F396322

General Info

Members Datasets Scaffolds Average Seq Length
302 204 302 154

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_101368395|Ga0070668_1013683951
Length 167
Sequence MWGGEAVSRGELKVASMSNTEPPAESATQKVRMAEDAWNTREPQRVAMAYTRDSVWRNRAEFLAGREAIEQFLIRKWSKELDYRLIKELWAFHDNRIAVRFAYEWHDDSGTWFRSYGNENWEFDPLGYMRRRIASINDLPIAERARKYRWPLGRRPDDHPGLSDLGL

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
143 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
144 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
145 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
146 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 7.28
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10248901 3300005293 Bacteria 1147
2 Ga0065707_10124122 3300005295 Bacteria 2045
3 Ga0070676_10019404 3300005328 Bacteria 3782
4 Ga0070676_10419540 3300005328 Bacteria 935
5 Ga0070683_100017284 3300005329 Bacteria 6374
6 Ga0070690_100012594 3300005330 Bacteria 4978
7 Ga0070690_100312607 3300005330 Bacteria 1130
8 Ga0070670_101485088 3300005331 Bacteria 622
9 Ga0070677_10148953 3300005333 Bacteria 1087
10 Ga0070677_10153398 3300005333 Bacteria 1074
11 Ga0068868_100035090 3300005338 Bacteria 3875
12 Ga0068868_100177435 3300005338 Bacteria 1766
13 Ga0068868_101104180 3300005338 Bacteria 730
14 Ga0070660_100098778 3300005339 Bacteria 2311
15 Ga0070660_100101881 3300005339 Bacteria 2275
16 Ga0070689_100001973 3300005340 Bacteria 13307
17 Ga0070687_100241888 3300005343 Bacteria 1116
18 Ga0070661_100171706 3300005344 Bacteria 1647
19 Ga0070668_101209663 3300005347 Bacteria 685
20 Ga0070668_101368395 3300005347 Bacteria 645
21 Ga0070671_100497861 3300005355 Bacteria 1048
22 Ga0070674_100723654 3300005356 Bacteria 853
23 Ga0070673_100962481 3300005364 Bacteria 794
24 Ga0070659_100183036 3300005366 Bacteria 1720
25 Ga0070667_100043617 3300005367 Bacteria 3764
26 Ga0070700_100070752 3300005441 Bacteria 2225
27 Ga0070708_100272596 3300005445 Bacteria 1592
28 Ga0070708_100608583 3300005445 Bacteria 1030
29 Ga0070663_100475277 3300005455 Bacteria 1034
30 Ga0070663_101269802 3300005455 Bacteria 649
31 Ga0070662_100003095 3300005457 Bacteria 10330
32 Ga0070662_100344245 3300005457 Bacteria 1220
33 Ga0068867_100003457 3300005459 Bacteria 11109
34 Ga0068867_100031637 3300005459 Bacteria 3822
35 Ga0068867_100121635 3300005459 Bacteria 2018
36 Ga0070685_10059573 3300005466 Bacteria 2230
37 Ga0070698_100363228 3300005471 Bacteria 1380
38 Ga0068853_100334936 3300005539 Bacteria 1405
39 Ga0070672_100238324 3300005543 Bacteria 1529
40 Ga0070672_100694634 3300005543 Bacteria 891
41 Ga0070686_100643124 3300005544 Bacteria 840
42 Ga0070693_100137052 3300005547 Bacteria 1536
43 Ga0070693_100204696 3300005547 Bacteria 1284
44 Ga0070664_100042572 3300005564 Bacteria 3833
45 Ga0070664_100249946 3300005564 Bacteria 1594
46 Ga0070664_101817720 3300005564 Bacteria 578
47 Ga0068857_101513225 3300005577 Bacteria 654
48 Ga0068854_100074986 3300005578 Bacteria 2483
49 Ga0068854_100209768 3300005578 Bacteria 1536
50 Ga0068852_100047005 3300005616 Bacteria 3680
51 Ga0068859_100376696 3300005617 Bacteria 1515
52 Ga0068859_100680482 3300005617 Bacteria 1120
53 Ga0068859_100860980 3300005617 Bacteria 992
54 Ga0068864_100000416 3300005618 Bacteria 36855
55 Ga0068861_100259554 3300005719 Bacteria 1487
56 Ga0068861_101000282 3300005719 Bacteria 798
57 Ga0068861_101447502 3300005719 Bacteria 672
58 Ga0068851_10240381 3300005834 Bacteria 1024
59 Ga0068870_10079961 3300005840 Bacteria 1805
60 Ga0068870_10264028 3300005840 Bacteria 1073
61 Ga0068863_100015520 3300005841 Bacteria 7318
62 Ga0068858_100188726 3300005842 Bacteria 1947
63 Ga0068858_101764903 3300005842 Bacteria 611
64 Ga0068860_100220190 3300005843 Bacteria 1843
65 Ga0068862_100006119 3300005844 Bacteria 10015
66 Ga0068862_101320692 3300005844 Bacteria 723
67 Ga0081540_1000537 3300005983 Bacteria 36699
68 Ga0075365_10140939 3300006038 Bacteria 1673
69 Ga0070715_10097659 3300006163 Bacteria 1364
70 Ga0097621_100562255 3300006237 Bacteria 1039
71 Ga0097621_101254597 3300006237 Bacteria 699
72 Ga0075370_10384471 3300006353 Bacteria 841
73 Ga0068871_100105173 3300006358 Bacteria 2368
74 Ga0068871_100198731 3300006358 Bacteria 1730
75 Ga0075428_100013669 3300006844 Bacteria 9038
76 Ga0075428_100839048 3300006844 Bacteria 976
77 Ga0075431_100170808 3300006847 Bacteria 2234
78 Ga0075431_100245723 3300006847 Bacteria 1819
79 Ga0075429_100215369 3300006880 Bacteria 1682
80 Ga0068865_100262394 3300006881 Bacteria 1368
81 Ga0075436_100434958 3300006914 Bacteria 954
82 Ga0097620_100376693 3300006931 Bacteria 1515
83 Ga0097620_100680498 3300006931 Bacteria 1120
84 Ga0097620_100860949 3300006931 Bacteria 992
85 Ga0111539_10146460 3300009094 Bacteria 2765
86 Ga0111539_10232184 3300009094 Bacteria 2148
87 Ga0111539_10763722 3300009094 Bacteria 1125
88 Ga0111539_10963838 3300009094 Bacteria 992
89 Ga0105245_10729976 3300009098 Bacteria 1025
90 Ga0105243_10555982 3300009148 Bacteria 1097
91 Ga0105241_10672970 3300009174 Bacteria 942
92 Ga0105242_10172944 3300009176 Bacteria 1899
93 Ga0105242_10270392 3300009176 Bacteria 1539
94 Ga0105242_11362354 3300009176 Bacteria 735
95 Ga0105248_10066741 3300009177 Bacteria 4039
96 Ga0105248_11112521 3300009177 Bacteria 893
97 Ga0105237_10024786 3300009545 Bacteria 6137
98 Ga0105238_10997087 3300009551 Bacteria 858
99 Ga0105249_10284691 3300009553 Bacteria 1652
100 Ga0105239_10489610 3300010375 Bacteria 1398
101 Ga0105246_10122595 3300011119 Bacteria 1929
102 Ga0157371_10023683 3300013102 Bacteria 4489
103 Ga0157370_10065301 3300013104 Bacteria 3443
104 Ga0157369_10277331 3300013105 Bacteria 1746
105 Ga0157374_10000047 3300013296 Bacteria 137075
106 Ga0157374_10573058 3300013296 Bacteria 1138
107 Ga0157374_10827775 3300013296 Bacteria 942
108 Ga0157378_10016554 3300013297 Bacteria 6458
109 Ga0157378_10019007 3300013297 Bacteria 6038
110 Ga0157378_10209960 3300013297 Bacteria 1846
111 Ga0163162_10004763 3300013306 Bacteria 13093
112 Ga0157372_10026832 3300013307 Bacteria 6270
113 Ga0157375_10038062 3300013308 Bacteria 4615
114 Ga0157375_10112340 3300013308 Bacteria 2825
115 Ga0157375_10991353 3300013308 Bacteria 980
116 Ga0163163_10000050 3300014325 Bacteria 128713
117 Ga0163163_10059713 3300014325 Bacteria 3773
118 Ga0157380_10086184 3300014326 Bacteria 2580
119 Ga0157380_10133301 3300014326 Bacteria 2123
120 Ga0157377_10253138 3300014745 Bacteria 1142
121 Ga0157379_10046693 3300014968 Bacteria 3864
122 Ga0157379_11283202 3300014968 Bacteria 707
123 Ga0157376_10001129 3300014969 Bacteria 17508
124 Ga0163161_10009709 3300017792 Bacteria 6664
125 Ga0163161_10494810 3300017792 Bacteria 995
126 Ga0206356_10945099 3300020070 Bacteria 1472
127 Ga0207697_10087609 3300025315 Bacteria 1317
128 Ga0207656_10071010 3300025321 Bacteria 1547
129 Ga0207682_10043802 3300025893 Bacteria 1833
130 Ga0207680_10063440 3300025903 Bacteria 2261
131 Ga0207645_10001571 3300025907 Bacteria 18633
132 Ga0207645_10004816 3300025907 Bacteria 9916
133 Ga0207645_10038090 3300025907 Bacteria 3085
134 Ga0207645_10389498 3300025907 Bacteria 936
135 Ga0207643_10001503 3300025908 Bacteria 13345
136 Ga0207643_10189654 3300025908 Bacteria 1247
137 Ga0207707_10493287 3300025912 Bacteria 1045
138 Ga0207671_10015543 3300025914 Bacteria 5953
139 Ga0207693_10276020 3300025915 Bacteria 1317
140 Ga0207662_10226869 3300025918 Bacteria 1218
141 Ga0207662_11145059 3300025918 Bacteria 553
142 Ga0207657_10097598 3300025919 Bacteria 2443
143 Ga0207657_10104810 3300025919 Bacteria 2342
144 Ga0207649_10166596 3300025920 Bacteria 1531
145 Ga0207650_10149227 3300025925 Bacteria 1844
146 Ga0207659_10001876 3300025926 Bacteria 12443
147 Ga0207644_10006515 3300025931 Bacteria 7613
148 Ga0207644_10042958 3300025931 Bacteria 3206
149 Ga0207644_10257064 3300025931 Bacteria 1395
150 Ga0207706_10001026 3300025933 Bacteria 28419
151 Ga0207706_10790919 3300025933 Bacteria 806
152 Ga0207686_10465261 3300025934 Bacteria 975
153 Ga0207686_11062208 3300025934 Bacteria 659
154 Ga0207670_10001270 3300025936 Bacteria 13339
155 Ga0207704_10009678 3300025938 Bacteria 4663
156 Ga0207691_10002306 3300025940 Bacteria 18705
157 Ga0207691_10872222 3300025940 Bacteria 754
158 Ga0207711_10031865 3300025941 Bacteria 4454
159 Ga0207661_10616600 3300025944 Bacteria 996
160 Ga0207679_10315158 3300025945 Bacteria 1353
161 Ga0207679_10321444 3300025945 Bacteria 1340
162 Ga0207679_11864427 3300025945 Bacteria 549
163 Ga0207667_10753764 3300025949 Bacteria 973
164 Ga0207651_10063808 3300025960 Bacteria 2574
165 Ga0207668_10226387 3300025972 Bacteria 1505
166 Ga0207668_10675584 3300025972 Bacteria 906
167 Ga0207640_10206999 3300025981 Bacteria 1491
168 Ga0207677_10004129 3300026023 Bacteria 7769
169 Ga0207677_10978871 3300026023 Bacteria 766
170 Ga0207703_10024011 3300026035 Bacteria 4797
171 Ga0207703_10690034 3300026035 Bacteria 970
172 Ga0207639_10519146 3300026041 Bacteria 1090
173 Ga0207678_10269252 3300026067 Bacteria 1460
174 Ga0207678_10378487 3300026067 Bacteria 1224
175 Ga0207678_11253933 3300026067 Bacteria 656
176 Ga0207708_10013179 3300026075 Bacteria 6171
177 Ga0207641_10249391 3300026088 Bacteria 1657
178 Ga0207641_10463797 3300026088 Bacteria 1226
179 Ga0207648_10002215 3300026089 Bacteria 21068
180 Ga0207648_10004747 3300026089 Bacteria 13887
181 Ga0207676_10000477 3300026095 Bacteria 33711
182 Ga0207675_100001295 3300026118 Bacteria 25065
183 Ga0207698_10084727 3300026142 Bacteria 2570
184 Ga0207698_10090808 3300026142 Bacteria 2499
185 Ga0207698_12757481 3300026142 Bacteria 500
186 Ga0209967_1002423 3300027364 Bacteria 2415
187 Ga0209996_1021378 3300027395 Bacteria 911
188 Ga0209999_1027666 3300027543 Bacteria 1050
189 Ga0209982_1004202 3300027552 Bacteria 2061
190 Ga0209970_1031468 3300027614 Bacteria 923
191 Ga0210002_1001414 3300027617 Bacteria 3374
192 Ga0209983_1001769 3300027665 Bacteria 4791
193 Ga0209971_1029220 3300027682 Bacteria 1320
194 Ga0209974_10000198 3300027876 Bacteria 19218
195 Ga0268265_11314209 3300028380 Bacteria 723
196 Ga0265327_10004951 3300031251 Bacteria 11448
197 Ga0265327_10044582 3300031251 Bacteria 2363
198 Ga0373944_0101410 3300035089 Bacteria 973
199 Ga0373953_0017513 3300035117 Bacteria 2635
200 Ga0373954_0044194 3300035118 Bacteria 2078
201 Ga0373956_0003761 3300035119 Bacteria 6113
202 Ga0373957_0150031 3300035120 Bacteria 957
203 Ga0373943_0033437 3300035170 Bacteria 2450
204 Ga0373943_0054388 3300035170 Bacteria 1980
205 Ga0373955_0004972 3300035172 Bacteria 5933
206 Ga0373955_0234499 3300035172 Bacteria 1098
207 Ga0373935_0050516 3300035692 Bacteria 2639
208 Ga0373927_0022505 3300035695 Bacteria 4129
209 Ga0373933_0000681 3300035724 Bacteria 20930
210 Ga0373933_0461589 3300035724 Bacteria 831
211 Ga0373933_0833976 3300035724 Bacteria 607
212 Ga0373947_0036466 3300035725 Bacteria 2916
213 Ga0373947_0247871 3300035725 Bacteria 1177
214 Ga0373937_0001140 3300036401 Bacteria 22318
215 Ga0373937_0021634 3300036401 Bacteria 5772
216 Ga0373925_0029136 3300037068 Bacteria 4049
217 Ga0373925_0180459 3300037068 Bacteria 1671
218 Ga0451800_1471335 3300041459 Bacteria 819
219 Ga0451800_1686787 3300041459 Bacteria 576
220 Ga0451851_1051196 3300041507 Bacteria 641
221 Ga0450920_025407 3300042122 Bacteria 1154
222 Ga0450923_016997 3300042125 Bacteria 1377
223 Ga0450898_035914 3300042134 Bacteria 924
224 Ga0439435_0116551 3300042436 Bacteria 833
225 Ga0451577_0157597 3300042876 Bacteria 2044
226 Ga0453683_0282765 3300044673 Bacteria 1060
227 Ga0466957_0103713 3300044842 Bacteria 1796
228 Ga0451576_0039574 3300045051 Bacteria 4990
229 Ga0451576_0809823 3300045051 Bacteria 983
230 Ga0451576_1462928 3300045051 Bacteria 710
231 Ga0451576_2750096 3300045051 Bacteria 500
232 Ga0466967_0060636 3300045976 Bacteria 3353
233 Ga0495592_0595700 3300046454 Bacteria 675
234 Ga0495629_0121147 3300046459 Bacteria 1822
235 Ga0495651_0000233 3300046462 Bacteria 42757
236 Ga0495653_0058070 3300046463 Bacteria 2942
237 Ga0495580_0284614 3300046472 Bacteria 1127
238 Ga0495582_0014163 3300046473 Bacteria 4388
239 Ga0495639_0004728 3300046475 Bacteria 5855
240 Ga0495639_0139272 3300046475 Bacteria 1166
241 Ga0495608_0351980 3300046511 Bacteria 906
242 Ga0495666_0082407 3300046526 Bacteria 1521
243 Ga0495666_0156918 3300046526 Bacteria 1056
244 Ga0495665_0083227 3300046531 Bacteria 1682
245 Ga0495598_0102171 3300046537 Bacteria 950
246 Ga0495667_0360168 3300046559 Bacteria 918
247 Ga0495668_0068317 3300046616 Bacteria 1955
248 Ga0495635_0028927 3300046663 Bacteria 3852
249 Ga0495635_0434733 3300046663 Bacteria 869
250 Ga0495657_0018536 3300046675 Bacteria 5032
251 Ga0495657_0708793 3300046675 Bacteria 578
252 Ga0495647_0014033 3300046681 Bacteria 2786
253 Ga0495647_0105691 3300046681 Bacteria 1170
254 Ga0495658_0005367 3300046683 Bacteria 6305
255 Ga0495658_0655358 3300046683 Bacteria 672
256 Ga0495613_0039367 3300046689 Bacteria 3505
257 Ga0495600_0007944 3300046809 Bacteria 6503
258 Ga0495600_0482420 3300046809 Bacteria 764
259 Ga0495581_0019333 3300047315 Bacteria 3953
260 Ga0495581_0339041 3300047315 Bacteria 878
261 Ga0495680_0225283 3300047322 Bacteria 1337
262 Ga0495684_0063014 3300047471 Bacteria 2819
263 Ga0496100_0217104 3300048903 Bacteria 1402
264 Ga0496102_1068836 3300048905 Bacteria 727
265 Ga0496103_0408593 3300048906 Bacteria 872
266 Ga0496104_0083359 3300048907 Bacteria 3049
267 Ga0496104_0242617 3300048907 Bacteria 1714
268 Ga0496105_0010875 3300048908 Bacteria 7165
269 Ga0496105_0168051 3300048908 Bacteria 1799
270 Ga0496105_1061608 3300048908 Bacteria 603
271 Ga0496107_0058045 3300048910 Bacteria 2798
272 Ga0496107_0394051 3300048910 Bacteria 1030
273 Ga0496108_0022736 3300048911 Bacteria 5157
274 Ga0496109_0120079 3300048912 Bacteria 2448
275 Ga0496110_0209096 3300048913 Bacteria 1774
276 Ga0496110_0706312 3300048913 Bacteria 910
277 Ga0496111_0597339 3300048914 Bacteria 808
278 Ga0496112_0089744 3300048915 Bacteria 3042
279 Ga0496114_0089418 3300048917 Bacteria 2613
280 Ga0496114_0154412 3300048917 Bacteria 1992
281 Ga0496114_0540874 3300048917 Bacteria 1030
282 Ga0496115_0029766 3300048918 Bacteria 4291
283 Ga0501034_0385268 3300049571 Bacteria 1326
284 Ga0501037_0016223 3300049573 Bacteria 5482
285 Ga0501043_0069605 3300049579 Bacteria 2764
286 Ga0501035_0376428 3300049822 Bacteria 1185
287 Ga0501044_0716746 3300049823 Bacteria 885
288 nmdc:mga0yw44_127075_c1 3300050492 Bacteria 1647
289 nmdc:mga0k408_151596_c1 3300050493 Bacteria 1380
290 nmdc:mga09592_249999_c1 3300050508 Bacteria 1537
291 nmdc:mga09592_49017_c1 3300050508 Bacteria 3561
292 nmdc:mga06r32_166152_c1 3300050510 Bacteria 2190
293 nmdc:mga06r32_50923_c1 3300050510 Bacteria 3962
294 nmdc:mga08y16_329127_c1 3300050511 Bacteria 1572
295 nmdc:mga08y16_68959_c1 3300050511 Bacteria 3687
296 nmdc:mga08x19_467722_c1 3300050514 Bacteria 888
297 Ga0495601_0482588 3300053077 Bacteria 801
298 Ga0495612_0317651 3300053078 Bacteria 700
299 Ga0495595_0050383 3300053084 Bacteria 1928
300 Ga0495619_0114469 3300053085 Bacteria 1845
301 Ga0500568_0075074 3300053139 Bacteria 1289
302 Ga0500616_0001180 3300053153 Bacteria 26586

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10124122 Ga0065707_101241222 135
2 3300005328 Ga0070676_10419540 Ga0070676_104195401 135
3 3300005330 Ga0070690_100312607 Ga0070690_1003126072 135
4 3300005338 Ga0068868_101104180 Ga0068868_1011041801 135
5 3300005340 Ga0070689_100001973 Ga0070689_1000019737 135
6 3300005544 Ga0070686_100643124 Ga0070686_1006431241 135
7 3300005547 Ga0070693_100204696 Ga0070693_1002046963 135
8 3300005564 Ga0070664_101817720 Ga0070664_1018177202 135
9 3300005616 Ga0068852_100047005 Ga0068852_1000470053 135
10 3300005617 Ga0068859_100376696 Ga0068859_1003766962 135
11 3300005618 Ga0068864_100000416 Ga0068864_10000041630 135
12 3300005841 Ga0068863_100015520 Ga0068863_1000155205 135
13 3300005843 Ga0068860_100220190 Ga0068860_1002201903 135
14 3300006847 Ga0075431_100245723 Ga0075431_1002457232 135
15 3300006880 Ga0075429_100215369 Ga0075429_1002153691 135
16 3300006881 Ga0068865_100262394 Ga0068865_1002623944 135
17 3300006931 Ga0097620_100376693 Ga0097620_1003766932 135
18 3300009094 Ga0111539_10232184 Ga0111539_102321843 135
19 3300010375 Ga0105239_10489610 Ga0105239_104896102 135
20 3300017792 Ga0163161_10009709 Ga0163161_100097094 135
21 3300025315 Ga0207697_10087609 Ga0207697_100876093 135
22 3300025907 Ga0207645_10038090 Ga0207645_100380904 135
23 3300025908 Ga0207643_10189654 Ga0207643_101896542 135
24 3300025926 Ga0207659_10001876 Ga0207659_100018761 135
25 3300025931 Ga0207644_10006515 Ga0207644_100065156 135
26 3300025936 Ga0207670_10001270 Ga0207670_1000127014 135
27 3300025941 Ga0207711_10031865 Ga0207711_100318655 135
28 3300025945 Ga0207679_10315158 Ga0207679_103151582 135
29 3300025960 Ga0207651_10063808 Ga0207651_100638083 135
30 3300026023 Ga0207677_10004129 Ga0207677_100041294 135
31 3300026023 Ga0207677_10978871 Ga0207677_109788711 135
32 3300026088 Ga0207641_10463797 Ga0207641_104637972 135
33 3300026095 Ga0207676_10000477 Ga0207676_1000047717 135
34 3300026142 Ga0207698_12757481 Ga0207698_127574811 135
35 3300035117 Ga0373953_0017513 Ga0373953_0017513_2093_2500 135
36 3300035119 Ga0373956_0003761 Ga0373956_0003761_475_882 135
37 3300035172 Ga0373955_0004972 Ga0373955_0004972_2410_2817 135
38 3300035724 Ga0373933_0000681 Ga0373933_0000681_13697_14104 135
39 3300036401 Ga0373937_0001140 Ga0373937_0001140_8826_9233 135
40 3300041459 Ga0451800_1471335 Ga0451800_1471335_356_763 135
41 3300041507 Ga0451851_1051196 Ga0451851_1051196_210_617 135
42 3300042122 Ga0450920_025407 Ga0450920_025407_452_859 135
43 3300045051 Ga0451576_0039574 Ga0451576_0039574_883_1290 135
44 3300045051 Ga0451576_2750096 Ga0451576_2750096_53_460 135
45 3300046454 Ga0495592_0595700 Ga0495592_0595700_198_605 135
46 3300046462 Ga0495651_0000233 Ga0495651_0000233_14373_14780 135
47 3300046511 Ga0495608_0351980 Ga0495608_0351980_295_702 135
48 3300046616 Ga0495668_0068317 Ga0495668_0068317_54_464 135
49 3300046675 Ga0495657_0018536 Ga0495657_0018536_1227_1634 135
50 3300046675 Ga0495657_0708793 Ga0495657_0708793_153_560 135
51 3300046683 Ga0495658_0655358 Ga0495658_0655358_35_442 135
52 3300047315 Ga0495581_0339041 Ga0495581_0339041_44_451 135
53 3300048905 Ga0496102_1068836 Ga0496102_1068836_257_664 135
54 3300048908 Ga0496105_1061608 Ga0496105_1061608_166_573 135
55 3300050508 nmdc:mga09592_49017_c1 nmdc:mga09592_49017_c1_1518_1925 135
56 3300050510 nmdc:mga06r32_50923_c1 nmdc:mga06r32_50923_c1_1850_2257 135
57 3300050514 nmdc:mga08x19_467722_c1 nmdc:mga08x19_467722_c1_51_458 135
58 3300053077 Ga0495601_0482588 Ga0495601_0482588_68_475 135
59 3300005842 Ga0068858_100188726 Ga0068858_1001887262 137
60 3300025914 Ga0207671_10015543 Ga0207671_100155433 137
61 3300026035 Ga0207703_10024011 Ga0207703_100240113 137
62 3300045051 Ga0451576_1462928 Ga0451576_1462928_45_458 137
63 3300020070 Ga0206356_10945099 Ga0206356_109450992 138
64 3300014325 Ga0163163_10059713 Ga0163163_100597134 139
65 3300025918 Ga0207662_11145059 Ga0207662_111450591 139
66 3300005457 Ga0070662_100003095 Ga0070662_1000030952 148
67 3300031251 Ga0265327_10044582 Ga0265327_100445824 149
68 3300005459 Ga0068867_100121635 Ga0068867_1001216352 150
69 3300005543 Ga0070672_100238324 Ga0070672_1002383242 150
70 3300005842 Ga0068858_101764903 Ga0068858_1017649032 150
71 3300006237 Ga0097621_101254597 Ga0097621_1012545971 150
72 3300009176 Ga0105242_10270392 Ga0105242_102703923 150
73 3300009177 Ga0105248_11112521 Ga0105248_111125212 150
74 3300009545 Ga0105237_10024786 Ga0105237_100247865 150
75 3300025934 Ga0207686_10465261 Ga0207686_104652612 150
76 3300025938 Ga0207704_10009678 Ga0207704_100096783 150
77 3300025940 Ga0207691_10002306 Ga0207691_1000230613 150
78 3300026089 Ga0207648_10002215 Ga0207648_1000221511 150
79 3300027364 Ga0209967_1002423 Ga0209967_10024232 150
80 3300027395 Ga0209996_1021378 Ga0209996_10213781 150
81 3300027552 Ga0209982_1004202 Ga0209982_10042022 150
82 3300027617 Ga0210002_1001414 Ga0210002_10014143 150
83 3300027665 Ga0209983_1001769 Ga0209983_10017694 150
84 3300027876 Ga0209974_10000198 Ga0209974_1000019818 150
85 3300005347 Ga0070668_101368395 Ga0070668_1013683951 151
86 3300005356 Ga0070674_100723654 Ga0070674_1007236542 151
87 3300005441 Ga0070700_100070752 Ga0070700_1000707523 151
88 3300005577 Ga0068857_101513225 Ga0068857_1015132252 151
89 3300005840 Ga0068870_10079961 Ga0068870_100799612 151
90 3300005844 Ga0068862_100006119 Ga0068862_1000061196 151
91 3300009094 Ga0111539_10146460 Ga0111539_101464602 151
92 3300014325 Ga0163163_10000050 Ga0163163_1000005071 151
93 3300025907 Ga0207645_10001571 Ga0207645_1000157115 151
94 3300025908 Ga0207643_10001503 Ga0207643_100015038 151
95 3300025933 Ga0207706_10001026 Ga0207706_1000102611 151
96 3300025972 Ga0207668_10226387 Ga0207668_102263872 151
97 3300026075 Ga0207708_10013179 Ga0207708_100131792 151
98 3300026118 Ga0207675_100001295 Ga0207675_10000129513 151
99 3300027614 Ga0209970_1031468 Ga0209970_10314682 151
100 3300027682 Ga0209971_1029220 Ga0209971_10292202 151
101 3300009174 Ga0105241_10672970 Ga0105241_106729702 152
102 3300005333 Ga0070677_10148953 Ga0070677_101489531 153
103 3300005339 Ga0070660_100098778 Ga0070660_1000987781 153
104 3300006847 Ga0075431_100170808 Ga0075431_1001708082 153
105 3300009176 Ga0105242_11362354 Ga0105242_113623542 153
106 3300014326 Ga0157380_10133301 Ga0157380_101333012 153
107 3300025912 Ga0207707_10493287 Ga0207707_104932872 153
108 3300025919 Ga0207657_10104810 Ga0207657_101048101 153
109 3300044842 Ga0466957_0103713 Ga0466957_0103713_1048_1533 153
110 3300050508 nmdc:mga09592_249999_c1 nmdc:mga09592_249999_c1_782_1261 153
111 3300050511 nmdc:mga08y16_68959_c1 nmdc:mga08y16_68959_c1_3042_3521 153
112 3300005347 Ga0070668_101209663 Ga0070668_1012096631 154
113 3300005617 Ga0068859_100680482 Ga0068859_1006804822 154
114 3300005719 Ga0068861_101000282 Ga0068861_1010002821 154
115 3300005983 Ga0081540_1000537 Ga0081540_100053727 154
116 3300006931 Ga0097620_100680498 Ga0097620_1006804982 154
117 3300013307 Ga0157372_10026832 Ga0157372_100268324 154
118 3300025949 Ga0207667_10753764 Ga0207667_107537642 154
119 3300026035 Ga0207703_10690034 Ga0207703_106900342 154
120 3300044673 Ga0453683_0282765 Ga0453683_0282765_109_588 154
121 3300046526 Ga0495666_0156918 Ga0495666_0156918_100_567 154
122 3300046537 Ga0495598_0102171 Ga0495598_0102171_75_554 154
123 3300053139 Ga0500568_0075074 Ga0500568_0075074_698_1162 154
124 3300053153 Ga0500616_0001180 Ga0500616_0001180_4970_5434 154
125 3300049571 Ga0501034_0385268 Ga0501034_0385268_429_896 155
126 3300049573 Ga0501037_0016223 Ga0501037_0016223_285_752 155
127 3300049579 Ga0501043_0069605 Ga0501043_0069605_1685_2152 155
128 3300049822 Ga0501035_0376428 Ga0501035_0376428_278_745 155
129 3300049823 Ga0501044_0716746 Ga0501044_0716746_368_835 155
130 3300027543 Ga0209999_1027666 Ga0209999_10276662 156
131 3300005471 Ga0070698_100363228 Ga0070698_1003632282 157
132 3300042876 Ga0451577_0157597 Ga0451577_0157597_484_972 157
133 3300045051 Ga0451576_0809823 Ga0451576_0809823_313_786 157
134 3300005445 Ga0070708_100272596 Ga0070708_1002725961 158
135 3300031251 Ga0265327_10004951 Ga0265327_100049514 158
136 3300042436 Ga0439435_0116551 Ga0439435_0116551_225_701 158
137 3300005293 Ga0065715_10248901 Ga0065715_102489011 159
138 3300005328 Ga0070676_10019404 Ga0070676_100194044 159
139 3300005329 Ga0070683_100017284 Ga0070683_1000172842 159
140 3300005330 Ga0070690_100012594 Ga0070690_1000125943 159
141 3300005331 Ga0070670_101485088 Ga0070670_1014850881 159
142 3300005333 Ga0070677_10153398 Ga0070677_101533982 159
143 3300005338 Ga0068868_100035090 Ga0068868_1000350901 159
144 3300005338 Ga0068868_100177435 Ga0068868_1001774353 159
145 3300005339 Ga0070660_100101881 Ga0070660_1001018812 159
146 3300005343 Ga0070687_100241888 Ga0070687_1002418882 159
147 3300005344 Ga0070661_100171706 Ga0070661_1001717062 159
148 3300005355 Ga0070671_100497861 Ga0070671_1004978613 159
149 3300005364 Ga0070673_100962481 Ga0070673_1009624811 159
150 3300005366 Ga0070659_100183036 Ga0070659_1001830362 159
151 3300005367 Ga0070667_100043617 Ga0070667_1000436176 159
152 3300005445 Ga0070708_100608583 Ga0070708_1006085832 159
153 3300005455 Ga0070663_100475277 Ga0070663_1004752772 159
154 3300005455 Ga0070663_101269802 Ga0070663_1012698021 159
155 3300005457 Ga0070662_100344245 Ga0070662_1003442452 159
156 3300005459 Ga0068867_100003457 Ga0068867_10000345711 159
157 3300005459 Ga0068867_100031637 Ga0068867_1000316373 159
158 3300005466 Ga0070685_10059573 Ga0070685_100595732 159
159 3300005539 Ga0068853_100334936 Ga0068853_1003349363 159
160 3300005543 Ga0070672_100694634 Ga0070672_1006946342 159
161 3300005547 Ga0070693_100137052 Ga0070693_1001370522 159
162 3300005564 Ga0070664_100042572 Ga0070664_1000425723 159
163 3300005564 Ga0070664_100249946 Ga0070664_1002499462 159
164 3300005578 Ga0068854_100074986 Ga0068854_1000749862 159
165 3300005578 Ga0068854_100209768 Ga0068854_1002097682 159
166 3300005617 Ga0068859_100860980 Ga0068859_1008609802 159
167 3300005719 Ga0068861_100259554 Ga0068861_1002595542 159
168 3300005719 Ga0068861_101447502 Ga0068861_1014475021 159
169 3300005834 Ga0068851_10240381 Ga0068851_102403812 159
170 3300005840 Ga0068870_10264028 Ga0068870_102640282 159
171 3300005844 Ga0068862_101320692 Ga0068862_1013206922 159
172 3300006038 Ga0075365_10140939 Ga0075365_101409393 159
173 3300006163 Ga0070715_10097659 Ga0070715_100976594 159
174 3300006237 Ga0097621_100562255 Ga0097621_1005622552 159
175 3300006353 Ga0075370_10384471 Ga0075370_103844712 159
176 3300006358 Ga0068871_100105173 Ga0068871_1001051734 159
177 3300006358 Ga0068871_100198731 Ga0068871_1001987312 159
178 3300006844 Ga0075428_100013669 Ga0075428_1000136696 159
179 3300006844 Ga0075428_100839048 Ga0075428_1008390482 159
180 3300006914 Ga0075436_100434958 Ga0075436_1004349582 159
181 3300006931 Ga0097620_100860949 Ga0097620_1008609492 159
182 3300009094 Ga0111539_10763722 Ga0111539_107637222 159
183 3300009094 Ga0111539_10963838 Ga0111539_109638381 159
184 3300009098 Ga0105245_10729976 Ga0105245_107299761 159
185 3300009148 Ga0105243_10555982 Ga0105243_105559821 159
186 3300009176 Ga0105242_10172944 Ga0105242_101729443 159
187 3300009177 Ga0105248_10066741 Ga0105248_100667413 159
188 3300009551 Ga0105238_10997087 Ga0105238_109970871 159
189 3300009553 Ga0105249_10284691 Ga0105249_102846912 159
190 3300011119 Ga0105246_10122595 Ga0105246_101225951 159
191 3300013102 Ga0157371_10023683 Ga0157371_100236833 159
192 3300013104 Ga0157370_10065301 Ga0157370_100653012 159
193 3300013105 Ga0157369_10277331 Ga0157369_102773314 159
194 3300013296 Ga0157374_10000047 Ga0157374_1000004765 159
195 3300013296 Ga0157374_10573058 Ga0157374_105730582 159
196 3300013296 Ga0157374_10827775 Ga0157374_108277752 159
197 3300013297 Ga0157378_10016554 Ga0157378_100165544 159
198 3300013297 Ga0157378_10019007 Ga0157378_100190076 159
199 3300013297 Ga0157378_10209960 Ga0157378_102099603 159
200 3300013306 Ga0163162_10004763 Ga0163162_1000476312 159
201 3300013308 Ga0157375_10038062 Ga0157375_100380624 159
202 3300013308 Ga0157375_10112340 Ga0157375_101123401 159
203 3300013308 Ga0157375_10991353 Ga0157375_109913531 159
204 3300014326 Ga0157380_10086184 Ga0157380_100861843 159
205 3300014745 Ga0157377_10253138 Ga0157377_102531382 159
206 3300014968 Ga0157379_10046693 Ga0157379_100466932 159
207 3300014968 Ga0157379_11283202 Ga0157379_112832021 159
208 3300014969 Ga0157376_10001129 Ga0157376_100011297 159
209 3300017792 Ga0163161_10494810 Ga0163161_104948101 159
210 3300025321 Ga0207656_10071010 Ga0207656_100710101 159
211 3300025893 Ga0207682_10043802 Ga0207682_100438023 159
212 3300025903 Ga0207680_10063440 Ga0207680_100634403 159
213 3300025907 Ga0207645_10004816 Ga0207645_100048169 159
214 3300025907 Ga0207645_10389498 Ga0207645_103894981 159
215 3300025915 Ga0207693_10276020 Ga0207693_102760202 159
216 3300025918 Ga0207662_10226869 Ga0207662_102268692 159
217 3300025919 Ga0207657_10097598 Ga0207657_100975983 159
218 3300025920 Ga0207649_10166596 Ga0207649_101665962 159
219 3300025925 Ga0207650_10149227 Ga0207650_101492272 159
220 3300025931 Ga0207644_10042958 Ga0207644_100429583 159
221 3300025931 Ga0207644_10257064 Ga0207644_102570643 159
222 3300025933 Ga0207706_10790919 Ga0207706_107909191 159
223 3300025934 Ga0207686_11062208 Ga0207686_110622081 159
224 3300025940 Ga0207691_10872222 Ga0207691_108722221 159
225 3300025944 Ga0207661_10616600 Ga0207661_106166002 159
226 3300025945 Ga0207679_10321444 Ga0207679_103214442 159
227 3300025945 Ga0207679_11864427 Ga0207679_118644271 159
228 3300025972 Ga0207668_10675584 Ga0207668_106755842 159
229 3300025981 Ga0207640_10206999 Ga0207640_102069992 159
230 3300026041 Ga0207639_10519146 Ga0207639_105191463 159
231 3300026067 Ga0207678_10269252 Ga0207678_102692523 159
232 3300026067 Ga0207678_10378487 Ga0207678_103784871 159
233 3300026067 Ga0207678_11253933 Ga0207678_112539331 159
234 3300026088 Ga0207641_10249391 Ga0207641_102493912 159
235 3300026089 Ga0207648_10004747 Ga0207648_1000474717 159
236 3300026142 Ga0207698_10084727 Ga0207698_100847272 159
237 3300026142 Ga0207698_10090808 Ga0207698_100908085 159
238 3300028380 Ga0268265_11314209 Ga0268265_113142091 159
239 3300035089 Ga0373944_0101410 Ga0373944_0101410_461_940 159
240 3300035118 Ga0373954_0044194 Ga0373954_0044194_1123_1602 159
241 3300035120 Ga0373957_0150031 Ga0373957_0150031_272_751 159
242 3300035170 Ga0373943_0033437 Ga0373943_0033437_1364_1843 159
243 3300035170 Ga0373943_0054388 Ga0373943_0054388_68_547 159
244 3300035172 Ga0373955_0234499 Ga0373955_0234499_150_629 159
245 3300035692 Ga0373935_0050516 Ga0373935_0050516_521_1000 159
246 3300035695 Ga0373927_0022505 Ga0373927_0022505_2119_2598 159
247 3300035724 Ga0373933_0461589 Ga0373933_0461589_249_728 159
248 3300035724 Ga0373933_0833976 Ga0373933_0833976_86_565 159
249 3300035725 Ga0373947_0036466 Ga0373947_0036466_666_1145 159
250 3300035725 Ga0373947_0247871 Ga0373947_0247871_287_766 159
251 3300036401 Ga0373937_0021634 Ga0373937_0021634_5193_5672 159
252 3300037068 Ga0373925_0029136 Ga0373925_0029136_525_1004 159
253 3300037068 Ga0373925_0180459 Ga0373925_0180459_857_1336 159
254 3300041459 Ga0451800_1686787 Ga0451800_1686787_38_517 159
255 3300042125 Ga0450923_016997 Ga0450923_016997_753_1232 159
256 3300042134 Ga0450898_035914 Ga0450898_035914_154_633 159
257 3300045976 Ga0466967_0060636 Ga0466967_0060636_1303_1782 159
258 3300046459 Ga0495629_0121147 Ga0495629_0121147_872_1351 159
259 3300046463 Ga0495653_0058070 Ga0495653_0058070_1462_1941 159
260 3300046472 Ga0495580_0284614 Ga0495580_0284614_519_998 159
261 3300046473 Ga0495582_0014163 Ga0495582_0014163_2855_3334 159
262 3300046475 Ga0495639_0004728 Ga0495639_0004728_4867_5346 159
263 3300046475 Ga0495639_0139272 Ga0495639_0139272_575_1054 159
264 3300046526 Ga0495666_0082407 Ga0495666_0082407_821_1300 159
265 3300046531 Ga0495665_0083227 Ga0495665_0083227_736_1215 159
266 3300046559 Ga0495667_0360168 Ga0495667_0360168_61_540 159
267 3300046663 Ga0495635_0028927 Ga0495635_0028927_2653_3132 159
268 3300046663 Ga0495635_0434733 Ga0495635_0434733_115_594 159
269 3300046681 Ga0495647_0014033 Ga0495647_0014033_81_560 159
270 3300046681 Ga0495647_0105691 Ga0495647_0105691_178_657 159
271 3300046683 Ga0495658_0005367 Ga0495658_0005367_546_1025 159
272 3300046689 Ga0495613_0039367 Ga0495613_0039367_1042_1521 159
273 3300046809 Ga0495600_0007944 Ga0495600_0007944_4398_4877 159
274 3300046809 Ga0495600_0482420 Ga0495600_0482420_42_521 159
275 3300047315 Ga0495581_0019333 Ga0495581_0019333_957_1436 159
276 3300047322 Ga0495680_0225283 Ga0495680_0225283_597_1076 159
277 3300047471 Ga0495684_0063014 Ga0495684_0063014_2329_2808 159
278 3300048903 Ga0496100_0217104 Ga0496100_0217104_385_864 159
279 3300048906 Ga0496103_0408593 Ga0496103_0408593_379_858 159
280 3300048907 Ga0496104_0083359 Ga0496104_0083359_2135_2614 159
281 3300048907 Ga0496104_0242617 Ga0496104_0242617_366_845 159
282 3300048908 Ga0496105_0010875 Ga0496105_0010875_1562_2041 159
283 3300048908 Ga0496105_0168051 Ga0496105_0168051_111_590 159
284 3300048910 Ga0496107_0058045 Ga0496107_0058045_981_1460 159
285 3300048910 Ga0496107_0394051 Ga0496107_0394051_228_707 159
286 3300048911 Ga0496108_0022736 Ga0496108_0022736_2663_3142 159
287 3300048912 Ga0496109_0120079 Ga0496109_0120079_1847_2326 159
288 3300048913 Ga0496110_0209096 Ga0496110_0209096_789_1268 159
289 3300048913 Ga0496110_0706312 Ga0496110_0706312_324_803 159
290 3300048914 Ga0496111_0597339 Ga0496111_0597339_223_702 159
291 3300048915 Ga0496112_0089744 Ga0496112_0089744_1123_1602 159
292 3300048917 Ga0496114_0089418 Ga0496114_0089418_1952_2431 159
293 3300048917 Ga0496114_0154412 Ga0496114_0154412_1326_1805 159
294 3300048917 Ga0496114_0540874 Ga0496114_0540874_371_850 159
295 3300048918 Ga0496115_0029766 Ga0496115_0029766_2468_2947 159
296 3300050492 nmdc:mga0yw44_127075_c1 nmdc:mga0yw44_127075_c1_710_1189 159
297 3300050493 nmdc:mga0k408_151596_c1 nmdc:mga0k408_151596_c1_778_1257 159
298 3300050510 nmdc:mga06r32_166152_c1 nmdc:mga06r32_166152_c1_296_775 159
299 3300050511 nmdc:mga08y16_329127_c1 nmdc:mga08y16_329127_c1_378_857 159
300 3300053078 Ga0495612_0317651 Ga0495612_0317651_62_562 159
301 3300053084 Ga0495595_0050383 Ga0495595_0050383_1024_1503 159
302 3300053085 Ga0495619_0114469 Ga0495619_0114469_960_1439 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

22

149

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9768 8 155
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9391 8 155
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.8944 21 129
1cqs-assembly1.cif.gz_B crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida 0.8778 16 129
1w00-assembly1.cif.gz_B crystal structure of mutant enzyme d103l of ketosteroid isomerase from pseudomonas putida biotype b 0.8723 16 129
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9947 15 155 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9806 15 155 3.10.450.50
af_A0A1D8PD11_9_180_2.40.160.20 Mainly Beta;Beta Barrel;Porin; 0.8898 87 117 2.40.160.20
3ebtA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.877 19 129 3.10.450.50
4xdvE00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8709 21 129 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A0P4V4M4-F1-model_v4 COGs COG3558 1 63 155
AF-A0A3C0NIB0-F1-model_v4 DUF1348 domain-containing protein 0.9992 21 141
AF-A0A1H7CD02-F1-model_v4 DUF1348 domain-containing protein 0.9991 63 159
AF-A0A512HQ28-F1-model_v4 50S ribosomal protein L21 0.9991 58 159
AF-J8V0J8-F1-model_v4 deleted 0.998 71 159

Feature Viewer

pLDDT pTM Quality
93.88 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map