F396286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 186 | 302 | 376 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10000986|Ga0070676_100009866 |
| Length | 353 |
| Sequence | MRNGVIAFRRDGTLALMNDEAYRIFGLTPAPGDIGRPFADVLRERPEIIRLMFSSFELSYLPNRAELRLKDLDRVIGYTISHVRDESGDAPIGAVLFFKDLTRVEQIEEQERLRDRLASLGEMAAGIAHELKNPLAGIEVMAGLLRRQVPESKDAQSLLADILSEAKLANAIVVEMLEFVRPVRLQVERTDLADVLQQSVTMAESKARRGQVTVATEIEQGLPPIDGDHHQLSQVFTNLVANAFEAMDGKGHITITAATSTIDADPAFAGVHPPTPVVVVEVADDGPGIAPELTDRIFNPFFTTKVTGTGLGLAIVRKIIDAHDGRIDVHSNAQTGTKFRVTVPVTSASSWFK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 118 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 119 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 120 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 121 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 122 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 123 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 125 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 130 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 131 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 134 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 141 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 147 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 186 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.3 |
| Rhizosphere | 95.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10001090 | 3300002459 | Bacteria | 5884 |
| 2 | Ga0070676_10000986 | 3300005328 | Bacteria | 14151 |
| 3 | Ga0070676_10036882 | 3300005328 | Bacteria | 2817 |
| 4 | Ga0070676_10063238 | 3300005328 | Bacteria | 2204 |
| 5 | Ga0070683_100213396 | 3300005329 | Bacteria | 1834 |
| 6 | Ga0070690_100009755 | 3300005330 | Bacteria | 5569 |
| 7 | Ga0070670_100023056 | 3300005331 | Bacteria | 5356 |
| 8 | Ga0070670_100232207 | 3300005331 | Unclassified | 1605 |
| 9 | Ga0070666_10001460 | 3300005335 | Bacteria | 14346 |
| 10 | Ga0070660_100077427 | 3300005339 | Bacteria | 2606 |
| 11 | Ga0070689_100132178 | 3300005340 | Bacteria | 2002 |
| 12 | Ga0070691_10006564 | 3300005341 | Bacteria | 5322 |
| 13 | Ga0070668_100090435 | 3300005347 | Bacteria | 2412 |
| 14 | Ga0070669_100158990 | 3300005353 | Bacteria | 1754 |
| 15 | Ga0070675_100080757 | 3300005354 | Bacteria | 2711 |
| 16 | Ga0070671_100059703 | 3300005355 | Bacteria | 3174 |
| 17 | Ga0070674_100242158 | 3300005356 | Unclassified | 1413 |
| 18 | Ga0070673_100056848 | 3300005364 | Bacteria | 3088 |
| 19 | Ga0070673_100334408 | 3300005364 | Bacteria | 1341 |
| 20 | Ga0070659_100091827 | 3300005366 | Bacteria | 2434 |
| 21 | Ga0070667_100004804 | 3300005367 | Bacteria | 11320 |
| 22 | Ga0070667_100184280 | 3300005367 | Bacteria | 1847 |
| 23 | Ga0070714_100114637 | 3300005435 | Bacteria | 2391 |
| 24 | Ga0070701_10011576 | 3300005438 | Bacteria | 3950 |
| 25 | Ga0070711_100111135 | 3300005439 | Bacteria | 2012 |
| 26 | Ga0070694_100007108 | 3300005444 | Bacteria | 6817 |
| 27 | Ga0070708_100172316 | 3300005445 | Bacteria | 2021 |
| 28 | Ga0070678_100004053 | 3300005456 | Bacteria | 8247 |
| 29 | Ga0070678_100029612 | 3300005456 | Bacteria | 3751 |
| 30 | Ga0070681_10037177 | 3300005458 | Bacteria | 4887 |
| 31 | Ga0070681_10138362 | 3300005458 | Bacteria | 2364 |
| 32 | Ga0070681_10172624 | 3300005458 | Bacteria | 2084 |
| 33 | Ga0068867_100184058 | 3300005459 | Bacteria | 1663 |
| 34 | Ga0070685_10105276 | 3300005466 | Bacteria | 1729 |
| 35 | Ga0070707_100093642 | 3300005468 | Bacteria | 2909 |
| 36 | Ga0070698_100263085 | 3300005471 | Bacteria | 1657 |
| 37 | Ga0070699_100005716 | 3300005518 | Bacteria | 10890 |
| 38 | Ga0070699_100091351 | 3300005518 | Bacteria | 2662 |
| 39 | Ga0070699_100114466 | 3300005518 | Bacteria | 2370 |
| 40 | Ga0070699_100190611 | 3300005518 | Bacteria | 1821 |
| 41 | Ga0070699_100190631 | 3300005518 | Bacteria | 1821 |
| 42 | Ga0070679_100050906 | 3300005530 | Bacteria | 4126 |
| 43 | Ga0070679_100098223 | 3300005530 | Bacteria | 2916 |
| 44 | Ga0070697_100083120 | 3300005536 | Bacteria | 2640 |
| 45 | Ga0070697_100085939 | 3300005536 | Bacteria | 2595 |
| 46 | Ga0070697_100109591 | 3300005536 | Bacteria | 2299 |
| 47 | Ga0070686_100001443 | 3300005544 | Bacteria | 13429 |
| 48 | Ga0070686_100045827 | 3300005544 | Bacteria | 2756 |
| 49 | Ga0070695_100201463 | 3300005545 | Bacteria | 1423 |
| 50 | Ga0070696_100055390 | 3300005546 | Bacteria | 2765 |
| 51 | Ga0070665_100191757 | 3300005548 | Bacteria | 2044 |
| 52 | Ga0070704_100047398 | 3300005549 | Bacteria | 3004 |
| 53 | Ga0068855_100062542 | 3300005563 | Bacteria | 4345 |
| 54 | Ga0070664_100192373 | 3300005564 | Bacteria | 1818 |
| 55 | Ga0068857_100130781 | 3300005577 | Bacteria | 2264 |
| 56 | Ga0068854_100053335 | 3300005578 | Bacteria | 2904 |
| 57 | Ga0068856_100034335 | 3300005614 | Bacteria | 4968 |
| 58 | Ga0068859_100160810 | 3300005617 | Bacteria | 2325 |
| 59 | Ga0068859_100239118 | 3300005617 | Bacteria | 1905 |
| 60 | Ga0068864_100003141 | 3300005618 | Bacteria | 13649 |
| 61 | Ga0068866_10025675 | 3300005718 | Bacteria | 2772 |
| 62 | Ga0068861_100020433 | 3300005719 | Bacteria | 4744 |
| 63 | Ga0068863_100046453 | 3300005841 | Bacteria | 4121 |
| 64 | Ga0068863_100142959 | 3300005841 | Bacteria | 2287 |
| 65 | Ga0068860_100059670 | 3300005843 | Bacteria | 3626 |
| 66 | Ga0068860_100066799 | 3300005843 | Bacteria | 3417 |
| 67 | Ga0068860_100118549 | 3300005843 | Bacteria | 2533 |
| 68 | Ga0081455_10008733 | 3300005937 | Bacteria | 10492 |
| 69 | Ga0081455_10051001 | 3300005937 | Bacteria | 3552 |
| 70 | Ga0081539_10054142 | 3300005985 | Bacteria | 2242 |
| 71 | Ga0070716_100097961 | 3300006173 | Bacteria | 1791 |
| 72 | Ga0097621_100013447 | 3300006237 | Bacteria | 6101 |
| 73 | Ga0097621_100050268 | 3300006237 | Bacteria | 3390 |
| 74 | Ga0097621_100052332 | 3300006237 | Bacteria | 3326 |
| 75 | Ga0097621_100164097 | 3300006237 | Bacteria | 1911 |
| 76 | Ga0068871_100091099 | 3300006358 | Bacteria | 2541 |
| 77 | Ga0075434_100036241 | 3300006871 | Bacteria | 4880 |
| 78 | Ga0075434_100042105 | 3300006871 | Bacteria | 4527 |
| 79 | Ga0075434_100066146 | 3300006871 | Bacteria | 3600 |
| 80 | Ga0075429_100036513 | 3300006880 | Bacteria | 4274 |
| 81 | Ga0075429_100332537 | 3300006880 | Bacteria | 1330 |
| 82 | Ga0075436_100014955 | 3300006914 | Bacteria | 5319 |
| 83 | Ga0075436_100017746 | 3300006914 | Bacteria | 4872 |
| 84 | Ga0075436_100035607 | 3300006914 | Bacteria | 3433 |
| 85 | Ga0075436_100062393 | 3300006914 | Bacteria | 2575 |
| 86 | Ga0075436_100154968 | 3300006914 | Bacteria | 1613 |
| 87 | Ga0097620_100160810 | 3300006931 | Bacteria | 2325 |
| 88 | Ga0097620_100239116 | 3300006931 | Bacteria | 1905 |
| 89 | Ga0075435_100012125 | 3300007076 | Bacteria | 6373 |
| 90 | Ga0075435_100022429 | 3300007076 | Bacteria | 4872 |
| 91 | Ga0075435_100054130 | 3300007076 | Bacteria | 3238 |
| 92 | Ga0075435_100168518 | 3300007076 | Bacteria | 1847 |
| 93 | Ga0105240_10038904 | 3300009093 | Bacteria | 6097 |
| 94 | Ga0105240_10126082 | 3300009093 | Bacteria | 3076 |
| 95 | Ga0105240_10140243 | 3300009093 | Bacteria | 2891 |
| 96 | Ga0105240_10199549 | 3300009093 | Bacteria | 2345 |
| 97 | Ga0111539_10001119 | 3300009094 | Bacteria | 35455 |
| 98 | Ga0111539_10022288 | 3300009094 | Bacteria | 7785 |
| 99 | Ga0111539_10102355 | 3300009094 | Bacteria | 3361 |
| 100 | Ga0105247_10058080 | 3300009101 | Bacteria | 2393 |
| 101 | Ga0114129_10000997 | 3300009147 | Bacteria | 36967 |
| 102 | Ga0114129_10001174 | 3300009147 | Bacteria | 34722 |
| 103 | Ga0114129_10002196 | 3300009147 | Bacteria | 26870 |
| 104 | Ga0114129_10020638 | 3300009147 | Bacteria | 9367 |
| 105 | Ga0114129_10028205 | 3300009147 | Bacteria | 7954 |
| 106 | Ga0114129_10100890 | 3300009147 | Bacteria | 3994 |
| 107 | Ga0114129_10147813 | 3300009147 | Bacteria | 3218 |
| 108 | Ga0114129_10152236 | 3300009147 | Bacteria | 3165 |
| 109 | Ga0114129_10163650 | 3300009147 | Bacteria | 3038 |
| 110 | Ga0114129_10200542 | 3300009147 | Bacteria | 2703 |
| 111 | Ga0105243_10261268 | 3300009148 | Bacteria | 1550 |
| 112 | Ga0105242_10049668 | 3300009176 | Bacteria | 3414 |
| 113 | Ga0105242_10176892 | 3300009176 | Bacteria | 1880 |
| 114 | Ga0105248_10063544 | 3300009177 | Bacteria | 4144 |
| 115 | Ga0105248_10089368 | 3300009177 | Bacteria | 3467 |
| 116 | Ga0105248_10104758 | 3300009177 | Bacteria | 3189 |
| 117 | Ga0105248_10137252 | 3300009177 | Bacteria | 2759 |
| 118 | Ga0105248_10193587 | 3300009177 | Bacteria | 2291 |
| 119 | Ga0105248_10526852 | 3300009177 | Bacteria | 1333 |
| 120 | Ga0105238_10247912 | 3300009551 | Bacteria | 1759 |
| 121 | Ga0105238_10437393 | 3300009551 | Bacteria | 1304 |
| 122 | Ga0105249_10168267 | 3300009553 | Bacteria | 2124 |
| 123 | Ga0105249_10223449 | 3300009553 | Bacteria | 1854 |
| 124 | Ga0105246_10133109 | 3300011119 | Bacteria | 1860 |
| 125 | Ga0105246_10204805 | 3300011119 | Bacteria | 1536 |
| 126 | Ga0157374_10205842 | 3300013296 | Bacteria | 1928 |
| 127 | Ga0163162_10088655 | 3300013306 | Bacteria | 3173 |
| 128 | Ga0163162_10320460 | 3300013306 | Bacteria | 1683 |
| 129 | Ga0157375_10126428 | 3300013308 | Bacteria | 2671 |
| 130 | Ga0157375_10157679 | 3300013308 | Bacteria | 2410 |
| 131 | Ga0157375_10370992 | 3300013308 | Bacteria | 1597 |
| 132 | Ga0163163_10008939 | 3300014325 | Bacteria | 8923 |
| 133 | Ga0163163_10144001 | 3300014325 | Bacteria | 2426 |
| 134 | Ga0157380_10323297 | 3300014326 | Bacteria | 1431 |
| 135 | Ga0157377_10040317 | 3300014745 | Bacteria | 2585 |
| 136 | Ga0157379_10049036 | 3300014968 | Bacteria | 3770 |
| 137 | Ga0157379_10169706 | 3300014968 | Bacteria | 1969 |
| 138 | Ga0157376_10075114 | 3300014969 | Bacteria | 2883 |
| 139 | Ga0157376_10078409 | 3300014969 | Bacteria | 2829 |
| 140 | Ga0207682_10027555 | 3300025893 | Bacteria | 2263 |
| 141 | Ga0207642_10067500 | 3300025899 | Bacteria | 1688 |
| 142 | Ga0207680_10001435 | 3300025903 | Bacteria | 11296 |
| 143 | Ga0207699_10009440 | 3300025906 | Bacteria | 4858 |
| 144 | Ga0207645_10066980 | 3300025907 | Bacteria | 2295 |
| 145 | Ga0207707_10018304 | 3300025912 | Bacteria | 6106 |
| 146 | Ga0207707_10019710 | 3300025912 | Bacteria | 5887 |
| 147 | Ga0207707_10142632 | 3300025912 | Bacteria | 2094 |
| 148 | Ga0207695_10081851 | 3300025913 | Bacteria | 3266 |
| 149 | Ga0207695_10096856 | 3300025913 | Bacteria | 2952 |
| 150 | Ga0207663_10210593 | 3300025916 | Bacteria | 1408 |
| 151 | Ga0207662_10087439 | 3300025918 | Bacteria | 1912 |
| 152 | Ga0207657_10026903 | 3300025919 | Bacteria | 5275 |
| 153 | Ga0207657_10089866 | 3300025919 | Bacteria | 2564 |
| 154 | Ga0207652_10024227 | 3300025921 | Bacteria | 5034 |
| 155 | Ga0207646_10071767 | 3300025922 | Bacteria | 3092 |
| 156 | Ga0207681_10088786 | 3300025923 | Bacteria | 2202 |
| 157 | Ga0207650_10173262 | 3300025925 | Bacteria | 1716 |
| 158 | Ga0207659_10000072 | 3300025926 | Bacteria | 64525 |
| 159 | Ga0207659_10080691 | 3300025926 | Bacteria | 2404 |
| 160 | Ga0207687_10037910 | 3300025927 | Bacteria | 3292 |
| 161 | Ga0207700_10003372 | 3300025928 | Bacteria | 9273 |
| 162 | Ga0207706_10165776 | 3300025933 | Bacteria | 1942 |
| 163 | Ga0207686_10021800 | 3300025934 | Bacteria | 3682 |
| 164 | Ga0207704_10006608 | 3300025938 | Bacteria | 5426 |
| 165 | Ga0207665_10065293 | 3300025939 | Bacteria | 2475 |
| 166 | Ga0207691_10070884 | 3300025940 | Bacteria | 3147 |
| 167 | Ga0207711_10045170 | 3300025941 | Bacteria | 3764 |
| 168 | Ga0207711_10049132 | 3300025941 | Bacteria | 3611 |
| 169 | Ga0207711_10081839 | 3300025941 | Bacteria | 2822 |
| 170 | Ga0207689_10084733 | 3300025942 | Bacteria | 2605 |
| 171 | Ga0207689_10210350 | 3300025942 | Bacteria | 1607 |
| 172 | Ga0207667_10118977 | 3300025949 | Bacteria | 2722 |
| 173 | Ga0207651_10021719 | 3300025960 | Bacteria | 3908 |
| 174 | Ga0207640_10013629 | 3300025981 | Bacteria | 4665 |
| 175 | Ga0207640_10042120 | 3300025981 | Bacteria | 2909 |
| 176 | Ga0207658_10126475 | 3300025986 | Bacteria | 2046 |
| 177 | Ga0207658_10178035 | 3300025986 | Bacteria | 1758 |
| 178 | Ga0207677_10126676 | 3300026023 | Bacteria | 1931 |
| 179 | Ga0207703_10037916 | 3300026035 | Bacteria | 3843 |
| 180 | Ga0207703_10305979 | 3300026035 | Bacteria | 1451 |
| 181 | Ga0207639_10055270 | 3300026041 | Bacteria | 3038 |
| 182 | Ga0207702_10089686 | 3300026078 | Bacteria | 2689 |
| 183 | Ga0207641_10023804 | 3300026088 | Bacteria | 5046 |
| 184 | Ga0207641_10098357 | 3300026088 | Bacteria | 2573 |
| 185 | Ga0207648_10005751 | 3300026089 | Bacteria | 12425 |
| 186 | Ga0207676_10003454 | 3300026095 | Bacteria | 11182 |
| 187 | Ga0207676_10239432 | 3300026095 | Unclassified | 1627 |
| 188 | Ga0207675_100135884 | 3300026118 | Bacteria | 2333 |
| 189 | Ga0207683_10007672 | 3300026121 | Bacteria | 9236 |
| 190 | Ga0207683_10069605 | 3300026121 | Bacteria | 3108 |
| 191 | Ga0209974_10022136 | 3300027876 | Bacteria | 2104 |
| 192 | Ga0207428_10010807 | 3300027907 | Bacteria | 8138 |
| 193 | Ga0268266_10014019 | 3300028379 | Bacteria | 6901 |
| 194 | Ga0268266_10228222 | 3300028379 | Bacteria | 1714 |
| 195 | Ga0268264_10052338 | 3300028381 | Bacteria | 3404 |
| 196 | Ga0268264_10053894 | 3300028381 | Bacteria | 3357 |
| 197 | Ga0307416_100167118 | 3300032002 | Bacteria | 2042 |
| 198 | Ga0373930_0000409 | 3300034816 | Bacteria | 5697 |
| 199 | Ga0373948_0000409 | 3300034817 | Bacteria | 5287 |
| 200 | Ga0373958_0009176 | 3300034819 | Bacteria | 1622 |
| 201 | Ga0373959_0002290 | 3300034820 | Bacteria | 3042 |
| 202 | Ga0373938_0001602 | 3300034957 | Bacteria | 3641 |
| 203 | Ga0373928_0000693 | 3300035084 | Bacteria | 6609 |
| 204 | Ga0373929_0000500 | 3300035085 | Bacteria | 7481 |
| 205 | Ga0373934_0055013 | 3300035086 | Bacteria | 1581 |
| 206 | Ga0373940_0000710 | 3300035088 | Bacteria | 5400 |
| 207 | Ga0373949_0001026 | 3300035090 | Bacteria | 8602 |
| 208 | Ga0373951_0000835 | 3300035091 | Bacteria | 8381 |
| 209 | Ga0373952_0000580 | 3300035092 | Bacteria | 6454 |
| 210 | Ga0373939_0000222 | 3300035114 | Bacteria | 15549 |
| 211 | Ga0373941_0002079 | 3300035115 | Bacteria | 4347 |
| 212 | Ga0373945_0022582 | 3300035116 | Bacteria | 2168 |
| 213 | Ga0373953_0078737 | 3300035117 | Bacteria | 1368 |
| 214 | Ga0373960_0000140 | 3300035121 | Bacteria | 12051 |
| 215 | Ga0373943_0015996 | 3300035170 | Bacteria | 3415 |
| 216 | Ga0373946_0005179 | 3300035171 | Bacteria | 4700 |
| 217 | Ga0373955_0109349 | 3300035172 | Bacteria | 1597 |
| 218 | Ga0373955_0189377 | 3300035172 | Bacteria | 1223 |
| 219 | Ga0373942_0001703 | 3300035207 | Bacteria | 5578 |
| 220 | Ga0373961_0000977 | 3300035241 | Bacteria | 9454 |
| 221 | Ga0373962_0039807 | 3300035242 | Bacteria | 1321 |
| 222 | Ga0373931_0000392 | 3300035691 | Bacteria | 17983 |
| 223 | Ga0373935_0012630 | 3300035692 | Bacteria | 5081 |
| 224 | Ga0373947_0072465 | 3300035725 | Bacteria | 2115 |
| 225 | Ga0373937_0041778 | 3300036401 | Bacteria | 4183 |
| 226 | Ga0373937_0213228 | 3300036401 | Bacteria | 1817 |
| 227 | Ga0373937_0455293 | 3300036401 | Bacteria | 1215 |
| 228 | Ga0373925_0055885 | 3300037068 | Bacteria | 2956 |
| 229 | Ga0439433_0003945 | 3300041999 | Bacteria | 3192 |
| 230 | Ga0439450_023005 | 3300042008 | Bacteria | 1349 |
| 231 | Ga0451576_0004093 | 3300045051 | Bacteria | 19254 |
| 232 | Ga0451576_0083419 | 3300045051 | Bacteria | 3325 |
| 233 | Ga0495582_0094548 | 3300046473 | Bacteria | 1669 |
| 234 | Ga0495640_0218805 | 3300046533 | Bacteria | 1202 |
| 235 | Ga0495586_0111645 | 3300046535 | Bacteria | 1522 |
| 236 | Ga0495587_0110792 | 3300046536 | Bacteria | 1577 |
| 237 | Ga0495645_0007405 | 3300046543 | Bacteria | 7635 |
| 238 | Ga0495634_0024322 | 3300046642 | Bacteria | 4250 |
| 239 | Ga0495647_0039026 | 3300046681 | Bacteria | 1797 |
| 240 | Ga0495669_0002827 | 3300046684 | Bacteria | 7123 |
| 241 | Ga0495613_0249251 | 3300046689 | Bacteria | 1240 |
| 242 | Ga0495604_0083607 | 3300047317 | Bacteria | 2385 |
| 243 | Ga0495604_0186279 | 3300047317 | Bacteria | 1449 |
| 244 | Ga0495684_0043687 | 3300047471 | Bacteria | 3432 |
| 245 | Ga0496100_0069520 | 3300048903 | Bacteria | 2345 |
| 246 | Ga0496100_0218762 | 3300048903 | Bacteria | 1397 |
| 247 | Ga0496101_0001911 | 3300048904 | Bacteria | 12588 |
| 248 | Ga0496102_0056429 | 3300048905 | Bacteria | 3583 |
| 249 | Ga0496102_0190371 | 3300048905 | Bacteria | 1933 |
| 250 | Ga0496103_0111536 | 3300048906 | Bacteria | 1738 |
| 251 | Ga0496104_0020531 | 3300048907 | Bacteria | 6056 |
| 252 | Ga0496104_0131196 | 3300048907 | Bacteria | 2407 |
| 253 | Ga0496107_0025813 | 3300048910 | Bacteria | 4163 |
| 254 | Ga0496109_0106740 | 3300048912 | Bacteria | 2601 |
| 255 | Ga0496112_0035661 | 3300048915 | Bacteria | 4848 |
| 256 | Ga0496114_0000613 | 3300048917 | Bacteria | 26374 |
| 257 | Ga0496114_0408516 | 3300048917 | Bacteria | 1202 |
| 258 | Ga0501034_0005914 | 3300049571 | Bacteria | 13275 |
| 259 | Ga0501042_0314742 | 3300049578 | Bacteria | 1131 |
| 260 | Ga0501043_0171204 | 3300049579 | Bacteria | 1694 |
| 261 | Ga0501047_0001540 | 3300049581 | Bacteria | 22545 |
| 262 | Ga0501047_0220320 | 3300049581 | Bacteria | 1754 |
| 263 | Ga0501076_0184828 | 3300049592 | Bacteria | 1700 |
| 264 | Ga0501083_0152065 | 3300049744 | Bacteria | 1515 |
| 265 | Ga0501044_0036519 | 3300049823 | Bacteria | 5141 |
| 266 | nmdc:mga05p37_1000_c1 | 3300050507 | Bacteria | 32217 |
| 267 | nmdc:mga05p37_120531_c1 | 3300050507 | Bacteria | 3223 |
| 268 | nmdc:mga05p37_184035_c1 | 3300050507 | Bacteria | 2540 |
| 269 | nmdc:mga05p37_22470_c1 | 3300050507 | Bacteria | 7648 |
| 270 | nmdc:mga05p37_24195_c1 | 3300050507 | Bacteria | 7379 |
| 271 | nmdc:mga05p37_25634_c1 | 3300050507 | Bacteria | 7172 |
| 272 | nmdc:mga05p37_428360_c1 | 3300050507 | Bacteria | 1538 |
| 273 | nmdc:mga05p37_8828_c1 | 3300050507 | Bacteria | 11908 |
| 274 | nmdc:mga05p37_91344_c1 | 3300050507 | Bacteria | 3752 |
| 275 | nmdc:mga09592_23788_c1 | 3300050508 | Bacteria | 5061 |
| 276 | nmdc:mga08y16_168841_c1 | 3300050511 | Bacteria | 2273 |
| 277 | nmdc:mga08y16_191800_c1 | 3300050511 | Bacteria | 2119 |
| 278 | nmdc:mga08y16_51177_c1 | 3300050511 | Bacteria | 4321 |
| 279 | nmdc:mga08y16_56865_c1 | 3300050511 | Bacteria | 4088 |
| 280 | nmdc:mga0n895_11_c1 | 3300050512 | Bacteria | 112540 |
| 281 | nmdc:mga0n895_182320_c1 | 3300050512 | Bacteria | 2131 |
| 282 | nmdc:mga0n895_5137_c1 | 3300050512 | Bacteria | 10882 |
| 283 | nmdc:mga0n895_8220_c1 | 3300050512 | Bacteria | 9021 |
| 284 | nmdc:mga0rr50_123817_c1 | 3300050513 | Bacteria | 2062 |
| 285 | nmdc:mga0rr50_1622_c1 | 3300050513 | Bacteria | 12380 |
| 286 | nmdc:mga0rr50_19_c1 | 3300050513 | Bacteria | 158236 |
| 287 | nmdc:mga0rr50_202680_c1 | 3300050513 | Bacteria | 1631 |
| 288 | nmdc:mga0rr50_8433_c1 | 3300050513 | Bacteria | 6416 |
| 289 | nmdc:mga08x19_10189_c1 | 3300050514 | Bacteria | 5641 |
| 290 | nmdc:mga08x19_39167_c1 | 3300050514 | Bacteria | 3013 |
| 291 | nmdc:mga08x19_43795_c1 | 3300050514 | Bacteria | 2856 |
| 292 | nmdc:mga08x19_48082_c1 | 3300050514 | Bacteria | 2732 |
| 293 | nmdc:mga08x19_58632_c1 | 3300050514 | Bacteria | 2491 |
| 294 | nmdc:mga0a205_38695_c1 | 3300050515 | Bacteria | 4589 |
| 295 | nmdc:mga0a205_56101_c1 | 3300050515 | Bacteria | 3804 |
| 296 | Ga0495601_0014122 | 3300053077 | Bacteria | 4812 |
| 297 | Ga0495601_0068813 | 3300053077 | Bacteria | 2257 |
| 298 | Ga0495619_0043004 | 3300053085 | Bacteria | 2960 |
| 299 | Ga0495619_0070760 | 3300053085 | Bacteria | 2333 |
| 300 | Ga0495619_0197533 | 3300053085 | Bacteria | 1393 |
| 301 | Ga0590075_023028 | 3300059424 | Bacteria | 1561 |
| 302 | Ga0501082_0090549 | 3300060353 | Bacteria | 2641 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_100135884 | Ga0207675_1001358841 | 328 |
| 2 | 3300025912 | Ga0207707_10142632 | Ga0207707_101426321 | 330 |
| 3 | 3300005518 | Ga0070699_100190631 | Ga0070699_1001906311 | 334 |
| 4 | 3300005439 | Ga0070711_100111135 | Ga0070711_1001111351 | 335 |
| 5 | 3300005937 | Ga0081455_10051001 | Ga0081455_100510012 | 335 |
| 6 | 3300025906 | Ga0207699_10009440 | Ga0207699_100094403 | 335 |
| 7 | 3300025916 | Ga0207663_10210593 | Ga0207663_102105931 | 335 |
| 8 | 3300025928 | Ga0207700_10003372 | Ga0207700_100033722 | 335 |
| 9 | 3300005719 | Ga0068861_100020433 | Ga0068861_1000204332 | 336 |
| 10 | 3300006173 | Ga0070716_100097961 | Ga0070716_1000979612 | 336 |
| 11 | 3300009147 | Ga0114129_10001174 | Ga0114129_1000117427 | 336 |
| 12 | 3300009177 | Ga0105248_10137252 | Ga0105248_101372522 | 336 |
| 13 | 3300025939 | Ga0207665_10065293 | Ga0207665_100652932 | 336 |
| 14 | 3300046684 | Ga0495669_0002827 | Ga0495669_0002827_1603_2757 | 336 |
| 15 | 3300050507 | nmdc:mga05p37_22470_c1 | nmdc:mga05p37_22470_c1_1605_2795 | 336 |
| 16 | 3300005364 | Ga0070673_100334408 | Ga0070673_1003344081 | 337 |
| 17 | 3300026088 | Ga0207641_10098357 | Ga0207641_100983572 | 338 |
| 18 | 3300005367 | Ga0070667_100184280 | Ga0070667_1001842802 | 339 |
| 19 | 3300025986 | Ga0207658_10178035 | Ga0207658_101780352 | 339 |
| 20 | 3300006871 | Ga0075434_100036241 | Ga0075434_1000362414 | 340 |
| 21 | 3300006914 | Ga0075436_100017746 | Ga0075436_1000177464 | 340 |
| 22 | 3300007076 | Ga0075435_100022429 | Ga0075435_1000224294 | 340 |
| 23 | 3300050512 | nmdc:mga0n895_11_c1 | nmdc:mga0n895_11_c1_70619_71818 | 340 |
| 24 | 3300050513 | nmdc:mga0rr50_19_c1 | nmdc:mga0rr50_19_c1_82825_84024 | 340 |
| 25 | 3300050514 | nmdc:mga08x19_39167_c1 | nmdc:mga08x19_39167_c1_405_1604 | 340 |
| 26 | 3300046473 | Ga0495582_0094548 | Ga0495582_0094548_306_1415 | 341 |
| 27 | 3300009177 | Ga0105248_10526852 | Ga0105248_105268521 | 342 |
| 28 | 3300025926 | Ga0207659_10080691 | Ga0207659_100806912 | 342 |
| 29 | 3300035116 | Ga0373945_0022582 | Ga0373945_0022582_800_1951 | 342 |
| 30 | 3300035170 | Ga0373943_0015996 | Ga0373943_0015996_1526_2677 | 342 |
| 31 | 3300035171 | Ga0373946_0005179 | Ga0373946_0005179_3124_4275 | 342 |
| 32 | 3300035692 | Ga0373935_0012630 | Ga0373935_0012630_3656_4807 | 342 |
| 33 | 3300035725 | Ga0373947_0072465 | Ga0373947_0072465_831_1982 | 342 |
| 34 | 3300036401 | Ga0373937_0455293 | Ga0373937_0455293_19_1170 | 342 |
| 35 | 3300037068 | Ga0373925_0055885 | Ga0373925_0055885_1263_2414 | 342 |
| 36 | 3300053077 | Ga0495601_0068813 | Ga0495601_0068813_644_1795 | 342 |
| 37 | 3300005563 | Ga0068855_100062542 | Ga0068855_1000625422 | 343 |
| 38 | 3300009551 | Ga0105238_10437393 | Ga0105238_104373931 | 343 |
| 39 | 3300025919 | Ga0207657_10026903 | Ga0207657_100269032 | 343 |
| 40 | 3300025949 | Ga0207667_10118977 | Ga0207667_101189772 | 343 |
| 41 | 3300050512 | nmdc:mga0n895_5137_c1 | nmdc:mga0n895_5137_c1_5674_6864 | 343 |
| 42 | 3300050513 | nmdc:mga0rr50_123817_c1 | nmdc:mga0rr50_123817_c1_105_1295 | 343 |
| 43 | 3300005471 | Ga0070698_100263085 | Ga0070698_1002630851 | 344 |
| 44 | 3300011119 | Ga0105246_10133109 | Ga0105246_101331092 | 345 |
| 45 | 3300005459 | Ga0068867_100184058 | Ga0068867_1001840581 | 349 |
| 46 | 3300009148 | Ga0105243_10261268 | Ga0105243_102612681 | 349 |
| 47 | 3300005328 | Ga0070676_10063238 | Ga0070676_100632382 | 350 |
| 48 | 3300005331 | Ga0070670_100232207 | Ga0070670_1002322071 | 350 |
| 49 | 3300005354 | Ga0070675_100080757 | Ga0070675_1000807572 | 350 |
| 50 | 3300005356 | Ga0070674_100242158 | Ga0070674_1002421581 | 350 |
| 51 | 3300005456 | Ga0070678_100004053 | Ga0070678_1000040536 | 350 |
| 52 | 3300005536 | Ga0070697_100109591 | Ga0070697_1001095911 | 350 |
| 53 | 3300005617 | Ga0068859_100160810 | Ga0068859_1001608102 | 350 |
| 54 | 3300006237 | Ga0097621_100050268 | Ga0097621_1000502682 | 350 |
| 55 | 3300006358 | Ga0068871_100091099 | Ga0068871_1000910992 | 350 |
| 56 | 3300006931 | Ga0097620_100160810 | Ga0097620_1001608102 | 350 |
| 57 | 3300009093 | Ga0105240_10140243 | Ga0105240_101402432 | 350 |
| 58 | 3300009094 | Ga0111539_10001119 | Ga0111539_100011193 | 350 |
| 59 | 3300009177 | Ga0105248_10089368 | Ga0105248_100893682 | 350 |
| 60 | 3300009177 | Ga0105248_10104758 | Ga0105248_101047582 | 350 |
| 61 | 3300009177 | Ga0105248_10193587 | Ga0105248_101935872 | 350 |
| 62 | 3300009551 | Ga0105238_10247912 | Ga0105238_102479122 | 350 |
| 63 | 3300009553 | Ga0105249_10168267 | Ga0105249_101682672 | 350 |
| 64 | 3300013296 | Ga0157374_10205842 | Ga0157374_102058422 | 350 |
| 65 | 3300014326 | Ga0157380_10323297 | Ga0157380_103232972 | 350 |
| 66 | 3300025893 | Ga0207682_10027555 | Ga0207682_100275552 | 350 |
| 67 | 3300025913 | Ga0207695_10096856 | Ga0207695_100968562 | 350 |
| 68 | 3300025941 | Ga0207711_10049132 | Ga0207711_100491321 | 350 |
| 69 | 3300025981 | Ga0207640_10013629 | Ga0207640_100136292 | 350 |
| 70 | 3300026095 | Ga0207676_10239432 | Ga0207676_102394322 | 350 |
| 71 | 3300026121 | Ga0207683_10007672 | Ga0207683_100076722 | 350 |
| 72 | 3300027876 | Ga0209974_10022136 | Ga0209974_100221362 | 350 |
| 73 | 3300027907 | Ga0207428_10010807 | Ga0207428_100108075 | 350 |
| 74 | 3300028379 | Ga0268266_10228222 | Ga0268266_102282222 | 350 |
| 75 | 3300046535 | Ga0495586_0111645 | Ga0495586_0111645_349_1419 | 350 |
| 76 | 3300046642 | Ga0495634_0024322 | Ga0495634_0024322_2919_4046 | 350 |
| 77 | 3300048903 | Ga0496100_0218762 | Ga0496100_0218762_263_1369 | 350 |
| 78 | 3300050511 | nmdc:mga08y16_51177_c1 | nmdc:mga08y16_51177_c1_279_1529 | 350 |
| 79 | 3300002459 | JGI24751J29686_10001090 | JGI24751J29686_100010904 | 351 |
| 80 | 3300005328 | Ga0070676_10000986 | Ga0070676_100009866 | 351 |
| 81 | 3300005328 | Ga0070676_10036882 | Ga0070676_100368822 | 351 |
| 82 | 3300005329 | Ga0070683_100213396 | Ga0070683_1002133962 | 351 |
| 83 | 3300005330 | Ga0070690_100009755 | Ga0070690_1000097554 | 351 |
| 84 | 3300005331 | Ga0070670_100023056 | Ga0070670_1000230564 | 351 |
| 85 | 3300005335 | Ga0070666_10001460 | Ga0070666_1000146011 | 351 |
| 86 | 3300005339 | Ga0070660_100077427 | Ga0070660_1000774272 | 351 |
| 87 | 3300005340 | Ga0070689_100132178 | Ga0070689_1001321781 | 351 |
| 88 | 3300005341 | Ga0070691_10006564 | Ga0070691_100065642 | 351 |
| 89 | 3300005347 | Ga0070668_100090435 | Ga0070668_1000904351 | 351 |
| 90 | 3300005353 | Ga0070669_100158990 | Ga0070669_1001589902 | 351 |
| 91 | 3300005355 | Ga0070671_100059703 | Ga0070671_1000597032 | 351 |
| 92 | 3300005364 | Ga0070673_100056848 | Ga0070673_1000568481 | 351 |
| 93 | 3300005366 | Ga0070659_100091827 | Ga0070659_1000918272 | 351 |
| 94 | 3300005367 | Ga0070667_100004804 | Ga0070667_1000048042 | 351 |
| 95 | 3300005435 | Ga0070714_100114637 | Ga0070714_1001146372 | 351 |
| 96 | 3300005438 | Ga0070701_10011576 | Ga0070701_100115762 | 351 |
| 97 | 3300005444 | Ga0070694_100007108 | Ga0070694_1000071082 | 351 |
| 98 | 3300005445 | Ga0070708_100172316 | Ga0070708_1001723162 | 351 |
| 99 | 3300005456 | Ga0070678_100029612 | Ga0070678_1000296122 | 351 |
| 100 | 3300005458 | Ga0070681_10037177 | Ga0070681_100371774 | 351 |
| 101 | 3300005458 | Ga0070681_10138362 | Ga0070681_101383621 | 351 |
| 102 | 3300005458 | Ga0070681_10172624 | Ga0070681_101726242 | 351 |
| 103 | 3300005466 | Ga0070685_10105276 | Ga0070685_101052761 | 351 |
| 104 | 3300005468 | Ga0070707_100093642 | Ga0070707_1000936422 | 351 |
| 105 | 3300005518 | Ga0070699_100005716 | Ga0070699_1000057165 | 351 |
| 106 | 3300005518 | Ga0070699_100091351 | Ga0070699_1000913512 | 351 |
| 107 | 3300005518 | Ga0070699_100114466 | Ga0070699_1001144662 | 351 |
| 108 | 3300005518 | Ga0070699_100190611 | Ga0070699_1001906111 | 351 |
| 109 | 3300005530 | Ga0070679_100050906 | Ga0070679_1000509062 | 351 |
| 110 | 3300005530 | Ga0070679_100098223 | Ga0070679_1000982232 | 351 |
| 111 | 3300005536 | Ga0070697_100083120 | Ga0070697_1000831201 | 351 |
| 112 | 3300005536 | Ga0070697_100085939 | Ga0070697_1000859392 | 351 |
| 113 | 3300005544 | Ga0070686_100001443 | Ga0070686_10000144310 | 351 |
| 114 | 3300005544 | Ga0070686_100045827 | Ga0070686_1000458272 | 351 |
| 115 | 3300005545 | Ga0070695_100201463 | Ga0070695_1002014632 | 351 |
| 116 | 3300005546 | Ga0070696_100055390 | Ga0070696_1000553902 | 351 |
| 117 | 3300005548 | Ga0070665_100191757 | Ga0070665_1001917571 | 351 |
| 118 | 3300005549 | Ga0070704_100047398 | Ga0070704_1000473982 | 351 |
| 119 | 3300005564 | Ga0070664_100192373 | Ga0070664_1001923732 | 351 |
| 120 | 3300005577 | Ga0068857_100130781 | Ga0068857_1001307812 | 351 |
| 121 | 3300005578 | Ga0068854_100053335 | Ga0068854_1000533352 | 351 |
| 122 | 3300005614 | Ga0068856_100034335 | Ga0068856_1000343352 | 351 |
| 123 | 3300005617 | Ga0068859_100239118 | Ga0068859_1002391182 | 351 |
| 124 | 3300005618 | Ga0068864_100003141 | Ga0068864_1000031415 | 351 |
| 125 | 3300005718 | Ga0068866_10025675 | Ga0068866_100256752 | 351 |
| 126 | 3300005841 | Ga0068863_100046453 | Ga0068863_1000464532 | 351 |
| 127 | 3300005841 | Ga0068863_100142959 | Ga0068863_1001429592 | 351 |
| 128 | 3300005843 | Ga0068860_100059670 | Ga0068860_1000596702 | 351 |
| 129 | 3300005843 | Ga0068860_100066799 | Ga0068860_1000667992 | 351 |
| 130 | 3300005843 | Ga0068860_100118549 | Ga0068860_1001185492 | 351 |
| 131 | 3300005937 | Ga0081455_10008733 | Ga0081455_100087332 | 351 |
| 132 | 3300005985 | Ga0081539_10054142 | Ga0081539_100541422 | 351 |
| 133 | 3300006237 | Ga0097621_100013447 | Ga0097621_1000134472 | 351 |
| 134 | 3300006237 | Ga0097621_100052332 | Ga0097621_1000523322 | 351 |
| 135 | 3300006237 | Ga0097621_100164097 | Ga0097621_1001640971 | 351 |
| 136 | 3300006871 | Ga0075434_100042105 | Ga0075434_1000421052 | 351 |
| 137 | 3300006871 | Ga0075434_100066146 | Ga0075434_1000661462 | 351 |
| 138 | 3300006880 | Ga0075429_100036513 | Ga0075429_1000365132 | 351 |
| 139 | 3300006880 | Ga0075429_100332537 | Ga0075429_1003325371 | 351 |
| 140 | 3300006914 | Ga0075436_100014955 | Ga0075436_1000149552 | 351 |
| 141 | 3300006914 | Ga0075436_100035607 | Ga0075436_1000356072 | 351 |
| 142 | 3300006914 | Ga0075436_100062393 | Ga0075436_1000623932 | 351 |
| 143 | 3300006914 | Ga0075436_100154968 | Ga0075436_1001549681 | 351 |
| 144 | 3300006931 | Ga0097620_100239116 | Ga0097620_1002391162 | 351 |
| 145 | 3300007076 | Ga0075435_100012125 | Ga0075435_1000121252 | 351 |
| 146 | 3300007076 | Ga0075435_100054130 | Ga0075435_1000541301 | 351 |
| 147 | 3300007076 | Ga0075435_100168518 | Ga0075435_1001685182 | 351 |
| 148 | 3300009093 | Ga0105240_10038904 | Ga0105240_100389042 | 351 |
| 149 | 3300009093 | Ga0105240_10126082 | Ga0105240_101260822 | 351 |
| 150 | 3300009093 | Ga0105240_10199549 | Ga0105240_101995492 | 351 |
| 151 | 3300009094 | Ga0111539_10022288 | Ga0111539_100222884 | 351 |
| 152 | 3300009094 | Ga0111539_10102355 | Ga0111539_101023552 | 351 |
| 153 | 3300009101 | Ga0105247_10058080 | Ga0105247_100580802 | 351 |
| 154 | 3300009147 | Ga0114129_10000997 | Ga0114129_1000099722 | 351 |
| 155 | 3300009147 | Ga0114129_10002196 | Ga0114129_1000219615 | 351 |
| 156 | 3300009147 | Ga0114129_10020638 | Ga0114129_100206382 | 351 |
| 157 | 3300009147 | Ga0114129_10028205 | Ga0114129_100282054 | 351 |
| 158 | 3300009147 | Ga0114129_10100890 | Ga0114129_101008902 | 351 |
| 159 | 3300009147 | Ga0114129_10147813 | Ga0114129_101478132 | 351 |
| 160 | 3300009147 | Ga0114129_10152236 | Ga0114129_101522362 | 351 |
| 161 | 3300009147 | Ga0114129_10163650 | Ga0114129_101636502 | 351 |
| 162 | 3300009147 | Ga0114129_10200542 | Ga0114129_102005422 | 351 |
| 163 | 3300009176 | Ga0105242_10049668 | Ga0105242_100496682 | 351 |
| 164 | 3300009176 | Ga0105242_10176892 | Ga0105242_101768922 | 351 |
| 165 | 3300009177 | Ga0105248_10063544 | Ga0105248_100635442 | 351 |
| 166 | 3300009553 | Ga0105249_10223449 | Ga0105249_102234491 | 351 |
| 167 | 3300011119 | Ga0105246_10204805 | Ga0105246_102048052 | 351 |
| 168 | 3300013306 | Ga0163162_10088655 | Ga0163162_100886552 | 351 |
| 169 | 3300013306 | Ga0163162_10320460 | Ga0163162_103204601 | 351 |
| 170 | 3300013308 | Ga0157375_10126428 | Ga0157375_101264282 | 351 |
| 171 | 3300013308 | Ga0157375_10157679 | Ga0157375_101576792 | 351 |
| 172 | 3300013308 | Ga0157375_10370992 | Ga0157375_103709922 | 351 |
| 173 | 3300014325 | Ga0163163_10008939 | Ga0163163_100089392 | 351 |
| 174 | 3300014325 | Ga0163163_10144001 | Ga0163163_101440012 | 351 |
| 175 | 3300014745 | Ga0157377_10040317 | Ga0157377_100403172 | 351 |
| 176 | 3300014968 | Ga0157379_10049036 | Ga0157379_100490362 | 351 |
| 177 | 3300014968 | Ga0157379_10169706 | Ga0157379_101697062 | 351 |
| 178 | 3300014969 | Ga0157376_10075114 | Ga0157376_100751142 | 351 |
| 179 | 3300014969 | Ga0157376_10078409 | Ga0157376_100784092 | 351 |
| 180 | 3300025899 | Ga0207642_10067500 | Ga0207642_100675001 | 351 |
| 181 | 3300025903 | Ga0207680_10001435 | Ga0207680_1000143510 | 351 |
| 182 | 3300025907 | Ga0207645_10066980 | Ga0207645_100669802 | 351 |
| 183 | 3300025912 | Ga0207707_10018304 | Ga0207707_100183043 | 351 |
| 184 | 3300025912 | Ga0207707_10019710 | Ga0207707_100197104 | 351 |
| 185 | 3300025913 | Ga0207695_10081851 | Ga0207695_100818512 | 351 |
| 186 | 3300025918 | Ga0207662_10087439 | Ga0207662_100874393 | 351 |
| 187 | 3300025919 | Ga0207657_10089866 | Ga0207657_100898662 | 351 |
| 188 | 3300025921 | Ga0207652_10024227 | Ga0207652_100242272 | 351 |
| 189 | 3300025922 | Ga0207646_10071767 | Ga0207646_100717672 | 351 |
| 190 | 3300025923 | Ga0207681_10088786 | Ga0207681_100887862 | 351 |
| 191 | 3300025925 | Ga0207650_10173262 | Ga0207650_101732621 | 351 |
| 192 | 3300025926 | Ga0207659_10000072 | Ga0207659_1000007249 | 351 |
| 193 | 3300025927 | Ga0207687_10037910 | Ga0207687_100379102 | 351 |
| 194 | 3300025933 | Ga0207706_10165776 | Ga0207706_101657762 | 351 |
| 195 | 3300025934 | Ga0207686_10021800 | Ga0207686_100218002 | 351 |
| 196 | 3300025938 | Ga0207704_10006608 | Ga0207704_100066084 | 351 |
| 197 | 3300025940 | Ga0207691_10070884 | Ga0207691_100708842 | 351 |
| 198 | 3300025941 | Ga0207711_10045170 | Ga0207711_100451702 | 351 |
| 199 | 3300025941 | Ga0207711_10081839 | Ga0207711_100818392 | 351 |
| 200 | 3300025942 | Ga0207689_10084733 | Ga0207689_100847331 | 351 |
| 201 | 3300025942 | Ga0207689_10210350 | Ga0207689_102103502 | 351 |
| 202 | 3300025960 | Ga0207651_10021719 | Ga0207651_100217191 | 351 |
| 203 | 3300025981 | Ga0207640_10042120 | Ga0207640_100421202 | 351 |
| 204 | 3300025986 | Ga0207658_10126475 | Ga0207658_101264752 | 351 |
| 205 | 3300026023 | Ga0207677_10126676 | Ga0207677_101266762 | 351 |
| 206 | 3300026035 | Ga0207703_10037916 | Ga0207703_100379162 | 351 |
| 207 | 3300026035 | Ga0207703_10305979 | Ga0207703_103059792 | 351 |
| 208 | 3300026041 | Ga0207639_10055270 | Ga0207639_100552702 | 351 |
| 209 | 3300026078 | Ga0207702_10089686 | Ga0207702_100896862 | 351 |
| 210 | 3300026088 | Ga0207641_10023804 | Ga0207641_100238042 | 351 |
| 211 | 3300026089 | Ga0207648_10005751 | Ga0207648_100057515 | 351 |
| 212 | 3300026095 | Ga0207676_10003454 | Ga0207676_100034545 | 351 |
| 213 | 3300026121 | Ga0207683_10069605 | Ga0207683_100696052 | 351 |
| 214 | 3300028379 | Ga0268266_10014019 | Ga0268266_100140194 | 351 |
| 215 | 3300028381 | Ga0268264_10052338 | Ga0268264_100523382 | 351 |
| 216 | 3300028381 | Ga0268264_10053894 | Ga0268264_100538943 | 351 |
| 217 | 3300032002 | Ga0307416_100167118 | Ga0307416_1001671182 | 351 |
| 218 | 3300034816 | Ga0373930_0000409 | Ga0373930_0000409_1844_2989 | 351 |
| 219 | 3300034817 | Ga0373948_0000409 | Ga0373948_0000409_2675_3820 | 351 |
| 220 | 3300034819 | Ga0373958_0009176 | Ga0373958_0009176_155_1300 | 351 |
| 221 | 3300034820 | Ga0373959_0002290 | Ga0373959_0002290_380_1525 | 351 |
| 222 | 3300034957 | Ga0373938_0001602 | Ga0373938_0001602_2401_3546 | 351 |
| 223 | 3300035084 | Ga0373928_0000693 | Ga0373928_0000693_4120_5265 | 351 |
| 224 | 3300035085 | Ga0373929_0000500 | Ga0373929_0000500_3300_4403 | 351 |
| 225 | 3300035086 | Ga0373934_0055013 | Ga0373934_0055013_51_1112 | 351 |
| 226 | 3300035088 | Ga0373940_0000710 | Ga0373940_0000710_2166_3269 | 351 |
| 227 | 3300035090 | Ga0373949_0001026 | Ga0373949_0001026_5137_6282 | 351 |
| 228 | 3300035091 | Ga0373951_0000835 | Ga0373951_0000835_1432_2577 | 351 |
| 229 | 3300035092 | Ga0373952_0000580 | Ga0373952_0000580_2731_3876 | 351 |
| 230 | 3300035114 | Ga0373939_0000222 | Ga0373939_0000222_2738_3883 | 351 |
| 231 | 3300035115 | Ga0373941_0002079 | Ga0373941_0002079_307_1452 | 351 |
| 232 | 3300035117 | Ga0373953_0078737 | Ga0373953_0078737_170_1231 | 351 |
| 233 | 3300035121 | Ga0373960_0000140 | Ga0373960_0000140_3300_4445 | 351 |
| 234 | 3300035172 | Ga0373955_0109349 | Ga0373955_0109349_486_1586 | 351 |
| 235 | 3300035172 | Ga0373955_0189377 | Ga0373955_0189377_83_1144 | 351 |
| 236 | 3300035207 | Ga0373942_0001703 | Ga0373942_0001703_4007_5152 | 351 |
| 237 | 3300035241 | Ga0373961_0000977 | Ga0373961_0000977_5454_6599 | 351 |
| 238 | 3300035242 | Ga0373962_0039807 | Ga0373962_0039807_171_1298 | 351 |
| 239 | 3300035691 | Ga0373931_0000392 | Ga0373931_0000392_9695_10840 | 351 |
| 240 | 3300036401 | Ga0373937_0041778 | Ga0373937_0041778_2334_3434 | 351 |
| 241 | 3300036401 | Ga0373937_0213228 | Ga0373937_0213228_143_1204 | 351 |
| 242 | 3300041999 | Ga0439433_0003945 | Ga0439433_0003945_1166_2299 | 351 |
| 243 | 3300042008 | Ga0439450_023005 | Ga0439450_023005_192_1253 | 351 |
| 244 | 3300045051 | Ga0451576_0004093 | Ga0451576_0004093_5095_6240 | 351 |
| 245 | 3300045051 | Ga0451576_0083419 | Ga0451576_0083419_1008_2174 | 351 |
| 246 | 3300046533 | Ga0495640_0218805 | Ga0495640_0218805_62_1123 | 351 |
| 247 | 3300046536 | Ga0495587_0110792 | Ga0495587_0110792_370_1431 | 351 |
| 248 | 3300046543 | Ga0495645_0007405 | Ga0495645_0007405_3229_4329 | 351 |
| 249 | 3300046681 | Ga0495647_0039026 | Ga0495647_0039026_120_1325 | 351 |
| 250 | 3300046689 | Ga0495613_0249251 | Ga0495613_0249251_23_1084 | 351 |
| 251 | 3300047317 | Ga0495604_0083607 | Ga0495604_0083607_923_1984 | 351 |
| 252 | 3300047317 | Ga0495604_0186279 | Ga0495604_0186279_234_1334 | 351 |
| 253 | 3300047471 | Ga0495684_0043687 | Ga0495684_0043687_1521_2621 | 351 |
| 254 | 3300048903 | Ga0496100_0069520 | Ga0496100_0069520_689_1831 | 351 |
| 255 | 3300048904 | Ga0496101_0001911 | Ga0496101_0001911_9786_10928 | 351 |
| 256 | 3300048905 | Ga0496102_0056429 | Ga0496102_0056429_1288_2472 | 351 |
| 257 | 3300048905 | Ga0496102_0190371 | Ga0496102_0190371_97_1356 | 351 |
| 258 | 3300048906 | Ga0496103_0111536 | Ga0496103_0111536_115_1299 | 351 |
| 259 | 3300048907 | Ga0496104_0020531 | Ga0496104_0020531_1609_2751 | 351 |
| 260 | 3300048907 | Ga0496104_0131196 | Ga0496104_0131196_530_1591 | 351 |
| 261 | 3300048910 | Ga0496107_0025813 | Ga0496107_0025813_16_1158 | 351 |
| 262 | 3300048912 | Ga0496109_0106740 | Ga0496109_0106740_399_1658 | 351 |
| 263 | 3300048915 | Ga0496112_0035661 | Ga0496112_0035661_1094_2155 | 351 |
| 264 | 3300048917 | Ga0496114_0000613 | Ga0496114_0000613_17567_18709 | 351 |
| 265 | 3300048917 | Ga0496114_0408516 | Ga0496114_0408516_106_1164 | 351 |
| 266 | 3300049571 | Ga0501034_0005914 | Ga0501034_0005914_4574_5722 | 351 |
| 267 | 3300049578 | Ga0501042_0314742 | Ga0501042_0314742_42_1103 | 351 |
| 268 | 3300049579 | Ga0501043_0171204 | Ga0501043_0171204_365_1513 | 351 |
| 269 | 3300049581 | Ga0501047_0001540 | Ga0501047_0001540_18288_19436 | 351 |
| 270 | 3300049581 | Ga0501047_0220320 | Ga0501047_0220320_432_1655 | 351 |
| 271 | 3300049592 | Ga0501076_0184828 | Ga0501076_0184828_354_1415 | 351 |
| 272 | 3300049744 | Ga0501083_0152065 | Ga0501083_0152065_346_1446 | 351 |
| 273 | 3300049823 | Ga0501044_0036519 | Ga0501044_0036519_2161_3309 | 351 |
| 274 | 3300050507 | nmdc:mga05p37_1000_c1 | nmdc:mga05p37_1000_c1_4980_6164 | 351 |
| 275 | 3300050507 | nmdc:mga05p37_120531_c1 | nmdc:mga05p37_120531_c1_1471_2658 | 351 |
| 276 | 3300050507 | nmdc:mga05p37_184035_c1 | nmdc:mga05p37_184035_c1_920_2125 | 351 |
| 277 | 3300050507 | nmdc:mga05p37_24195_c1 | nmdc:mga05p37_24195_c1_5739_6965 | 351 |
| 278 | 3300050507 | nmdc:mga05p37_25634_c1 | nmdc:mga05p37_25634_c1_1536_2594 | 351 |
| 279 | 3300050507 | nmdc:mga05p37_428360_c1 | nmdc:mga05p37_428360_c1_130_1338 | 351 |
| 280 | 3300050507 | nmdc:mga05p37_8828_c1 | nmdc:mga05p37_8828_c1_200_1261 | 351 |
| 281 | 3300050507 | nmdc:mga05p37_91344_c1 | nmdc:mga05p37_91344_c1_137_1198 | 351 |
| 282 | 3300050508 | nmdc:mga09592_23788_c1 | nmdc:mga09592_23788_c1_958_2019 | 351 |
| 283 | 3300050511 | nmdc:mga08y16_168841_c1 | nmdc:mga08y16_168841_c1_596_1657 | 351 |
| 284 | 3300050511 | nmdc:mga08y16_191800_c1 | nmdc:mga08y16_191800_c1_981_2042 | 351 |
| 285 | 3300050511 | nmdc:mga08y16_56865_c1 | nmdc:mga08y16_56865_c1_265_1503 | 351 |
| 286 | 3300050512 | nmdc:mga0n895_182320_c1 | nmdc:mga0n895_182320_c1_1048_2109 | 351 |
| 287 | 3300050512 | nmdc:mga0n895_8220_c1 | nmdc:mga0n895_8220_c1_2558_3745 | 351 |
| 288 | 3300050513 | nmdc:mga0rr50_1622_c1 | nmdc:mga0rr50_1622_c1_5492_6637 | 351 |
| 289 | 3300050513 | nmdc:mga0rr50_202680_c1 | nmdc:mga0rr50_202680_c1_94_1278 | 351 |
| 290 | 3300050513 | nmdc:mga0rr50_8433_c1 | nmdc:mga0rr50_8433_c1_2358_3563 | 351 |
| 291 | 3300050514 | nmdc:mga08x19_10189_c1 | nmdc:mga08x19_10189_c1_2589_3785 | 351 |
| 292 | 3300050514 | nmdc:mga08x19_43795_c1 | nmdc:mga08x19_43795_c1_1050_2234 | 351 |
| 293 | 3300050514 | nmdc:mga08x19_48082_c1 | nmdc:mga08x19_48082_c1_1517_2710 | 351 |
| 294 | 3300050514 | nmdc:mga08x19_58632_c1 | nmdc:mga08x19_58632_c1_293_1495 | 351 |
| 295 | 3300050515 | nmdc:mga0a205_38695_c1 | nmdc:mga0a205_38695_c1_1211_2419 | 351 |
| 296 | 3300050515 | nmdc:mga0a205_56101_c1 | nmdc:mga0a205_56101_c1_2179_3240 | 351 |
| 297 | 3300053077 | Ga0495601_0014122 | Ga0495601_0014122_795_1895 | 351 |
| 298 | 3300053085 | Ga0495619_0043004 | Ga0495619_0043004_583_1644 | 351 |
| 299 | 3300053085 | Ga0495619_0070760 | Ga0495619_0070760_1107_2207 | 351 |
| 300 | 3300053085 | Ga0495619_0197533 | Ga0495619_0197533_179_1321 | 351 |
| 301 | 3300059424 | Ga0590075_023028 | Ga0590075_023028_71_1231 | 351 |
| 302 | 3300060353 | Ga0501082_0090549 | Ga0501082_0090549_204_1340 | 351 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar