F396286

General Info

Members Datasets Scaffolds Average Seq Length
302 186 302 376

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10000986|Ga0070676_100009866
Length 353
Sequence MRNGVIAFRRDGTLALMNDEAYRIFGLTPAPGDIGRPFADVLRERPEIIRLMFSSFELSYLPNRAELRLKDLDRVIGYTISHVRDESGDAPIGAVLFFKDLTRVEQIEEQERLRDRLASLGEMAAGIAHELKNPLAGIEVMAGLLRRQVPESKDAQSLLADILSEAKLANAIVVEMLEFVRPVRLQVERTDLADVLQQSVTMAESKARRGQVTVATEIEQGLPPIDGDHHQLSQVFTNLVANAFEAMDGKGHITITAATSTIDADPAFAGVHPPTPVVVVEVADDGPGIAPELTDRIFNPFFTTKVTGTGLGLAIVRKIIDAHDGRIDVHSNAQTGTKFRVTVPVTSASSWFK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
121 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
122 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
123 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
127 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.3
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001090 3300002459 Bacteria 5884
2 Ga0070676_10000986 3300005328 Bacteria 14151
3 Ga0070676_10036882 3300005328 Bacteria 2817
4 Ga0070676_10063238 3300005328 Bacteria 2204
5 Ga0070683_100213396 3300005329 Bacteria 1834
6 Ga0070690_100009755 3300005330 Bacteria 5569
7 Ga0070670_100023056 3300005331 Bacteria 5356
8 Ga0070670_100232207 3300005331 Unclassified 1605
9 Ga0070666_10001460 3300005335 Bacteria 14346
10 Ga0070660_100077427 3300005339 Bacteria 2606
11 Ga0070689_100132178 3300005340 Bacteria 2002
12 Ga0070691_10006564 3300005341 Bacteria 5322
13 Ga0070668_100090435 3300005347 Bacteria 2412
14 Ga0070669_100158990 3300005353 Bacteria 1754
15 Ga0070675_100080757 3300005354 Bacteria 2711
16 Ga0070671_100059703 3300005355 Bacteria 3174
17 Ga0070674_100242158 3300005356 Unclassified 1413
18 Ga0070673_100056848 3300005364 Bacteria 3088
19 Ga0070673_100334408 3300005364 Bacteria 1341
20 Ga0070659_100091827 3300005366 Bacteria 2434
21 Ga0070667_100004804 3300005367 Bacteria 11320
22 Ga0070667_100184280 3300005367 Bacteria 1847
23 Ga0070714_100114637 3300005435 Bacteria 2391
24 Ga0070701_10011576 3300005438 Bacteria 3950
25 Ga0070711_100111135 3300005439 Bacteria 2012
26 Ga0070694_100007108 3300005444 Bacteria 6817
27 Ga0070708_100172316 3300005445 Bacteria 2021
28 Ga0070678_100004053 3300005456 Bacteria 8247
29 Ga0070678_100029612 3300005456 Bacteria 3751
30 Ga0070681_10037177 3300005458 Bacteria 4887
31 Ga0070681_10138362 3300005458 Bacteria 2364
32 Ga0070681_10172624 3300005458 Bacteria 2084
33 Ga0068867_100184058 3300005459 Bacteria 1663
34 Ga0070685_10105276 3300005466 Bacteria 1729
35 Ga0070707_100093642 3300005468 Bacteria 2909
36 Ga0070698_100263085 3300005471 Bacteria 1657
37 Ga0070699_100005716 3300005518 Bacteria 10890
38 Ga0070699_100091351 3300005518 Bacteria 2662
39 Ga0070699_100114466 3300005518 Bacteria 2370
40 Ga0070699_100190611 3300005518 Bacteria 1821
41 Ga0070699_100190631 3300005518 Bacteria 1821
42 Ga0070679_100050906 3300005530 Bacteria 4126
43 Ga0070679_100098223 3300005530 Bacteria 2916
44 Ga0070697_100083120 3300005536 Bacteria 2640
45 Ga0070697_100085939 3300005536 Bacteria 2595
46 Ga0070697_100109591 3300005536 Bacteria 2299
47 Ga0070686_100001443 3300005544 Bacteria 13429
48 Ga0070686_100045827 3300005544 Bacteria 2756
49 Ga0070695_100201463 3300005545 Bacteria 1423
50 Ga0070696_100055390 3300005546 Bacteria 2765
51 Ga0070665_100191757 3300005548 Bacteria 2044
52 Ga0070704_100047398 3300005549 Bacteria 3004
53 Ga0068855_100062542 3300005563 Bacteria 4345
54 Ga0070664_100192373 3300005564 Bacteria 1818
55 Ga0068857_100130781 3300005577 Bacteria 2264
56 Ga0068854_100053335 3300005578 Bacteria 2904
57 Ga0068856_100034335 3300005614 Bacteria 4968
58 Ga0068859_100160810 3300005617 Bacteria 2325
59 Ga0068859_100239118 3300005617 Bacteria 1905
60 Ga0068864_100003141 3300005618 Bacteria 13649
61 Ga0068866_10025675 3300005718 Bacteria 2772
62 Ga0068861_100020433 3300005719 Bacteria 4744
63 Ga0068863_100046453 3300005841 Bacteria 4121
64 Ga0068863_100142959 3300005841 Bacteria 2287
65 Ga0068860_100059670 3300005843 Bacteria 3626
66 Ga0068860_100066799 3300005843 Bacteria 3417
67 Ga0068860_100118549 3300005843 Bacteria 2533
68 Ga0081455_10008733 3300005937 Bacteria 10492
69 Ga0081455_10051001 3300005937 Bacteria 3552
70 Ga0081539_10054142 3300005985 Bacteria 2242
71 Ga0070716_100097961 3300006173 Bacteria 1791
72 Ga0097621_100013447 3300006237 Bacteria 6101
73 Ga0097621_100050268 3300006237 Bacteria 3390
74 Ga0097621_100052332 3300006237 Bacteria 3326
75 Ga0097621_100164097 3300006237 Bacteria 1911
76 Ga0068871_100091099 3300006358 Bacteria 2541
77 Ga0075434_100036241 3300006871 Bacteria 4880
78 Ga0075434_100042105 3300006871 Bacteria 4527
79 Ga0075434_100066146 3300006871 Bacteria 3600
80 Ga0075429_100036513 3300006880 Bacteria 4274
81 Ga0075429_100332537 3300006880 Bacteria 1330
82 Ga0075436_100014955 3300006914 Bacteria 5319
83 Ga0075436_100017746 3300006914 Bacteria 4872
84 Ga0075436_100035607 3300006914 Bacteria 3433
85 Ga0075436_100062393 3300006914 Bacteria 2575
86 Ga0075436_100154968 3300006914 Bacteria 1613
87 Ga0097620_100160810 3300006931 Bacteria 2325
88 Ga0097620_100239116 3300006931 Bacteria 1905
89 Ga0075435_100012125 3300007076 Bacteria 6373
90 Ga0075435_100022429 3300007076 Bacteria 4872
91 Ga0075435_100054130 3300007076 Bacteria 3238
92 Ga0075435_100168518 3300007076 Bacteria 1847
93 Ga0105240_10038904 3300009093 Bacteria 6097
94 Ga0105240_10126082 3300009093 Bacteria 3076
95 Ga0105240_10140243 3300009093 Bacteria 2891
96 Ga0105240_10199549 3300009093 Bacteria 2345
97 Ga0111539_10001119 3300009094 Bacteria 35455
98 Ga0111539_10022288 3300009094 Bacteria 7785
99 Ga0111539_10102355 3300009094 Bacteria 3361
100 Ga0105247_10058080 3300009101 Bacteria 2393
101 Ga0114129_10000997 3300009147 Bacteria 36967
102 Ga0114129_10001174 3300009147 Bacteria 34722
103 Ga0114129_10002196 3300009147 Bacteria 26870
104 Ga0114129_10020638 3300009147 Bacteria 9367
105 Ga0114129_10028205 3300009147 Bacteria 7954
106 Ga0114129_10100890 3300009147 Bacteria 3994
107 Ga0114129_10147813 3300009147 Bacteria 3218
108 Ga0114129_10152236 3300009147 Bacteria 3165
109 Ga0114129_10163650 3300009147 Bacteria 3038
110 Ga0114129_10200542 3300009147 Bacteria 2703
111 Ga0105243_10261268 3300009148 Bacteria 1550
112 Ga0105242_10049668 3300009176 Bacteria 3414
113 Ga0105242_10176892 3300009176 Bacteria 1880
114 Ga0105248_10063544 3300009177 Bacteria 4144
115 Ga0105248_10089368 3300009177 Bacteria 3467
116 Ga0105248_10104758 3300009177 Bacteria 3189
117 Ga0105248_10137252 3300009177 Bacteria 2759
118 Ga0105248_10193587 3300009177 Bacteria 2291
119 Ga0105248_10526852 3300009177 Bacteria 1333
120 Ga0105238_10247912 3300009551 Bacteria 1759
121 Ga0105238_10437393 3300009551 Bacteria 1304
122 Ga0105249_10168267 3300009553 Bacteria 2124
123 Ga0105249_10223449 3300009553 Bacteria 1854
124 Ga0105246_10133109 3300011119 Bacteria 1860
125 Ga0105246_10204805 3300011119 Bacteria 1536
126 Ga0157374_10205842 3300013296 Bacteria 1928
127 Ga0163162_10088655 3300013306 Bacteria 3173
128 Ga0163162_10320460 3300013306 Bacteria 1683
129 Ga0157375_10126428 3300013308 Bacteria 2671
130 Ga0157375_10157679 3300013308 Bacteria 2410
131 Ga0157375_10370992 3300013308 Bacteria 1597
132 Ga0163163_10008939 3300014325 Bacteria 8923
133 Ga0163163_10144001 3300014325 Bacteria 2426
134 Ga0157380_10323297 3300014326 Bacteria 1431
135 Ga0157377_10040317 3300014745 Bacteria 2585
136 Ga0157379_10049036 3300014968 Bacteria 3770
137 Ga0157379_10169706 3300014968 Bacteria 1969
138 Ga0157376_10075114 3300014969 Bacteria 2883
139 Ga0157376_10078409 3300014969 Bacteria 2829
140 Ga0207682_10027555 3300025893 Bacteria 2263
141 Ga0207642_10067500 3300025899 Bacteria 1688
142 Ga0207680_10001435 3300025903 Bacteria 11296
143 Ga0207699_10009440 3300025906 Bacteria 4858
144 Ga0207645_10066980 3300025907 Bacteria 2295
145 Ga0207707_10018304 3300025912 Bacteria 6106
146 Ga0207707_10019710 3300025912 Bacteria 5887
147 Ga0207707_10142632 3300025912 Bacteria 2094
148 Ga0207695_10081851 3300025913 Bacteria 3266
149 Ga0207695_10096856 3300025913 Bacteria 2952
150 Ga0207663_10210593 3300025916 Bacteria 1408
151 Ga0207662_10087439 3300025918 Bacteria 1912
152 Ga0207657_10026903 3300025919 Bacteria 5275
153 Ga0207657_10089866 3300025919 Bacteria 2564
154 Ga0207652_10024227 3300025921 Bacteria 5034
155 Ga0207646_10071767 3300025922 Bacteria 3092
156 Ga0207681_10088786 3300025923 Bacteria 2202
157 Ga0207650_10173262 3300025925 Bacteria 1716
158 Ga0207659_10000072 3300025926 Bacteria 64525
159 Ga0207659_10080691 3300025926 Bacteria 2404
160 Ga0207687_10037910 3300025927 Bacteria 3292
161 Ga0207700_10003372 3300025928 Bacteria 9273
162 Ga0207706_10165776 3300025933 Bacteria 1942
163 Ga0207686_10021800 3300025934 Bacteria 3682
164 Ga0207704_10006608 3300025938 Bacteria 5426
165 Ga0207665_10065293 3300025939 Bacteria 2475
166 Ga0207691_10070884 3300025940 Bacteria 3147
167 Ga0207711_10045170 3300025941 Bacteria 3764
168 Ga0207711_10049132 3300025941 Bacteria 3611
169 Ga0207711_10081839 3300025941 Bacteria 2822
170 Ga0207689_10084733 3300025942 Bacteria 2605
171 Ga0207689_10210350 3300025942 Bacteria 1607
172 Ga0207667_10118977 3300025949 Bacteria 2722
173 Ga0207651_10021719 3300025960 Bacteria 3908
174 Ga0207640_10013629 3300025981 Bacteria 4665
175 Ga0207640_10042120 3300025981 Bacteria 2909
176 Ga0207658_10126475 3300025986 Bacteria 2046
177 Ga0207658_10178035 3300025986 Bacteria 1758
178 Ga0207677_10126676 3300026023 Bacteria 1931
179 Ga0207703_10037916 3300026035 Bacteria 3843
180 Ga0207703_10305979 3300026035 Bacteria 1451
181 Ga0207639_10055270 3300026041 Bacteria 3038
182 Ga0207702_10089686 3300026078 Bacteria 2689
183 Ga0207641_10023804 3300026088 Bacteria 5046
184 Ga0207641_10098357 3300026088 Bacteria 2573
185 Ga0207648_10005751 3300026089 Bacteria 12425
186 Ga0207676_10003454 3300026095 Bacteria 11182
187 Ga0207676_10239432 3300026095 Unclassified 1627
188 Ga0207675_100135884 3300026118 Bacteria 2333
189 Ga0207683_10007672 3300026121 Bacteria 9236
190 Ga0207683_10069605 3300026121 Bacteria 3108
191 Ga0209974_10022136 3300027876 Bacteria 2104
192 Ga0207428_10010807 3300027907 Bacteria 8138
193 Ga0268266_10014019 3300028379 Bacteria 6901
194 Ga0268266_10228222 3300028379 Bacteria 1714
195 Ga0268264_10052338 3300028381 Bacteria 3404
196 Ga0268264_10053894 3300028381 Bacteria 3357
197 Ga0307416_100167118 3300032002 Bacteria 2042
198 Ga0373930_0000409 3300034816 Bacteria 5697
199 Ga0373948_0000409 3300034817 Bacteria 5287
200 Ga0373958_0009176 3300034819 Bacteria 1622
201 Ga0373959_0002290 3300034820 Bacteria 3042
202 Ga0373938_0001602 3300034957 Bacteria 3641
203 Ga0373928_0000693 3300035084 Bacteria 6609
204 Ga0373929_0000500 3300035085 Bacteria 7481
205 Ga0373934_0055013 3300035086 Bacteria 1581
206 Ga0373940_0000710 3300035088 Bacteria 5400
207 Ga0373949_0001026 3300035090 Bacteria 8602
208 Ga0373951_0000835 3300035091 Bacteria 8381
209 Ga0373952_0000580 3300035092 Bacteria 6454
210 Ga0373939_0000222 3300035114 Bacteria 15549
211 Ga0373941_0002079 3300035115 Bacteria 4347
212 Ga0373945_0022582 3300035116 Bacteria 2168
213 Ga0373953_0078737 3300035117 Bacteria 1368
214 Ga0373960_0000140 3300035121 Bacteria 12051
215 Ga0373943_0015996 3300035170 Bacteria 3415
216 Ga0373946_0005179 3300035171 Bacteria 4700
217 Ga0373955_0109349 3300035172 Bacteria 1597
218 Ga0373955_0189377 3300035172 Bacteria 1223
219 Ga0373942_0001703 3300035207 Bacteria 5578
220 Ga0373961_0000977 3300035241 Bacteria 9454
221 Ga0373962_0039807 3300035242 Bacteria 1321
222 Ga0373931_0000392 3300035691 Bacteria 17983
223 Ga0373935_0012630 3300035692 Bacteria 5081
224 Ga0373947_0072465 3300035725 Bacteria 2115
225 Ga0373937_0041778 3300036401 Bacteria 4183
226 Ga0373937_0213228 3300036401 Bacteria 1817
227 Ga0373937_0455293 3300036401 Bacteria 1215
228 Ga0373925_0055885 3300037068 Bacteria 2956
229 Ga0439433_0003945 3300041999 Bacteria 3192
230 Ga0439450_023005 3300042008 Bacteria 1349
231 Ga0451576_0004093 3300045051 Bacteria 19254
232 Ga0451576_0083419 3300045051 Bacteria 3325
233 Ga0495582_0094548 3300046473 Bacteria 1669
234 Ga0495640_0218805 3300046533 Bacteria 1202
235 Ga0495586_0111645 3300046535 Bacteria 1522
236 Ga0495587_0110792 3300046536 Bacteria 1577
237 Ga0495645_0007405 3300046543 Bacteria 7635
238 Ga0495634_0024322 3300046642 Bacteria 4250
239 Ga0495647_0039026 3300046681 Bacteria 1797
240 Ga0495669_0002827 3300046684 Bacteria 7123
241 Ga0495613_0249251 3300046689 Bacteria 1240
242 Ga0495604_0083607 3300047317 Bacteria 2385
243 Ga0495604_0186279 3300047317 Bacteria 1449
244 Ga0495684_0043687 3300047471 Bacteria 3432
245 Ga0496100_0069520 3300048903 Bacteria 2345
246 Ga0496100_0218762 3300048903 Bacteria 1397
247 Ga0496101_0001911 3300048904 Bacteria 12588
248 Ga0496102_0056429 3300048905 Bacteria 3583
249 Ga0496102_0190371 3300048905 Bacteria 1933
250 Ga0496103_0111536 3300048906 Bacteria 1738
251 Ga0496104_0020531 3300048907 Bacteria 6056
252 Ga0496104_0131196 3300048907 Bacteria 2407
253 Ga0496107_0025813 3300048910 Bacteria 4163
254 Ga0496109_0106740 3300048912 Bacteria 2601
255 Ga0496112_0035661 3300048915 Bacteria 4848
256 Ga0496114_0000613 3300048917 Bacteria 26374
257 Ga0496114_0408516 3300048917 Bacteria 1202
258 Ga0501034_0005914 3300049571 Bacteria 13275
259 Ga0501042_0314742 3300049578 Bacteria 1131
260 Ga0501043_0171204 3300049579 Bacteria 1694
261 Ga0501047_0001540 3300049581 Bacteria 22545
262 Ga0501047_0220320 3300049581 Bacteria 1754
263 Ga0501076_0184828 3300049592 Bacteria 1700
264 Ga0501083_0152065 3300049744 Bacteria 1515
265 Ga0501044_0036519 3300049823 Bacteria 5141
266 nmdc:mga05p37_1000_c1 3300050507 Bacteria 32217
267 nmdc:mga05p37_120531_c1 3300050507 Bacteria 3223
268 nmdc:mga05p37_184035_c1 3300050507 Bacteria 2540
269 nmdc:mga05p37_22470_c1 3300050507 Bacteria 7648
270 nmdc:mga05p37_24195_c1 3300050507 Bacteria 7379
271 nmdc:mga05p37_25634_c1 3300050507 Bacteria 7172
272 nmdc:mga05p37_428360_c1 3300050507 Bacteria 1538
273 nmdc:mga05p37_8828_c1 3300050507 Bacteria 11908
274 nmdc:mga05p37_91344_c1 3300050507 Bacteria 3752
275 nmdc:mga09592_23788_c1 3300050508 Bacteria 5061
276 nmdc:mga08y16_168841_c1 3300050511 Bacteria 2273
277 nmdc:mga08y16_191800_c1 3300050511 Bacteria 2119
278 nmdc:mga08y16_51177_c1 3300050511 Bacteria 4321
279 nmdc:mga08y16_56865_c1 3300050511 Bacteria 4088
280 nmdc:mga0n895_11_c1 3300050512 Bacteria 112540
281 nmdc:mga0n895_182320_c1 3300050512 Bacteria 2131
282 nmdc:mga0n895_5137_c1 3300050512 Bacteria 10882
283 nmdc:mga0n895_8220_c1 3300050512 Bacteria 9021
284 nmdc:mga0rr50_123817_c1 3300050513 Bacteria 2062
285 nmdc:mga0rr50_1622_c1 3300050513 Bacteria 12380
286 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
287 nmdc:mga0rr50_202680_c1 3300050513 Bacteria 1631
288 nmdc:mga0rr50_8433_c1 3300050513 Bacteria 6416
289 nmdc:mga08x19_10189_c1 3300050514 Bacteria 5641
290 nmdc:mga08x19_39167_c1 3300050514 Bacteria 3013
291 nmdc:mga08x19_43795_c1 3300050514 Bacteria 2856
292 nmdc:mga08x19_48082_c1 3300050514 Bacteria 2732
293 nmdc:mga08x19_58632_c1 3300050514 Bacteria 2491
294 nmdc:mga0a205_38695_c1 3300050515 Bacteria 4589
295 nmdc:mga0a205_56101_c1 3300050515 Bacteria 3804
296 Ga0495601_0014122 3300053077 Bacteria 4812
297 Ga0495601_0068813 3300053077 Bacteria 2257
298 Ga0495619_0043004 3300053085 Bacteria 2960
299 Ga0495619_0070760 3300053085 Bacteria 2333
300 Ga0495619_0197533 3300053085 Bacteria 1393
301 Ga0590075_023028 3300059424 Bacteria 1561
302 Ga0501082_0090549 3300060353 Bacteria 2641

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100135884 Ga0207675_1001358841 328
2 3300025912 Ga0207707_10142632 Ga0207707_101426321 330
3 3300005518 Ga0070699_100190631 Ga0070699_1001906311 334
4 3300005439 Ga0070711_100111135 Ga0070711_1001111351 335
5 3300005937 Ga0081455_10051001 Ga0081455_100510012 335
6 3300025906 Ga0207699_10009440 Ga0207699_100094403 335
7 3300025916 Ga0207663_10210593 Ga0207663_102105931 335
8 3300025928 Ga0207700_10003372 Ga0207700_100033722 335
9 3300005719 Ga0068861_100020433 Ga0068861_1000204332 336
10 3300006173 Ga0070716_100097961 Ga0070716_1000979612 336
11 3300009147 Ga0114129_10001174 Ga0114129_1000117427 336
12 3300009177 Ga0105248_10137252 Ga0105248_101372522 336
13 3300025939 Ga0207665_10065293 Ga0207665_100652932 336
14 3300046684 Ga0495669_0002827 Ga0495669_0002827_1603_2757 336
15 3300050507 nmdc:mga05p37_22470_c1 nmdc:mga05p37_22470_c1_1605_2795 336
16 3300005364 Ga0070673_100334408 Ga0070673_1003344081 337
17 3300026088 Ga0207641_10098357 Ga0207641_100983572 338
18 3300005367 Ga0070667_100184280 Ga0070667_1001842802 339
19 3300025986 Ga0207658_10178035 Ga0207658_101780352 339
20 3300006871 Ga0075434_100036241 Ga0075434_1000362414 340
21 3300006914 Ga0075436_100017746 Ga0075436_1000177464 340
22 3300007076 Ga0075435_100022429 Ga0075435_1000224294 340
23 3300050512 nmdc:mga0n895_11_c1 nmdc:mga0n895_11_c1_70619_71818 340
24 3300050513 nmdc:mga0rr50_19_c1 nmdc:mga0rr50_19_c1_82825_84024 340
25 3300050514 nmdc:mga08x19_39167_c1 nmdc:mga08x19_39167_c1_405_1604 340
26 3300046473 Ga0495582_0094548 Ga0495582_0094548_306_1415 341
27 3300009177 Ga0105248_10526852 Ga0105248_105268521 342
28 3300025926 Ga0207659_10080691 Ga0207659_100806912 342
29 3300035116 Ga0373945_0022582 Ga0373945_0022582_800_1951 342
30 3300035170 Ga0373943_0015996 Ga0373943_0015996_1526_2677 342
31 3300035171 Ga0373946_0005179 Ga0373946_0005179_3124_4275 342
32 3300035692 Ga0373935_0012630 Ga0373935_0012630_3656_4807 342
33 3300035725 Ga0373947_0072465 Ga0373947_0072465_831_1982 342
34 3300036401 Ga0373937_0455293 Ga0373937_0455293_19_1170 342
35 3300037068 Ga0373925_0055885 Ga0373925_0055885_1263_2414 342
36 3300053077 Ga0495601_0068813 Ga0495601_0068813_644_1795 342
37 3300005563 Ga0068855_100062542 Ga0068855_1000625422 343
38 3300009551 Ga0105238_10437393 Ga0105238_104373931 343
39 3300025919 Ga0207657_10026903 Ga0207657_100269032 343
40 3300025949 Ga0207667_10118977 Ga0207667_101189772 343
41 3300050512 nmdc:mga0n895_5137_c1 nmdc:mga0n895_5137_c1_5674_6864 343
42 3300050513 nmdc:mga0rr50_123817_c1 nmdc:mga0rr50_123817_c1_105_1295 343
43 3300005471 Ga0070698_100263085 Ga0070698_1002630851 344
44 3300011119 Ga0105246_10133109 Ga0105246_101331092 345
45 3300005459 Ga0068867_100184058 Ga0068867_1001840581 349
46 3300009148 Ga0105243_10261268 Ga0105243_102612681 349
47 3300005328 Ga0070676_10063238 Ga0070676_100632382 350
48 3300005331 Ga0070670_100232207 Ga0070670_1002322071 350
49 3300005354 Ga0070675_100080757 Ga0070675_1000807572 350
50 3300005356 Ga0070674_100242158 Ga0070674_1002421581 350
51 3300005456 Ga0070678_100004053 Ga0070678_1000040536 350
52 3300005536 Ga0070697_100109591 Ga0070697_1001095911 350
53 3300005617 Ga0068859_100160810 Ga0068859_1001608102 350
54 3300006237 Ga0097621_100050268 Ga0097621_1000502682 350
55 3300006358 Ga0068871_100091099 Ga0068871_1000910992 350
56 3300006931 Ga0097620_100160810 Ga0097620_1001608102 350
57 3300009093 Ga0105240_10140243 Ga0105240_101402432 350
58 3300009094 Ga0111539_10001119 Ga0111539_100011193 350
59 3300009177 Ga0105248_10089368 Ga0105248_100893682 350
60 3300009177 Ga0105248_10104758 Ga0105248_101047582 350
61 3300009177 Ga0105248_10193587 Ga0105248_101935872 350
62 3300009551 Ga0105238_10247912 Ga0105238_102479122 350
63 3300009553 Ga0105249_10168267 Ga0105249_101682672 350
64 3300013296 Ga0157374_10205842 Ga0157374_102058422 350
65 3300014326 Ga0157380_10323297 Ga0157380_103232972 350
66 3300025893 Ga0207682_10027555 Ga0207682_100275552 350
67 3300025913 Ga0207695_10096856 Ga0207695_100968562 350
68 3300025941 Ga0207711_10049132 Ga0207711_100491321 350
69 3300025981 Ga0207640_10013629 Ga0207640_100136292 350
70 3300026095 Ga0207676_10239432 Ga0207676_102394322 350
71 3300026121 Ga0207683_10007672 Ga0207683_100076722 350
72 3300027876 Ga0209974_10022136 Ga0209974_100221362 350
73 3300027907 Ga0207428_10010807 Ga0207428_100108075 350
74 3300028379 Ga0268266_10228222 Ga0268266_102282222 350
75 3300046535 Ga0495586_0111645 Ga0495586_0111645_349_1419 350
76 3300046642 Ga0495634_0024322 Ga0495634_0024322_2919_4046 350
77 3300048903 Ga0496100_0218762 Ga0496100_0218762_263_1369 350
78 3300050511 nmdc:mga08y16_51177_c1 nmdc:mga08y16_51177_c1_279_1529 350
79 3300002459 JGI24751J29686_10001090 JGI24751J29686_100010904 351
80 3300005328 Ga0070676_10000986 Ga0070676_100009866 351
81 3300005328 Ga0070676_10036882 Ga0070676_100368822 351
82 3300005329 Ga0070683_100213396 Ga0070683_1002133962 351
83 3300005330 Ga0070690_100009755 Ga0070690_1000097554 351
84 3300005331 Ga0070670_100023056 Ga0070670_1000230564 351
85 3300005335 Ga0070666_10001460 Ga0070666_1000146011 351
86 3300005339 Ga0070660_100077427 Ga0070660_1000774272 351
87 3300005340 Ga0070689_100132178 Ga0070689_1001321781 351
88 3300005341 Ga0070691_10006564 Ga0070691_100065642 351
89 3300005347 Ga0070668_100090435 Ga0070668_1000904351 351
90 3300005353 Ga0070669_100158990 Ga0070669_1001589902 351
91 3300005355 Ga0070671_100059703 Ga0070671_1000597032 351
92 3300005364 Ga0070673_100056848 Ga0070673_1000568481 351
93 3300005366 Ga0070659_100091827 Ga0070659_1000918272 351
94 3300005367 Ga0070667_100004804 Ga0070667_1000048042 351
95 3300005435 Ga0070714_100114637 Ga0070714_1001146372 351
96 3300005438 Ga0070701_10011576 Ga0070701_100115762 351
97 3300005444 Ga0070694_100007108 Ga0070694_1000071082 351
98 3300005445 Ga0070708_100172316 Ga0070708_1001723162 351
99 3300005456 Ga0070678_100029612 Ga0070678_1000296122 351
100 3300005458 Ga0070681_10037177 Ga0070681_100371774 351
101 3300005458 Ga0070681_10138362 Ga0070681_101383621 351
102 3300005458 Ga0070681_10172624 Ga0070681_101726242 351
103 3300005466 Ga0070685_10105276 Ga0070685_101052761 351
104 3300005468 Ga0070707_100093642 Ga0070707_1000936422 351
105 3300005518 Ga0070699_100005716 Ga0070699_1000057165 351
106 3300005518 Ga0070699_100091351 Ga0070699_1000913512 351
107 3300005518 Ga0070699_100114466 Ga0070699_1001144662 351
108 3300005518 Ga0070699_100190611 Ga0070699_1001906111 351
109 3300005530 Ga0070679_100050906 Ga0070679_1000509062 351
110 3300005530 Ga0070679_100098223 Ga0070679_1000982232 351
111 3300005536 Ga0070697_100083120 Ga0070697_1000831201 351
112 3300005536 Ga0070697_100085939 Ga0070697_1000859392 351
113 3300005544 Ga0070686_100001443 Ga0070686_10000144310 351
114 3300005544 Ga0070686_100045827 Ga0070686_1000458272 351
115 3300005545 Ga0070695_100201463 Ga0070695_1002014632 351
116 3300005546 Ga0070696_100055390 Ga0070696_1000553902 351
117 3300005548 Ga0070665_100191757 Ga0070665_1001917571 351
118 3300005549 Ga0070704_100047398 Ga0070704_1000473982 351
119 3300005564 Ga0070664_100192373 Ga0070664_1001923732 351
120 3300005577 Ga0068857_100130781 Ga0068857_1001307812 351
121 3300005578 Ga0068854_100053335 Ga0068854_1000533352 351
122 3300005614 Ga0068856_100034335 Ga0068856_1000343352 351
123 3300005617 Ga0068859_100239118 Ga0068859_1002391182 351
124 3300005618 Ga0068864_100003141 Ga0068864_1000031415 351
125 3300005718 Ga0068866_10025675 Ga0068866_100256752 351
126 3300005841 Ga0068863_100046453 Ga0068863_1000464532 351
127 3300005841 Ga0068863_100142959 Ga0068863_1001429592 351
128 3300005843 Ga0068860_100059670 Ga0068860_1000596702 351
129 3300005843 Ga0068860_100066799 Ga0068860_1000667992 351
130 3300005843 Ga0068860_100118549 Ga0068860_1001185492 351
131 3300005937 Ga0081455_10008733 Ga0081455_100087332 351
132 3300005985 Ga0081539_10054142 Ga0081539_100541422 351
133 3300006237 Ga0097621_100013447 Ga0097621_1000134472 351
134 3300006237 Ga0097621_100052332 Ga0097621_1000523322 351
135 3300006237 Ga0097621_100164097 Ga0097621_1001640971 351
136 3300006871 Ga0075434_100042105 Ga0075434_1000421052 351
137 3300006871 Ga0075434_100066146 Ga0075434_1000661462 351
138 3300006880 Ga0075429_100036513 Ga0075429_1000365132 351
139 3300006880 Ga0075429_100332537 Ga0075429_1003325371 351
140 3300006914 Ga0075436_100014955 Ga0075436_1000149552 351
141 3300006914 Ga0075436_100035607 Ga0075436_1000356072 351
142 3300006914 Ga0075436_100062393 Ga0075436_1000623932 351
143 3300006914 Ga0075436_100154968 Ga0075436_1001549681 351
144 3300006931 Ga0097620_100239116 Ga0097620_1002391162 351
145 3300007076 Ga0075435_100012125 Ga0075435_1000121252 351
146 3300007076 Ga0075435_100054130 Ga0075435_1000541301 351
147 3300007076 Ga0075435_100168518 Ga0075435_1001685182 351
148 3300009093 Ga0105240_10038904 Ga0105240_100389042 351
149 3300009093 Ga0105240_10126082 Ga0105240_101260822 351
150 3300009093 Ga0105240_10199549 Ga0105240_101995492 351
151 3300009094 Ga0111539_10022288 Ga0111539_100222884 351
152 3300009094 Ga0111539_10102355 Ga0111539_101023552 351
153 3300009101 Ga0105247_10058080 Ga0105247_100580802 351
154 3300009147 Ga0114129_10000997 Ga0114129_1000099722 351
155 3300009147 Ga0114129_10002196 Ga0114129_1000219615 351
156 3300009147 Ga0114129_10020638 Ga0114129_100206382 351
157 3300009147 Ga0114129_10028205 Ga0114129_100282054 351
158 3300009147 Ga0114129_10100890 Ga0114129_101008902 351
159 3300009147 Ga0114129_10147813 Ga0114129_101478132 351
160 3300009147 Ga0114129_10152236 Ga0114129_101522362 351
161 3300009147 Ga0114129_10163650 Ga0114129_101636502 351
162 3300009147 Ga0114129_10200542 Ga0114129_102005422 351
163 3300009176 Ga0105242_10049668 Ga0105242_100496682 351
164 3300009176 Ga0105242_10176892 Ga0105242_101768922 351
165 3300009177 Ga0105248_10063544 Ga0105248_100635442 351
166 3300009553 Ga0105249_10223449 Ga0105249_102234491 351
167 3300011119 Ga0105246_10204805 Ga0105246_102048052 351
168 3300013306 Ga0163162_10088655 Ga0163162_100886552 351
169 3300013306 Ga0163162_10320460 Ga0163162_103204601 351
170 3300013308 Ga0157375_10126428 Ga0157375_101264282 351
171 3300013308 Ga0157375_10157679 Ga0157375_101576792 351
172 3300013308 Ga0157375_10370992 Ga0157375_103709922 351
173 3300014325 Ga0163163_10008939 Ga0163163_100089392 351
174 3300014325 Ga0163163_10144001 Ga0163163_101440012 351
175 3300014745 Ga0157377_10040317 Ga0157377_100403172 351
176 3300014968 Ga0157379_10049036 Ga0157379_100490362 351
177 3300014968 Ga0157379_10169706 Ga0157379_101697062 351
178 3300014969 Ga0157376_10075114 Ga0157376_100751142 351
179 3300014969 Ga0157376_10078409 Ga0157376_100784092 351
180 3300025899 Ga0207642_10067500 Ga0207642_100675001 351
181 3300025903 Ga0207680_10001435 Ga0207680_1000143510 351
182 3300025907 Ga0207645_10066980 Ga0207645_100669802 351
183 3300025912 Ga0207707_10018304 Ga0207707_100183043 351
184 3300025912 Ga0207707_10019710 Ga0207707_100197104 351
185 3300025913 Ga0207695_10081851 Ga0207695_100818512 351
186 3300025918 Ga0207662_10087439 Ga0207662_100874393 351
187 3300025919 Ga0207657_10089866 Ga0207657_100898662 351
188 3300025921 Ga0207652_10024227 Ga0207652_100242272 351
189 3300025922 Ga0207646_10071767 Ga0207646_100717672 351
190 3300025923 Ga0207681_10088786 Ga0207681_100887862 351
191 3300025925 Ga0207650_10173262 Ga0207650_101732621 351
192 3300025926 Ga0207659_10000072 Ga0207659_1000007249 351
193 3300025927 Ga0207687_10037910 Ga0207687_100379102 351
194 3300025933 Ga0207706_10165776 Ga0207706_101657762 351
195 3300025934 Ga0207686_10021800 Ga0207686_100218002 351
196 3300025938 Ga0207704_10006608 Ga0207704_100066084 351
197 3300025940 Ga0207691_10070884 Ga0207691_100708842 351
198 3300025941 Ga0207711_10045170 Ga0207711_100451702 351
199 3300025941 Ga0207711_10081839 Ga0207711_100818392 351
200 3300025942 Ga0207689_10084733 Ga0207689_100847331 351
201 3300025942 Ga0207689_10210350 Ga0207689_102103502 351
202 3300025960 Ga0207651_10021719 Ga0207651_100217191 351
203 3300025981 Ga0207640_10042120 Ga0207640_100421202 351
204 3300025986 Ga0207658_10126475 Ga0207658_101264752 351
205 3300026023 Ga0207677_10126676 Ga0207677_101266762 351
206 3300026035 Ga0207703_10037916 Ga0207703_100379162 351
207 3300026035 Ga0207703_10305979 Ga0207703_103059792 351
208 3300026041 Ga0207639_10055270 Ga0207639_100552702 351
209 3300026078 Ga0207702_10089686 Ga0207702_100896862 351
210 3300026088 Ga0207641_10023804 Ga0207641_100238042 351
211 3300026089 Ga0207648_10005751 Ga0207648_100057515 351
212 3300026095 Ga0207676_10003454 Ga0207676_100034545 351
213 3300026121 Ga0207683_10069605 Ga0207683_100696052 351
214 3300028379 Ga0268266_10014019 Ga0268266_100140194 351
215 3300028381 Ga0268264_10052338 Ga0268264_100523382 351
216 3300028381 Ga0268264_10053894 Ga0268264_100538943 351
217 3300032002 Ga0307416_100167118 Ga0307416_1001671182 351
218 3300034816 Ga0373930_0000409 Ga0373930_0000409_1844_2989 351
219 3300034817 Ga0373948_0000409 Ga0373948_0000409_2675_3820 351
220 3300034819 Ga0373958_0009176 Ga0373958_0009176_155_1300 351
221 3300034820 Ga0373959_0002290 Ga0373959_0002290_380_1525 351
222 3300034957 Ga0373938_0001602 Ga0373938_0001602_2401_3546 351
223 3300035084 Ga0373928_0000693 Ga0373928_0000693_4120_5265 351
224 3300035085 Ga0373929_0000500 Ga0373929_0000500_3300_4403 351
225 3300035086 Ga0373934_0055013 Ga0373934_0055013_51_1112 351
226 3300035088 Ga0373940_0000710 Ga0373940_0000710_2166_3269 351
227 3300035090 Ga0373949_0001026 Ga0373949_0001026_5137_6282 351
228 3300035091 Ga0373951_0000835 Ga0373951_0000835_1432_2577 351
229 3300035092 Ga0373952_0000580 Ga0373952_0000580_2731_3876 351
230 3300035114 Ga0373939_0000222 Ga0373939_0000222_2738_3883 351
231 3300035115 Ga0373941_0002079 Ga0373941_0002079_307_1452 351
232 3300035117 Ga0373953_0078737 Ga0373953_0078737_170_1231 351
233 3300035121 Ga0373960_0000140 Ga0373960_0000140_3300_4445 351
234 3300035172 Ga0373955_0109349 Ga0373955_0109349_486_1586 351
235 3300035172 Ga0373955_0189377 Ga0373955_0189377_83_1144 351
236 3300035207 Ga0373942_0001703 Ga0373942_0001703_4007_5152 351
237 3300035241 Ga0373961_0000977 Ga0373961_0000977_5454_6599 351
238 3300035242 Ga0373962_0039807 Ga0373962_0039807_171_1298 351
239 3300035691 Ga0373931_0000392 Ga0373931_0000392_9695_10840 351
240 3300036401 Ga0373937_0041778 Ga0373937_0041778_2334_3434 351
241 3300036401 Ga0373937_0213228 Ga0373937_0213228_143_1204 351
242 3300041999 Ga0439433_0003945 Ga0439433_0003945_1166_2299 351
243 3300042008 Ga0439450_023005 Ga0439450_023005_192_1253 351
244 3300045051 Ga0451576_0004093 Ga0451576_0004093_5095_6240 351
245 3300045051 Ga0451576_0083419 Ga0451576_0083419_1008_2174 351
246 3300046533 Ga0495640_0218805 Ga0495640_0218805_62_1123 351
247 3300046536 Ga0495587_0110792 Ga0495587_0110792_370_1431 351
248 3300046543 Ga0495645_0007405 Ga0495645_0007405_3229_4329 351
249 3300046681 Ga0495647_0039026 Ga0495647_0039026_120_1325 351
250 3300046689 Ga0495613_0249251 Ga0495613_0249251_23_1084 351
251 3300047317 Ga0495604_0083607 Ga0495604_0083607_923_1984 351
252 3300047317 Ga0495604_0186279 Ga0495604_0186279_234_1334 351
253 3300047471 Ga0495684_0043687 Ga0495684_0043687_1521_2621 351
254 3300048903 Ga0496100_0069520 Ga0496100_0069520_689_1831 351
255 3300048904 Ga0496101_0001911 Ga0496101_0001911_9786_10928 351
256 3300048905 Ga0496102_0056429 Ga0496102_0056429_1288_2472 351
257 3300048905 Ga0496102_0190371 Ga0496102_0190371_97_1356 351
258 3300048906 Ga0496103_0111536 Ga0496103_0111536_115_1299 351
259 3300048907 Ga0496104_0020531 Ga0496104_0020531_1609_2751 351
260 3300048907 Ga0496104_0131196 Ga0496104_0131196_530_1591 351
261 3300048910 Ga0496107_0025813 Ga0496107_0025813_16_1158 351
262 3300048912 Ga0496109_0106740 Ga0496109_0106740_399_1658 351
263 3300048915 Ga0496112_0035661 Ga0496112_0035661_1094_2155 351
264 3300048917 Ga0496114_0000613 Ga0496114_0000613_17567_18709 351
265 3300048917 Ga0496114_0408516 Ga0496114_0408516_106_1164 351
266 3300049571 Ga0501034_0005914 Ga0501034_0005914_4574_5722 351
267 3300049578 Ga0501042_0314742 Ga0501042_0314742_42_1103 351
268 3300049579 Ga0501043_0171204 Ga0501043_0171204_365_1513 351
269 3300049581 Ga0501047_0001540 Ga0501047_0001540_18288_19436 351
270 3300049581 Ga0501047_0220320 Ga0501047_0220320_432_1655 351
271 3300049592 Ga0501076_0184828 Ga0501076_0184828_354_1415 351
272 3300049744 Ga0501083_0152065 Ga0501083_0152065_346_1446 351
273 3300049823 Ga0501044_0036519 Ga0501044_0036519_2161_3309 351
274 3300050507 nmdc:mga05p37_1000_c1 nmdc:mga05p37_1000_c1_4980_6164 351
275 3300050507 nmdc:mga05p37_120531_c1 nmdc:mga05p37_120531_c1_1471_2658 351
276 3300050507 nmdc:mga05p37_184035_c1 nmdc:mga05p37_184035_c1_920_2125 351
277 3300050507 nmdc:mga05p37_24195_c1 nmdc:mga05p37_24195_c1_5739_6965 351
278 3300050507 nmdc:mga05p37_25634_c1 nmdc:mga05p37_25634_c1_1536_2594 351
279 3300050507 nmdc:mga05p37_428360_c1 nmdc:mga05p37_428360_c1_130_1338 351
280 3300050507 nmdc:mga05p37_8828_c1 nmdc:mga05p37_8828_c1_200_1261 351
281 3300050507 nmdc:mga05p37_91344_c1 nmdc:mga05p37_91344_c1_137_1198 351
282 3300050508 nmdc:mga09592_23788_c1 nmdc:mga09592_23788_c1_958_2019 351
283 3300050511 nmdc:mga08y16_168841_c1 nmdc:mga08y16_168841_c1_596_1657 351
284 3300050511 nmdc:mga08y16_191800_c1 nmdc:mga08y16_191800_c1_981_2042 351
285 3300050511 nmdc:mga08y16_56865_c1 nmdc:mga08y16_56865_c1_265_1503 351
286 3300050512 nmdc:mga0n895_182320_c1 nmdc:mga0n895_182320_c1_1048_2109 351
287 3300050512 nmdc:mga0n895_8220_c1 nmdc:mga0n895_8220_c1_2558_3745 351
288 3300050513 nmdc:mga0rr50_1622_c1 nmdc:mga0rr50_1622_c1_5492_6637 351
289 3300050513 nmdc:mga0rr50_202680_c1 nmdc:mga0rr50_202680_c1_94_1278 351
290 3300050513 nmdc:mga0rr50_8433_c1 nmdc:mga0rr50_8433_c1_2358_3563 351
291 3300050514 nmdc:mga08x19_10189_c1 nmdc:mga08x19_10189_c1_2589_3785 351
292 3300050514 nmdc:mga08x19_43795_c1 nmdc:mga08x19_43795_c1_1050_2234 351
293 3300050514 nmdc:mga08x19_48082_c1 nmdc:mga08x19_48082_c1_1517_2710 351
294 3300050514 nmdc:mga08x19_58632_c1 nmdc:mga08x19_58632_c1_293_1495 351
295 3300050515 nmdc:mga0a205_38695_c1 nmdc:mga0a205_38695_c1_1211_2419 351
296 3300050515 nmdc:mga0a205_56101_c1 nmdc:mga0a205_56101_c1_2179_3240 351
297 3300053077 Ga0495601_0014122 Ga0495601_0014122_795_1895 351
298 3300053085 Ga0495619_0043004 Ga0495619_0043004_583_1644 351
299 3300053085 Ga0495619_0070760 Ga0495619_0070760_1107_2207 351
300 3300053085 Ga0495619_0197533 Ga0495619_0197533_179_1321 351
301 3300059424 Ga0590075_023028 Ga0590075_023028_71_1231 351
302 3300060353 Ga0501082_0090549 Ga0501082_0090549_204_1340 351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00512

HisKA

His Kinase A (phospho-acceptor) domain

119

183

0.96

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

227

347

0.88

Feature Viewer

pLDDT pTM Quality
76.47 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map