178 Bacteria 3723
50 Ga0075366_10028863 3300006195 Bacteria 3257
51 Ga0075434_100005553 3300006871 Bacteria 11492
52 Ga0068865_100013588 3300006881 Bacteria 5151
53 Ga0075435_100003946 3300007076 Bacteria 10139
54 Ga0099794_10034400 3300007265 Bacteria 2387
55 Ga0105244_10010401 3300009036 Bacteria 5645
56 Ga0105245_10061884 3300009098 Bacteria 3376
57 Ga0105245_10448376 3300009098 Bacteria 1298
58 Ga0105243_10009954 3300009148 Bacteria 7227
59 Ga0105243_10155162 3300009148 Bacteria 1968
60 Ga0105242_10007756 3300009176 Bacteria 8258
61 Ga0105237_10015728 3300009545 Bacteria 7866
62 Ga0105238_10451517 3300009551 Bacteria 1282
63 Ga0105249_10006557 3300009553 Bacteria 10128
64 Ga0105239_10010483 3300010375 Bacteria 10361
65 Ga0157373_10023224 3300013100 Bacteria 4497
66 Ga0163162_10003129 3300013306 Bacteria 15806
67 Ga0163162_10005956 3300013306 Bacteria 11803
68 Ga0163162_10165487 3300013306 Bacteria 2335
69 Ga0163162_10196280 3300013306 Bacteria 2147
70 Ga0157380_10016242 3300014326 Bacteria 5484
71 Ga0183361_10002 3300016635 Bacteria 907642
72 Ga0163161_10000072 3300017792 Bacteria 102352
73 Ga0209435_106846 3300025206 Bacteria 1266
74 Ga0209258_103435 3300025242 Bacteria 3415
75 Ga0209455_1000325 3300025272 Bacteria 46601
76 Ga0209051_1030421 3300025303 Bacteria 2095
77 Ga0207642_10013080 3300025899 Bacteria 3016
78 Ga0207680_10194608 3300025903 Bacteria 1378
79 Ga0207645_10000991 3300025907 Bacteria 23445
80 Ga0207684_10044273 3300025910 Bacteria 3774
81 Ga0207662_10004569 3300025918 Bacteria 7296
82 Ga0207681_10002446 3300025923 Bacteria 11773
83 Ga0207659_10002725 3300025926 Bacteria 10535
84 Ga0207644_10036139 3300025931 Bacteria 3466
85 Ga0207706_10020215 3300025933 Bacteria 5985
86 Ga0207686_10008385 3300025934 Bacteria 5578
87 Ga0207669_10001042 3300025937 Bacteria 11839
88 Ga0207704_10000481 3300025938 Bacteria 17780
89 Ga0207665_10031010 3300025939 Bacteria 3537
90 Ga0207691_10007506 3300025940 Bacteria 10495
91 Ga0207689_10001694 3300025942 Bacteria 20950
92 Ga0207712_10001131 3300025961 Bacteria 18584
93 Ga0207658_10000803 3300025986 Bacteria 26405
94 Ga0207658_10093806 3300025986 Bacteria 2334
95 Ga0207641_10004330 3300026088 Bacteria 12325
96 Ga0207641_10163086 3300026088 Bacteria 2028
97 Ga0207648_10008467 3300026089 Bacteria 9955
98 Ga0207675_100001498 3300026118 Bacteria 23384
99 Ga0207675_100259001 3300026118 Bacteria 1685
100 Ga0207683_10018928 3300026121 Bacteria 5875
101 Ga0207698_10251639 3300026142 Bacteria 1617
102 Ga0209371_1008314 3300027312 Bacteria 3469
103 Ga0268265_10020427 3300028380 Bacteria 4622
104 Ga0268264_10050889 3300028381 Bacteria 3451
105 Ga0307515_10000996 3300028794 Bacteria 64755
106 Ga0307515_10111856 3300028794 Bacteria 3182
107 Ga0307515_10289692 3300028794 Bacteria 1334
108 Ga0268256_1008629 3300030500 Bacteria 3469
109 Ga0307513_10005429 3300031456 Bacteria 16849
110 Ga0307513_10039824 3300031456 Bacteria 5204
111 Ga0307513_10188647 3300031456 Bacteria 1916
112 Ga0307408_100024536 3300031548 Bacteria 4119
113 Ga0307408_100063070 3300031548 Bacteria 2710
114 Ga0307514_10003801 3300031649 Bacteria 14211
115 Ga0307405_10020113 3300031731 Bacteria 3724
116 Ga0307405_10020510 3300031731 Bacteria 3695
117 Ga0307405_10033490 3300031731 Bacteria 3048
118 Ga0307410_10011303 3300031852 Bacteria 5100
119 Ga0307406_10020170 3300031901 Bacteria 3921
120 Ga0307412_10000123 3300031911 Bacteria 59156
121 Ga0307412_10058908 3300031911 Bacteria 2571
122 Ga0307409_100008411 3300031995 Bacteria 6260
123 Ga0307416_100001236 3300032002 Bacteria 13784
124 Ga0307416_100022454 3300032002 Bacteria 4556
125 Ga0307414_10071871 3300032004 Bacteria 2497
126 Ga0307411_10010139 3300032005 Bacteria 5004
127 Ga0307411_10018282 3300032005 Bacteria 4017
128 Ga0307415_100003696 3300032126 Bacteria 7830
129 Ga0395899_0031512 3300037312 Bacteria 3984
130 Ga0395900_0016916 3300037418 Bacteria 7444
131 Ga0395898_0002270 3300037466 Bacteria 23261
132 Ga0395905_0000025 3300037471 Bacteria 317571
133 Ga0395905_0186163 3300037471 Bacteria 1948
134 Ga0395905_0310467 3300037471 Bacteria 1465
135 Ga0395901_0000434 3300038443 Bacteria 48945
136 Ga0395901_0691174 3300038443 Bacteria 1019
137 Ga0439436_0022954 3300041404 Bacteria 1847
138 Ga0439461_0005238 3300041410 Bacteria 2202
139 Ga0439458_0021233 3300042157 Bacteria 1502
140 Ga0439464_0007090 3300042439 Bacteria 2929
141 Ga0466977_0002085 3300044666 Bacteria 8893
142 Ga0495592_0000229 3300046454 Bacteria 48485
143 Ga0495592_0035485 3300046454 Bacteria 3758
144 Ga0495603_0031347 3300046455 Bacteria 3200
145 Ga0495591_000101 3300046458 Bacteria 99240
146 Ga0495629_0001559 3300046459 Bacteria 18009
147 Ga0495629_0003820 3300046459 Bacteria 11357
148 Ga0495629_0089034 3300046459 Bacteria 2154
149 Ga0495651_0000858 3300046462 Bacteria 23552
150 Ga0495653_0016140 3300046463 Bacteria 6084
151 Ga0495580_0001309 3300046472 Bacteria 21990
152 Ga0495580_0004199 3300046472 Bacteria 12113
153 Ga0495582_0001818 3300046473 Bacteria 12061
154 Ga0495582_0034808 3300046473 Bacteria 2768
155 Ga0495662_0002777 3300046476 Bacteria 8858
156 Ga0495662_0050527 3300046476 Bacteria 2007
157 Ga0495664_0000769 3300046477 Bacteria 16399
158 Ga0495664_0049382 3300046477 Bacteria 2497
159 Ga0495596_0000146 3300046500 Bacteria 48977
160 Ga0495607_0000004 3300046501 Bacteria 317271
161 Ga0495606_0115558 3300046507 Bacteria 1613
162 Ga0495608_0000241 3300046511 Bacteria 39695
163 Ga0495618_0009655 3300046514 Bacteria 5825
164 Ga0495618_0011848 3300046514 Bacteria 5292
165 Ga0495628_0003810 3300046516 Bacteria 13432
166 Ga0495628_0014739 3300046516 Bacteria 6543
167 Ga0495628_0145454 3300046516 Bacteria 1807
168 Ga0495630_0000147 3300046517 Bacteria 54656
169 Ga0495632_0018795 3300046519 Bacteria 3782
170 Ga0495648_0000164 3300046524 Bacteria 78546
171 Ga0495648_0002963 3300046524 Bacteria 15236
172 Ga0495666_0002105 3300046526 Bacteria 9868
173 Ga0495666_0005907 3300046526 Bacteria 6167
174 Ga0495652_0012866 3300046529 Bacteria 7538
175 Ga0495665_0001305 3300046531 Bacteria 13281
176 Ga0495665_0003673 3300046531 Bacteria 8320
177 Ga0495640_0008654 3300046533 Bacteria 7976
178 Ga0495640_0008786 3300046533 Bacteria 7906
179 Ga0495586_0004455 3300046535 Bacteria 7479
180 Ga0495587_0001027 3300046536 Bacteria 18351
181 Ga0495587_0003706 3300046536 Bacteria 10152
182 Ga0495645_0011019 3300046543 Bacteria 6354
183 Ga0495645_0177412 3300046543 Bacteria 1462
184 Ga0495622_0000029 3300046557 Bacteria 130861
185 Ga0495633_0001934 3300046558 Bacteria 15069
186 Ga0495667_0020927 3300046559 Bacteria 4414
187 Ga0495634_0001293 3300046642 Bacteria 22871
188 Ga0495634_0008067 3300046642 Bacteria 7855
189 Ga0495611_0108723 3300046648 Bacteria 1290
190 Ga0495625_0034028 3300046660 Bacteria 3762
191 Ga0495635_0000218 3300046663 Bacteria 36175
192 Ga0495635_0003794 3300046663 Bacteria 10498
193 Ga0495661_0001002 3300046665 Bacteria 25389
194 Ga0495661_0063652 3300046665 Bacteria 2179
195 Ga0495599_0006962 3300046678 Bacteria 6840
196 Ga0495623_0002426 3300046679 Bacteria 12354
197 Ga0495646_0000478 3300046680 Bacteria 21305
198 Ga0495646_0012026 3300046680 Bacteria 5506
199 Ga0495613_0000604 3300046689 Bacteria 28806
200 Ga0495613_0001125 3300046689 Bacteria 20365
201 Ga0495613_0022227 3300046689 Bacteria 4726
202 Ga0495624_0000869 3300046690 Bacteria 23955
203 Ga0495624_0028916 3300046690 Bacteria 3617
204 Ga0495649_0001856 3300046694 Bacteria 15480
205 Ga0495589_0000213 3300046794 Bacteria 49333
206 Ga0495589_0012173 3300046794 Bacteria 4461
207 Ga0495600_0000806 3300046809 Bacteria 16629
208 Ga0495600_0096949 3300046809 Bacteria 1922
209 Ga0495600_0170852 3300046809 Bacteria 1403
210 Ga0495581_0001660 3300047315 Bacteria 12396
211 Ga0495581_0008200 3300047315 Bacteria 6053
212 Ga0495604_0002038 3300047317 Bacteria 16329
213 Ga0495604_0002559 3300047317 Bacteria 14545
214 Ga0495674_0007831 3300047319 Bacteria 10200
215 Ga0495672_0001483 3300047320 Bacteria 23008
216 Ga0495676_0001988 3300047321 Bacteria 17979
217 Ga0495676_0010010 3300047321 Bacteria 8613
218 Ga0495680_0011396 3300047322 Bacteria 7870
219 Ga0495680_0034984 3300047322 Bacteria 4050
220 Ga0495683_0000936 3300047323 Bacteria 20571
221 Ga0495687_021513 3300047443 Bacteria 3117
222 Ga0495675_0000151 3300047444 Bacteria 48734
223 Ga0495675_0003462 3300047444 Bacteria 9513
224 Ga0495679_000093 3300047446 Bacteria 81614
225 Ga0495679_001596 3300047446 Bacteria 12737
226 Ga0495673_0002273 3300047469 Bacteria 13779
227 Ga0495681_0007809 3300047470 Bacteria 6776
228 Ga0495681_0040708 3300047470 Bacteria 2261
229 Ga0495686_0000044 3300047472 Bacteria 288079
230 Ga0495593_0000339 3300047673 Bacteria 25912
231 Ga0495593_0002241 3300047673 Bacteria 11594
232 Ga0495602_0011631 3300048088 Bacteria 9090
233 Ga0495614_0004341 3300048089 Bacteria 6391
234 Ga0495614_0037528 3300048089 Bacteria 2078
235 Ga0496116_0000570 3300048919 Bacteria 49416
236 Ga0496117_0007098 3300048920 Bacteria 11071
237 Ga0496117_0094958 3300048920 Bacteria 1907
238 Ga0496118_0000175 3300048921 Bacteria 115396
239 Ga0496118_0023359 3300048921 Bacteria 5372
240 Ga0496118_0027029 3300048921 Bacteria 4867
241 Ga0496119_0035795 3300048922 Bacteria 3248
242 Ga0496119_0044176 3300048922 Bacteria 2808
243 Ga0496120_0012275 3300048923 Bacteria 5839
244 Ga0496121_0008395 3300048924 Bacteria 12174
245 Ga0496121_0034168 3300048924 Bacteria 4581
246 Ga0496122_0002024 3300048925 Bacteria 30109
247 Ga0496122_0051723 3300048925 Bacteria 3118
248 Ga0496122_0103729 3300048925 Bacteria 1891
249 Ga0496123_0001765 3300048926 Bacteria 28531
250 Ga0496123_0014547 3300048926 Bacteria 6513
251 Ga0496125_0000023 3300048928 Bacteria 449042
252 Ga0496125_0018655 3300048928 Bacteria 6582
253 Ga0496125_0040144 3300048928 Bacteria 4018
254 Ga0496125_0061704 3300048928 Bacteria 3005
255 Ga0496126_0164938 3300048929 Bacteria 1891
256 Ga0495682_0007807 3300049460 Bacteria 4238
257 Ga0501033_0028707 3300049570 Bacteria 4180
258 Ga0501033_0121876 3300049570 Bacteria 1892
259 Ga0501037_0205042 3300049573 Bacteria 1392
260 Ga0501070_0000156 3300049586 Bacteria 62807
261 Ga0501080_0000994 3300049742 Bacteria 23239
262 Ga0501035_0017646 3300049822 Bacteria 6583
263 Ga0501044_0014922 3300049823 Bacteria 8377
264 Ga0501044_0023059 3300049823 Bacteria 6625
265 nmdc:mga03n38_96655_c1 3300050490 Bacteria 1417
266 nmdc:mga00v17_4775_c1 3300050491 Bacteria 7094
267 nmdc:mga00v17_5415_c1 3300050491 Bacteria 6723
268 nmdc:mga06z11_3766_c1 3300050494 Bacteria 5897
269 nmdc:mga0rr50_31684_c1 3300050513 Bacteria 3759
270 Ga0500644_0001936 3300053088 Bacteria 5299
271 Ga0500618_000107 3300053125 Bacteria 67707
272 Ga0500618_004481 3300053125 Bacteria 4446
273 Ga0500658_0000873 3300053134 Bacteria 12373
274 Ga0500590_003715 3300053148 Bacteria 7090
275 Ga0500616_0014537 3300053153 Bacteria 4521
276 Ga0500634_0000005 3300053161 Bacteria 184092
277 2501075628 2501025501 Bacteria 7768574
278 2501407482 2501025504 Bacteria 8008976
279 2511097354 2510917014 Bacteria 8296963
280 2511105703 2510917015 Bacteria 7950052
281 2511383219 2511231026 Bacteria 5225445
282 2513591633 2513237087 Bacteria 5817514
283 2585324325 2582581315 Bacteria 7318924
284 2599100603 2597490356 Bacteria 7030811
285 2599905956 2599185292 Bacteria 6290804
286 2644122921 2643221621 Bacteria 6212786
287 2644147912 2643221626 Bacteria 8069654
288 2723877181 2721755763 Bacteria 4464185
289 2746087699 2744054900 Bacteria 8399525
290 2746098973 2744054901 Bacteria 8397047
291 2842327646 2842324504 Bacteria 9364110
292 2842351747 2842348783 Bacteria 9002918
293 2842460729 2842454564 Bacteria 8730687
294 2848863585 2848858292 Bacteria 7391279
295 2856293404 2856287931 Bacteria 7223934
296 2857578711 2857576091 Bacteria 5465855
297 2901312929 2901300506 Bacteria 8463898
298 2941479694
299 2941503091 2941499720 Bacteria 7599444
300 8016593505 8016583857 Bacteria 10421953
301 8046772848 8046767195 Bacteria 7547379
302 8054005736 8054002106 Bacteria 7987183
303 Ga0065165_1022628
304 Ga0055529_1000807
305 Ga0070676_10003591
306 Ga0070677_10014100
307 Ga0068869_100001419
308 Ga0070666_10106423
309 Ga0068868_100123741
310 Ga0068868_100266246
311 Ga0070668_100000760
312 Ga0070669_100003414
313 Ga0070671_100227408
314 Ga0070674_100002302
315 Ga0070667_100004847
316 Ga0070705_100029255
317 Ga0070708_100032489
318 Ga0070708_100039258
319 Ga0070663_100111798
320 Ga0070678_100150805
321 Ga0070662_100009897
322 Ga0070662_100366348
323 Ga0068867_100014058
324 Ga0068867_100056227
325 Ga0070706_100051170
326 Ga0070707_100174721
327 Ga0070698_100065975
328 Ga0070699_100036426
329 Ga0070684_100410932
330 Ga0070697_100198939
331 Ga0070672_100003647
332 Ga0070664_100166631
333 Ga0068854_100145500
334 Ga0068852_100061752
335 Ga0068864_100002152
336 Ga0068864_100029015
337 Ga0068866_10000902
338 Ga0068861_100004108
339 Ga0068863_100000783
340 Ga0068863_100059877
341 Ga0068858_100001938
342 Ga0068858_100042428
343 Ga0068860_100009197
344 Ga0068860_100245270
345 Ga0075365_10018827
346 Ga0075363_100020286
347 Ga0075364_10000299
348 Ga0075364_10109120
349 Ga0070716_100002156
350 Ga0075362_10021350
351 Ga0075367_10019988
352 Ga0075366_10028863
353 Ga0075434_100005553
354 Ga0068865_100013588
355 Ga0075435_100003946
356 Ga0099794_10034400
357 Ga0105244_10010401
358 Ga0105245_10061884
359 Ga0105245_10448376
360 Ga0105243_10009954
361 Ga0105243_10155162
362 Ga0105242_10007756
363 Ga0105237_10015728
364 Ga0105238_10451517
365 Ga0105249_10006557
366 Ga0105239_10010483
367 Ga0157373_10023224
368 Ga0163162_10003129
369 Ga0163162_10005956
370 Ga0163162_10165487
371 Ga0163162_10196280
372 Ga0157380_10016242
373 Ga0183361_10002
374 Ga0163161_10000072
375 Ga0209435_106846
376 Ga0209258_103435
377 Ga0209455_1000325
378 Ga0209051_1030421
379 Ga0207642_10013080
380 Ga0207680_10194608
381 Ga0207645_10000991
382 Ga0207684_10044273
383 Ga0207662_10004569
384 Ga0207681_10002446
385 Ga0207659_10002725
386 Ga0207644_10036139
387 Ga0207706_10020215
388 Ga0207686_10008385
389 Ga0207669_10001042
390 Ga0207704_10000481
391 Ga0207665_10031010
392 Ga0207691_10007506
393 Ga0207689_10001694
394 Ga0207712_10001131
395 Ga0207658_10000803
396 Ga0207658_10093806
397 Ga0207641_10004330
398 Ga0207641_10163086
399 Ga0207648_10008467
400 Ga0207675_100001498
401 Ga0207675_100259001
402 Ga0207683_10018928
403 Ga0207698_10251639
404 Ga0209371_1008314
405 Ga0268265_10020427
406 Ga0268264_10050889
407 Ga0307515_10000996
408 Ga0307515_10111856
409 Ga0307515_10289692
410 Ga0268256_1008629
411 Ga0307513_10005429
412 Ga0307513_10039824
413 Ga0307513_10188647
414 Ga0307408_100024536
415 Ga0307408_100063070
416 Ga0307514_10003801
417 Ga0307405_10020113
418 Ga0307405_10020510
419 Ga0307405_10033490
420 Ga0307410_10011303
421 Ga0307406_10020170
422 Ga0307412_10000123
423 Ga0307412_10058908
424 Ga0307409_100008411
425 Ga0307416_100001236
426 Ga0307416_100022454
427 Ga0307414_10071871
428 Ga0307411_10010139
429 Ga0307411_10018282
430 Ga0307415_100003696
431 Ga0395899_0031512
432 Ga0395900_0016916
433 Ga0395898_0002270
434 Ga0395905_0000025
435 Ga0395905_0186163
436 Ga0395905_0310467
437 Ga0395901_0000434
438 Ga0395901_0691174
439 Ga0439436_0022954
440 Ga0439461_0005238
441 Ga0439458_0021233
442 Ga0439464_0007090
443 Ga0466977_0002085
444 Ga0495592_0000229
445 Ga0495592_0035485
446 Ga0495603_0031347
447 Ga0495591_000101
448 Ga0495629_0001559
449 Ga0495629_0003820
450 Ga0495629_0089034
451 Ga0495651_0000858
452 Ga0495653_0016140
453 Ga0495580_0001309
454 Ga0495580_0004199
455 Ga0495582_0001818
456 Ga0495582_0034808
457 Ga0495662_0002777
458 Ga0495662_0050527
459 Ga0495664_0000769
460 Ga0495664_0049382
461 Ga0495596_0000146
462 Ga0495607_0000004
463 Ga0495606_0115558
464 Ga0495608_0000241
465 Ga0495618_0009655
466 Ga0495618_0011848
467 Ga0495628_0003810
468 Ga0495628_0014739
469 Ga0495628_0145454
470 Ga0495630_0000147
471 Ga0495632_0018795
472 Ga0495648_0000164
473 Ga0495648_0002963
474 Ga0495666_0002105
475 Ga0495666_0005907
476 Ga0495652_0012866
477 Ga0495665_0001305
478 Ga0495665_0003673
479 Ga0495640_0008654
480 Ga0495640_0008786
481 Ga0495586_0004455
482 Ga0495587_0001027
483 Ga0495587_0003706
484 Ga0495645_0011019
485 Ga0495645_0177412
486 Ga0495622_0000029
487 Ga0495633_0001934
488 Ga0495667_0020927
489 Ga0495634_0001293
490 Ga0495634_0008067
491 Ga0495611_0108723
492 Ga0495625_0034028
493 Ga0495635_0000218
494 Ga0495635_0003794
495 Ga0495661_0001002
496 Ga0495661_0063652
497 Ga0495599_0006962
498 Ga0495623_0002426
499 Ga0495646_0000478
500 Ga0495646_0012026
501 Ga0495613_0000604
502 Ga0495613_0001125
503 Ga0495613_0022227
504 Ga0495624_0000869
505 Ga0495624_0028916
506 Ga0495649_0001856
507 Ga0495589_0000213
508 Ga0495589_0012173
509 Ga0495600_0000806
510 Ga0495600_0096949
511 Ga0495600_0170852
512 Ga0495581_0001660
513 Ga0495581_0008200
514 Ga0495604_0002038
515 Ga0495604_0002559
516 Ga0495674_0007831
517 Ga0495672_0001483
518 Ga0495676_0001988
519 Ga0495676_0010010
520 Ga0495680_0011396
521 Ga0495680_0034984
522 Ga0495683_0000936
523 Ga0495687_021513
524 Ga0495675_0000151
525 Ga0495675_0003462
526 Ga0495679_000093
527 Ga0495679_001596
528 Ga0495673_0002273
529 Ga0495681_0007809
530 Ga0495681_0040708
531 Ga0495686_0000044
532 Ga0495593_0000339
533 Ga0495593_0002241
534 Ga0495602_0011631
535 Ga0495614_0004341
536 Ga0495614_0037528
537 Ga0496116_0000570
538 Ga0496117_0007098
539 Ga0496117_0094958
540 Ga0496118_0000175
541 Ga0496118_0023359
542 Ga0496118_0027029
543 Ga0496119_0035795
544 Ga0496119_0044176
545 Ga0496120_0012275
546 Ga0496121_0008395
547 Ga0496121_0034168
548 Ga0496122_0002024
549 Ga0496122_0051723
550 Ga0496122_0103729
551 Ga0496123_0001765
552 Ga0496123_0014547
553 Ga0496125_0000023
554 Ga0496125_0018655
555 Ga0496125_0040144
556 Ga0496125_0061704
557 Ga0496126_0164938
558 Ga0495682_0007807
559 Ga0501033_0028707
560 Ga0501033_0121876
561 Ga0501037_0205042
562 Ga0501070_0000156
563 Ga0501080_0000994
564 Ga0501035_0017646
565 Ga0501044_0014922
566 Ga0501044_0023059
567 nmdc:mga03n38_96655_c1
568 nmdc:mga00v17_4775_c1
569 nmdc:mga00v17_5415_c1
570 nmdc:mga06z11_3766_c1
571 nmdc:mga0rr50_31684_c1
572 Ga0500644_0001936
573 Ga0500618_000107
574 Ga0500618_004481
575 Ga0500658_0000873
576 Ga0500590_003715
577 Ga0500616_0014537
578 Ga0500634_0000005
579 2501075628
580 2501407482
581 2511097354
582 2511105703
583 2511383219
584 2513591633
585 2585324325
586 2599100603
587 2599905956
588 2644122921
589 2644147912
590 2723877181
591 2746087699
592 2746098973
593 2842327646
594 2842351747
595 2842460729
596 2848863585
597 2856293404
598 2857578711
599 2901312929
600 2941479694
601 2941503091
602 8016593505
603 8046772848
604 8054005736

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

37

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9506 5 236
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9464 3 219
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9453 4 217
6mit-assembly2.cif.gz_E lptbfgc from enterobacter cloacae 0.9412 6 223
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.938 6 223
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9763 4 219 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9699 6 237 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9653 6 218 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9632 4 219 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.961 6 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E7V6G1-F1-model_v4 Spermidine/putrescine ABC transporter ATP-binding protein 0.9913 2 218 GO:0005524
GO:0016887
AF-A0A5J4F8B2-F1-model_v4 Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) 0.984 6 242 GO:0005524
GO:0015419
GO:0016887
GO:0043190
AF-A0A2N5A791-F1-model_v4 Fe3+/spermidine/putrescine ABC transporter ATP-binding protein 0.9814 4 214 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A379D261-F1-model_v4 deleted 0.9802 4 236
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9778 6 223 GO:0005524
GO:0016887
GO:0055052

Map