F396322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 204 | 302 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_101368395|Ga0070668_1013683951 |
| Length | 167 |
| Sequence | MWGGEAVSRGELKVASMSNTEPPAESATQKVRMAEDAWNTREPQRVAMAYTRDSVWRNRAEFLAGREAIEQFLIRKWSKELDYRLIKELWAFHDNRIAVRFAYEWHDDSGTWFRSYGNENWEFDPLGYMRRRIASINDLPIAERARKYRWPLGRRPDDHPGLSDLGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 129 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 130 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 131 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 132 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 133 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 134 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 143 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 144 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 145 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 146 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 147 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 194 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 195 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 204 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.99 |
| Nodule | 0 |
| Rhizoplane | 7.28 |
| Rhizosphere | 90.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10248901 | 3300005293 | Bacteria | 1147 |
| 2 | Ga0065707_10124122 | 3300005295 | Bacteria | 2045 |
| 3 | Ga0070676_10019404 | 3300005328 | Bacteria | 3782 |
| 4 | Ga0070676_10419540 | 3300005328 | Bacteria | 935 |
| 5 | Ga0070683_100017284 | 3300005329 | Bacteria | 6374 |
| 6 | Ga0070690_100012594 | 3300005330 | Bacteria | 4978 |
| 7 | Ga0070690_100312607 | 3300005330 | Bacteria | 1130 |
| 8 | Ga0070670_101485088 | 3300005331 | Bacteria | 622 |
| 9 | Ga0070677_10148953 | 3300005333 | Bacteria | 1087 |
| 10 | Ga0070677_10153398 | 3300005333 | Bacteria | 1074 |
| 11 | Ga0068868_100035090 | 3300005338 | Bacteria | 3875 |
| 12 | Ga0068868_100177435 | 3300005338 | Bacteria | 1766 |
| 13 | Ga0068868_101104180 | 3300005338 | Bacteria | 730 |
| 14 | Ga0070660_100098778 | 3300005339 | Bacteria | 2311 |
| 15 | Ga0070660_100101881 | 3300005339 | Bacteria | 2275 |
| 16 | Ga0070689_100001973 | 3300005340 | Bacteria | 13307 |
| 17 | Ga0070687_100241888 | 3300005343 | Bacteria | 1116 |
| 18 | Ga0070661_100171706 | 3300005344 | Bacteria | 1647 |
| 19 | Ga0070668_101209663 | 3300005347 | Bacteria | 685 |
| 20 | Ga0070668_101368395 | 3300005347 | Bacteria | 645 |
| 21 | Ga0070671_100497861 | 3300005355 | Bacteria | 1048 |
| 22 | Ga0070674_100723654 | 3300005356 | Bacteria | 853 |
| 23 | Ga0070673_100962481 | 3300005364 | Bacteria | 794 |
| 24 | Ga0070659_100183036 | 3300005366 | Bacteria | 1720 |
| 25 | Ga0070667_100043617 | 3300005367 | Bacteria | 3764 |
| 26 | Ga0070700_100070752 | 3300005441 | Bacteria | 2225 |
| 27 | Ga0070708_100272596 | 3300005445 | Bacteria | 1592 |
| 28 | Ga0070708_100608583 | 3300005445 | Bacteria | 1030 |
| 29 | Ga0070663_100475277 | 3300005455 | Bacteria | 1034 |
| 30 | Ga0070663_101269802 | 3300005455 | Bacteria | 649 |
| 31 | Ga0070662_100003095 | 3300005457 | Bacteria | 10330 |
| 32 | Ga0070662_100344245 | 3300005457 | Bacteria | 1220 |
| 33 | Ga0068867_100003457 | 3300005459 | Bacteria | 11109 |
| 34 | Ga0068867_100031637 | 3300005459 | Bacteria | 3822 |
| 35 | Ga0068867_100121635 | 3300005459 | Bacteria | 2018 |
| 36 | Ga0070685_10059573 | 3300005466 | Bacteria | 2230 |
| 37 | Ga0070698_100363228 | 3300005471 | Bacteria | 1380 |
| 38 | Ga0068853_100334936 | 3300005539 | Bacteria | 1405 |
| 39 | Ga0070672_100238324 | 3300005543 | Bacteria | 1529 |
| 40 | Ga0070672_100694634 | 3300005543 | Bacteria | 891 |
| 41 | Ga0070686_100643124 | 3300005544 | Bacteria | 840 |
| 42 | Ga0070693_100137052 | 3300005547 | Bacteria | 1536 |
| 43 | Ga0070693_100204696 | 3300005547 | Bacteria | 1284 |
| 44 | Ga0070664_100042572 | 3300005564 | Bacteria | 3833 |
| 45 | Ga0070664_100249946 | 3300005564 | Bacteria | 1594 |
| 46 | Ga0070664_101817720 | 3300005564 | Bacteria | 578 |
| 47 | Ga0068857_101513225 | 3300005577 | Bacteria | 654 |
| 48 | Ga0068854_100074986 | 3300005578 | Bacteria | 2483 |
| 49 | Ga0068854_100209768 | 3300005578 | Bacteria | 1536 |
| 50 | Ga0068852_100047005 | 3300005616 | Bacteria | 3680 |
| 51 | Ga0068859_100376696 | 3300005617 | Bacteria | 1515 |
| 52 | Ga0068859_100680482 | 3300005617 | Bacteria | 1120 |
| 53 | Ga0068859_100860980 | 3300005617 | Bacteria | 992 |
| 54 | Ga0068864_100000416 | 3300005618 | Bacteria | 36855 |
| 55 | Ga0068861_100259554 | 3300005719 | Bacteria | 1487 |
| 56 | Ga0068861_101000282 | 3300005719 | Bacteria | 798 |
| 57 | Ga0068861_101447502 | 3300005719 | Bacteria | 672 |
| 58 | Ga0068851_10240381 | 3300005834 | Bacteria | 1024 |
| 59 | Ga0068870_10079961 | 3300005840 | Bacteria | 1805 |
| 60 | Ga0068870_10264028 | 3300005840 | Bacteria | 1073 |
| 61 | Ga0068863_100015520 | 3300005841 | Bacteria | 7318 |
| 62 | Ga0068858_100188726 | 3300005842 | Bacteria | 1947 |
| 63 | Ga0068858_101764903 | 3300005842 | Bacteria | 611 |
| 64 | Ga0068860_100220190 | 3300005843 | Bacteria | 1843 |
| 65 | Ga0068862_100006119 | 3300005844 | Bacteria | 10015 |
| 66 | Ga0068862_101320692 | 3300005844 | Bacteria | 723 |
| 67 | Ga0081540_1000537 | 3300005983 | Bacteria | 36699 |
| 68 | Ga0075365_10140939 | 3300006038 | Bacteria | 1673 |
| 69 | Ga0070715_10097659 | 3300006163 | Bacteria | 1364 |
| 70 | Ga0097621_100562255 | 3300006237 | Bacteria | 1039 |
| 71 | Ga0097621_101254597 | 3300006237 | Bacteria | 699 |
| 72 | Ga0075370_10384471 | 3300006353 | Bacteria | 841 |
| 73 | Ga0068871_100105173 | 3300006358 | Bacteria | 2368 |
| 74 | Ga0068871_100198731 | 3300006358 | Bacteria | 1730 |
| 75 | Ga0075428_100013669 | 3300006844 | Bacteria | 9038 |
| 76 | Ga0075428_100839048 | 3300006844 | Bacteria | 976 |
| 77 | Ga0075431_100170808 | 3300006847 | Bacteria | 2234 |
| 78 | Ga0075431_100245723 | 3300006847 | Bacteria | 1819 |
| 79 | Ga0075429_100215369 | 3300006880 | Bacteria | 1682 |
| 80 | Ga0068865_100262394 | 3300006881 | Bacteria | 1368 |
| 81 | Ga0075436_100434958 | 3300006914 | Bacteria | 954 |
| 82 | Ga0097620_100376693 | 3300006931 | Bacteria | 1515 |
| 83 | Ga0097620_100680498 | 3300006931 | Bacteria | 1120 |
| 84 | Ga0097620_100860949 | 3300006931 | Bacteria | 992 |
| 85 | Ga0111539_10146460 | 3300009094 | Bacteria | 2765 |
| 86 | Ga0111539_10232184 | 3300009094 | Bacteria | 2148 |
| 87 | Ga0111539_10763722 | 3300009094 | Bacteria | 1125 |
| 88 | Ga0111539_10963838 | 3300009094 | Bacteria | 992 |
| 89 | Ga0105245_10729976 | 3300009098 | Bacteria | 1025 |
| 90 | Ga0105243_10555982 | 3300009148 | Bacteria | 1097 |
| 91 | Ga0105241_10672970 | 3300009174 | Bacteria | 942 |
| 92 | Ga0105242_10172944 | 3300009176 | Bacteria | 1899 |
| 93 | Ga0105242_10270392 | 3300009176 | Bacteria | 1539 |
| 94 | Ga0105242_11362354 | 3300009176 | Bacteria | 735 |
| 95 | Ga0105248_10066741 | 3300009177 | Bacteria | 4039 |
| 96 | Ga0105248_11112521 | 3300009177 | Bacteria | 893 |
| 97 | Ga0105237_10024786 | 3300009545 | Bacteria | 6137 |
| 98 | Ga0105238_10997087 | 3300009551 | Bacteria | 858 |
| 99 | Ga0105249_10284691 | 3300009553 | Bacteria | 1652 |
| 100 | Ga0105239_10489610 | 3300010375 | Bacteria | 1398 |
| 101 | Ga0105246_10122595 | 3300011119 | Bacteria | 1929 |
| 102 | Ga0157371_10023683 | 3300013102 | Bacteria | 4489 |
| 103 | Ga0157370_10065301 | 3300013104 | Bacteria | 3443 |
| 104 | Ga0157369_10277331 | 3300013105 | Bacteria | 1746 |
| 105 | Ga0157374_10000047 | 3300013296 | Bacteria | 137075 |
| 106 | Ga0157374_10573058 | 3300013296 | Bacteria | 1138 |
| 107 | Ga0157374_10827775 | 3300013296 | Bacteria | 942 |
| 108 | Ga0157378_10016554 | 3300013297 | Bacteria | 6458 |
| 109 | Ga0157378_10019007 | 3300013297 | Bacteria | 6038 |
| 110 | Ga0157378_10209960 | 3300013297 | Bacteria | 1846 |
| 111 | Ga0163162_10004763 | 3300013306 | Bacteria | 13093 |
| 112 | Ga0157372_10026832 | 3300013307 | Bacteria | 6270 |
| 113 | Ga0157375_10038062 | 3300013308 | Bacteria | 4615 |
| 114 | Ga0157375_10112340 | 3300013308 | Bacteria | 2825 |
| 115 | Ga0157375_10991353 | 3300013308 | Bacteria | 980 |
| 116 | Ga0163163_10000050 | 3300014325 | Bacteria | 128713 |
| 117 | Ga0163163_10059713 | 3300014325 | Bacteria | 3773 |
| 118 | Ga0157380_10086184 | 3300014326 | Bacteria | 2580 |
| 119 | Ga0157380_10133301 | 3300014326 | Bacteria | 2123 |
| 120 | Ga0157377_10253138 | 3300014745 | Bacteria | 1142 |
| 121 | Ga0157379_10046693 | 3300014968 | Bacteria | 3864 |
| 122 | Ga0157379_11283202 | 3300014968 | Bacteria | 707 |
| 123 | Ga0157376_10001129 | 3300014969 | Bacteria | 17508 |
| 124 | Ga0163161_10009709 | 3300017792 | Bacteria | 6664 |
| 125 | Ga0163161_10494810 | 3300017792 | Bacteria | 995 |
| 126 | Ga0206356_10945099 | 3300020070 | Bacteria | 1472 |
| 127 | Ga0207697_10087609 | 3300025315 | Bacteria | 1317 |
| 128 | Ga0207656_10071010 | 3300025321 | Bacteria | 1547 |
| 129 | Ga0207682_10043802 | 3300025893 | Bacteria | 1833 |
| 130 | Ga0207680_10063440 | 3300025903 | Bacteria | 2261 |
| 131 | Ga0207645_10001571 | 3300025907 | Bacteria | 18633 |
| 132 | Ga0207645_10004816 | 3300025907 | Bacteria | 9916 |
| 133 | Ga0207645_10038090 | 3300025907 | Bacteria | 3085 |
| 134 | Ga0207645_10389498 | 3300025907 | Bacteria | 936 |
| 135 | Ga0207643_10001503 | 3300025908 | Bacteria | 13345 |
| 136 | Ga0207643_10189654 | 3300025908 | Bacteria | 1247 |
| 137 | Ga0207707_10493287 | 3300025912 | Bacteria | 1045 |
| 138 | Ga0207671_10015543 | 3300025914 | Bacteria | 5953 |
| 139 | Ga0207693_10276020 | 3300025915 | Bacteria | 1317 |
| 140 | Ga0207662_10226869 | 3300025918 | Bacteria | 1218 |
| 141 | Ga0207662_11145059 | 3300025918 | Bacteria | 553 |
| 142 | Ga0207657_10097598 | 3300025919 | Bacteria | 2443 |
| 143 | Ga0207657_10104810 | 3300025919 | Bacteria | 2342 |
| 144 | Ga0207649_10166596 | 3300025920 | Bacteria | 1531 |
| 145 | Ga0207650_10149227 | 3300025925 | Bacteria | 1844 |
| 146 | Ga0207659_10001876 | 3300025926 | Bacteria | 12443 |
| 147 | Ga0207644_10006515 | 3300025931 | Bacteria | 7613 |
| 148 | Ga0207644_10042958 | 3300025931 | Bacteria | 3206 |
| 149 | Ga0207644_10257064 | 3300025931 | Bacteria | 1395 |
| 150 | Ga0207706_10001026 | 3300025933 | Bacteria | 28419 |
| 151 | Ga0207706_10790919 | 3300025933 | Bacteria | 806 |
| 152 | Ga0207686_10465261 | 3300025934 | Bacteria | 975 |
| 153 | Ga0207686_11062208 | 3300025934 | Bacteria | 659 |
| 154 | Ga0207670_10001270 | 3300025936 | Bacteria | 13339 |
| 155 | Ga0207704_10009678 | 3300025938 | Bacteria | 4663 |
| 156 | Ga0207691_10002306 | 3300025940 | Bacteria | 18705 |
| 157 | Ga0207691_10872222 | 3300025940 | Bacteria | 754 |
| 158 | Ga0207711_10031865 | 3300025941 | Bacteria | 4454 |
| 159 | Ga0207661_10616600 | 3300025944 | Bacteria | 996 |
| 160 | Ga0207679_10315158 | 3300025945 | Bacteria | 1353 |
| 161 | Ga0207679_10321444 | 3300025945 | Bacteria | 1340 |
| 162 | Ga0207679_11864427 | 3300025945 | Bacteria | 549 |
| 163 | Ga0207667_10753764 | 3300025949 | Bacteria | 973 |
| 164 | Ga0207651_10063808 | 3300025960 | Bacteria | 2574 |
| 165 | Ga0207668_10226387 | 3300025972 | Bacteria | 1505 |
| 166 | Ga0207668_10675584 | 3300025972 | Bacteria | 906 |
| 167 | Ga0207640_10206999 | 3300025981 | Bacteria | 1491 |
| 168 | Ga0207677_10004129 | 3300026023 | Bacteria | 7769 |
| 169 | Ga0207677_10978871 | 3300026023 | Bacteria | 766 |
| 170 | Ga0207703_10024011 | 3300026035 | Bacteria | 4797 |
| 171 | Ga0207703_10690034 | 3300026035 | Bacteria | 970 |
| 172 | Ga0207639_10519146 | 3300026041 | Bacteria | 1090 |
| 173 | Ga0207678_10269252 | 3300026067 | Bacteria | 1460 |
| 174 | Ga0207678_10378487 | 3300026067 | Bacteria | 1224 |
| 175 | Ga0207678_11253933 | 3300026067 | Bacteria | 656 |
| 176 | Ga0207708_10013179 | 3300026075 | Bacteria | 6171 |
| 177 | Ga0207641_10249391 | 3300026088 | Bacteria | 1657 |
| 178 | Ga0207641_10463797 | 3300026088 | Bacteria | 1226 |
| 179 | Ga0207648_10002215 | 3300026089 | Bacteria | 21068 |
| 180 | Ga0207648_10004747 | 3300026089 | Bacteria | 13887 |
| 181 | Ga0207676_10000477 | 3300026095 | Bacteria | 33711 |
| 182 | Ga0207675_100001295 | 3300026118 | Bacteria | 25065 |
| 183 | Ga0207698_10084727 | 3300026142 | Bacteria | 2570 |
| 184 | Ga0207698_10090808 | 3300026142 | Bacteria | 2499 |
| 185 | Ga0207698_12757481 | 3300026142 | Bacteria | 500 |
| 186 | Ga0209967_1002423 | 3300027364 | Bacteria | 2415 |
| 187 | Ga0209996_1021378 | 3300027395 | Bacteria | 911 |
| 188 | Ga0209999_1027666 | 3300027543 | Bacteria | 1050 |
| 189 | Ga0209982_1004202 | 3300027552 | Bacteria | 2061 |
| 190 | Ga0209970_1031468 | 3300027614 | Bacteria | 923 |
| 191 | Ga0210002_1001414 | 3300027617 | Bacteria | 3374 |
| 192 | Ga0209983_1001769 | 3300027665 | Bacteria | 4791 |
| 193 | Ga0209971_1029220 | 3300027682 | Bacteria | 1320 |
| 194 | Ga0209974_10000198 | 3300027876 | Bacteria | 19218 |
| 195 | Ga0268265_11314209 | 3300028380 | Bacteria | 723 |
| 196 | Ga0265327_10004951 | 3300031251 | Bacteria | 11448 |
| 197 | Ga0265327_10044582 | 3300031251 | Bacteria | 2363 |
| 198 | Ga0373944_0101410 | 3300035089 | Bacteria | 973 |
| 199 | Ga0373953_0017513 | 3300035117 | Bacteria | 2635 |
| 200 | Ga0373954_0044194 | 3300035118 | Bacteria | 2078 |
| 201 | Ga0373956_0003761 | 3300035119 | Bacteria | 6113 |
| 202 | Ga0373957_0150031 | 3300035120 | Bacteria | 957 |
| 203 | Ga0373943_0033437 | 3300035170 | Bacteria | 2450 |
| 204 | Ga0373943_0054388 | 3300035170 | Bacteria | 1980 |
| 205 | Ga0373955_0004972 | 3300035172 | Bacteria | 5933 |
| 206 | Ga0373955_0234499 | 3300035172 | Bacteria | 1098 |
| 207 | Ga0373935_0050516 | 3300035692 | Bacteria | 2639 |
| 208 | Ga0373927_0022505 | 3300035695 | Bacteria | 4129 |
| 209 | Ga0373933_0000681 | 3300035724 | Bacteria | 20930 |
| 210 | Ga0373933_0461589 | 3300035724 | Bacteria | 831 |
| 211 | Ga0373933_0833976 | 3300035724 | Bacteria | 607 |
| 212 | Ga0373947_0036466 | 3300035725 | Bacteria | 2916 |
| 213 | Ga0373947_0247871 | 3300035725 | Bacteria | 1177 |
| 214 | Ga0373937_0001140 | 3300036401 | Bacteria | 22318 |
| 215 | Ga0373937_0021634 | 3300036401 | Bacteria | 5772 |
| 216 | Ga0373925_0029136 | 3300037068 | Bacteria | 4049 |
| 217 | Ga0373925_0180459 | 3300037068 | Bacteria | 1671 |
| 218 | Ga0451800_1471335 | 3300041459 | Bacteria | 819 |
| 219 | Ga0451800_1686787 | 3300041459 | Bacteria | 576 |
| 220 | Ga0451851_1051196 | 3300041507 | Bacteria | 641 |
| 221 | Ga0450920_025407 | 3300042122 | Bacteria | 1154 |
| 222 | Ga0450923_016997 | 3300042125 | Bacteria | 1377 |
| 223 | Ga0450898_035914 | 3300042134 | Bacteria | 924 |
| 224 | Ga0439435_0116551 | 3300042436 | Bacteria | 833 |
| 225 | Ga0451577_0157597 | 3300042876 | Bacteria | 2044 |
| 226 | Ga0453683_0282765 | 3300044673 | Bacteria | 1060 |
| 227 | Ga0466957_0103713 | 3300044842 | Bacteria | 1796 |
| 228 | Ga0451576_0039574 | 3300045051 | Bacteria | 4990 |
| 229 | Ga0451576_0809823 | 3300045051 | Bacteria | 983 |
| 230 | Ga0451576_1462928 | 3300045051 | Bacteria | 710 |
| 231 | Ga0451576_2750096 | 3300045051 | Bacteria | 500 |
| 232 | Ga0466967_0060636 | 3300045976 | Bacteria | 3353 |
| 233 | Ga0495592_0595700 | 3300046454 | Bacteria | 675 |
| 234 | Ga0495629_0121147 | 3300046459 | Bacteria | 1822 |
| 235 | Ga0495651_0000233 | 3300046462 | Bacteria | 42757 |
| 236 | Ga0495653_0058070 | 3300046463 | Bacteria | 2942 |
| 237 | Ga0495580_0284614 | 3300046472 | Bacteria | 1127 |
| 238 | Ga0495582_0014163 | 3300046473 | Bacteria | 4388 |
| 239 | Ga0495639_0004728 | 3300046475 | Bacteria | 5855 |
| 240 | Ga0495639_0139272 | 3300046475 | Bacteria | 1166 |
| 241 | Ga0495608_0351980 | 3300046511 | Bacteria | 906 |
| 242 | Ga0495666_0082407 | 3300046526 | Bacteria | 1521 |
| 243 | Ga0495666_0156918 | 3300046526 | Bacteria | 1056 |
| 244 | Ga0495665_0083227 | 3300046531 | Bacteria | 1682 |
| 245 | Ga0495598_0102171 | 3300046537 | Bacteria | 950 |
| 246 | Ga0495667_0360168 | 3300046559 | Bacteria | 918 |
| 247 | Ga0495668_0068317 | 3300046616 | Bacteria | 1955 |
| 248 | Ga0495635_0028927 | 3300046663 | Bacteria | 3852 |
| 249 | Ga0495635_0434733 | 3300046663 | Bacteria | 869 |
| 250 | Ga0495657_0018536 | 3300046675 | Bacteria | 5032 |
| 251 | Ga0495657_0708793 | 3300046675 | Bacteria | 578 |
| 252 | Ga0495647_0014033 | 3300046681 | Bacteria | 2786 |
| 253 | Ga0495647_0105691 | 3300046681 | Bacteria | 1170 |
| 254 | Ga0495658_0005367 | 3300046683 | Bacteria | 6305 |
| 255 | Ga0495658_0655358 | 3300046683 | Bacteria | 672 |
| 256 | Ga0495613_0039367 | 3300046689 | Bacteria | 3505 |
| 257 | Ga0495600_0007944 | 3300046809 | Bacteria | 6503 |
| 258 | Ga0495600_0482420 | 3300046809 | Bacteria | 764 |
| 259 | Ga0495581_0019333 | 3300047315 | Bacteria | 3953 |
| 260 | Ga0495581_0339041 | 3300047315 | Bacteria | 878 |
| 261 | Ga0495680_0225283 | 3300047322 | Bacteria | 1337 |
| 262 | Ga0495684_0063014 | 3300047471 | Bacteria | 2819 |
| 263 | Ga0496100_0217104 | 3300048903 | Bacteria | 1402 |
| 264 | Ga0496102_1068836 | 3300048905 | Bacteria | 727 |
| 265 | Ga0496103_0408593 | 3300048906 | Bacteria | 872 |
| 266 | Ga0496104_0083359 | 3300048907 | Bacteria | 3049 |
| 267 | Ga0496104_0242617 | 3300048907 | Bacteria | 1714 |
| 268 | Ga0496105_0010875 | 3300048908 | Bacteria | 7165 |
| 269 | Ga0496105_0168051 | 3300048908 | Bacteria | 1799 |
| 270 | Ga0496105_1061608 | 3300048908 | Bacteria | 603 |
| 271 | Ga0496107_0058045 | 3300048910 | Bacteria | 2798 |
| 272 | Ga0496107_0394051 | 3300048910 | Bacteria | 1030 |
| 273 | Ga0496108_0022736 | 3300048911 | Bacteria | 5157 |
| 274 | Ga0496109_0120079 | 3300048912 | Bacteria | 2448 |
| 275 | Ga0496110_0209096 | 3300048913 | Bacteria | 1774 |
| 276 | Ga0496110_0706312 | 3300048913 | Bacteria | 910 |
| 277 | Ga0496111_0597339 | 3300048914 | Bacteria | 808 |
| 278 | Ga0496112_0089744 | 3300048915 | Bacteria | 3042 |
| 279 | Ga0496114_0089418 | 3300048917 | Bacteria | 2613 |
| 280 | Ga0496114_0154412 | 3300048917 | Bacteria | 1992 |
| 281 | Ga0496114_0540874 | 3300048917 | Bacteria | 1030 |
| 282 | Ga0496115_0029766 | 3300048918 | Bacteria | 4291 |
| 283 | Ga0501034_0385268 | 3300049571 | Bacteria | 1326 |
| 284 | Ga0501037_0016223 | 3300049573 | Bacteria | 5482 |
| 285 | Ga0501043_0069605 | 3300049579 | Bacteria | 2764 |
| 286 | Ga0501035_0376428 | 3300049822 | Bacteria | 1185 |
| 287 | Ga0501044_0716746 | 3300049823 | Bacteria | 885 |
| 288 | nmdc:mga0yw44_127075_c1 | 3300050492 | Bacteria | 1647 |
| 289 | nmdc:mga0k408_151596_c1 | 3300050493 | Bacteria | 1380 |
| 290 | nmdc:mga09592_249999_c1 | 3300050508 | Bacteria | 1537 |
| 291 | nmdc:mga09592_49017_c1 | 3300050508 | Bacteria | 3561 |
| 292 | nmdc:mga06r32_166152_c1 | 3300050510 | Bacteria | 2190 |
| 293 | nmdc:mga06r32_50923_c1 | 3300050510 | Bacteria | 3962 |
| 294 | nmdc:mga08y16_329127_c1 | 3300050511 | Bacteria | 1572 |
| 295 | nmdc:mga08y16_68959_c1 | 3300050511 | Bacteria | 3687 |
| 296 | nmdc:mga08x19_467722_c1 | 3300050514 | Bacteria | 888 |
| 297 | Ga0495601_0482588 | 3300053077 | Bacteria | 801 |
| 298 | Ga0495612_0317651 | 3300053078 | Bacteria | 700 |
| 299 | Ga0495595_0050383 | 3300053084 | Bacteria | 1928 |
| 300 | Ga0495619_0114469 | 3300053085 | Bacteria | 1845 |
| 301 | Ga0500568_0075074 | 3300053139 | Bacteria | 1289 |
| 302 | Ga0500616_0001180 | 3300053153 | Bacteria | 26586 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005295 | Ga0065707_10124122 | Ga0065707_101241222 | 135 |
| 2 | 3300005328 | Ga0070676_10419540 | Ga0070676_104195401 | 135 |
| 3 | 3300005330 | Ga0070690_100312607 | Ga0070690_1003126072 | 135 |
| 4 | 3300005338 | Ga0068868_101104180 | Ga0068868_1011041801 | 135 |
| 5 | 3300005340 | Ga0070689_100001973 | Ga0070689_1000019737 | 135 |
| 6 | 3300005544 | Ga0070686_100643124 | Ga0070686_1006431241 | 135 |
| 7 | 3300005547 | Ga0070693_100204696 | Ga0070693_1002046963 | 135 |
| 8 | 3300005564 | Ga0070664_101817720 | Ga0070664_1018177202 | 135 |
| 9 | 3300005616 | Ga0068852_100047005 | Ga0068852_1000470053 | 135 |
| 10 | 3300005617 | Ga0068859_100376696 | Ga0068859_1003766962 | 135 |
| 11 | 3300005618 | Ga0068864_100000416 | Ga0068864_10000041630 | 135 |
| 12 | 3300005841 | Ga0068863_100015520 | Ga0068863_1000155205 | 135 |
| 13 | 3300005843 | Ga0068860_100220190 | Ga0068860_1002201903 | 135 |
| 14 | 3300006847 | Ga0075431_100245723 | Ga0075431_1002457232 | 135 |
| 15 | 3300006880 | Ga0075429_100215369 | Ga0075429_1002153691 | 135 |
| 16 | 3300006881 | Ga0068865_100262394 | Ga0068865_1002623944 | 135 |
| 17 | 3300006931 | Ga0097620_100376693 | Ga0097620_1003766932 | 135 |
| 18 | 3300009094 | Ga0111539_10232184 | Ga0111539_102321843 | 135 |
| 19 | 3300010375 | Ga0105239_10489610 | Ga0105239_104896102 | 135 |
| 20 | 3300017792 | Ga0163161_10009709 | Ga0163161_100097094 | 135 |
| 21 | 3300025315 | Ga0207697_10087609 | Ga0207697_100876093 | 135 |
| 22 | 3300025907 | Ga0207645_10038090 | Ga0207645_100380904 | 135 |
| 23 | 3300025908 | Ga0207643_10189654 | Ga0207643_101896542 | 135 |
| 24 | 3300025926 | Ga0207659_10001876 | Ga0207659_100018761 | 135 |
| 25 | 3300025931 | Ga0207644_10006515 | Ga0207644_100065156 | 135 |
| 26 | 3300025936 | Ga0207670_10001270 | Ga0207670_1000127014 | 135 |
| 27 | 3300025941 | Ga0207711_10031865 | Ga0207711_100318655 | 135 |
| 28 | 3300025945 | Ga0207679_10315158 | Ga0207679_103151582 | 135 |
| 29 | 3300025960 | Ga0207651_10063808 | Ga0207651_100638083 | 135 |
| 30 | 3300026023 | Ga0207677_10004129 | Ga0207677_100041294 | 135 |
| 31 | 3300026023 | Ga0207677_10978871 | Ga0207677_109788711 | 135 |
| 32 | 3300026088 | Ga0207641_10463797 | Ga0207641_104637972 | 135 |
| 33 | 3300026095 | Ga0207676_10000477 | Ga0207676_1000047717 | 135 |
| 34 | 3300026142 | Ga0207698_12757481 | Ga0207698_127574811 | 135 |
| 35 | 3300035117 | Ga0373953_0017513 | Ga0373953_0017513_2093_2500 | 135 |
| 36 | 3300035119 | Ga0373956_0003761 | Ga0373956_0003761_475_882 | 135 |
| 37 | 3300035172 | Ga0373955_0004972 | Ga0373955_0004972_2410_2817 | 135 |
| 38 | 3300035724 | Ga0373933_0000681 | Ga0373933_0000681_13697_14104 | 135 |
| 39 | 3300036401 | Ga0373937_0001140 | Ga0373937_0001140_8826_9233 | 135 |
| 40 | 3300041459 | Ga0451800_1471335 | Ga0451800_1471335_356_763 | 135 |
| 41 | 3300041507 | Ga0451851_1051196 | Ga0451851_1051196_210_617 | 135 |
| 42 | 3300042122 | Ga0450920_025407 | Ga0450920_025407_452_859 | 135 |
| 43 | 3300045051 | Ga0451576_0039574 | Ga0451576_0039574_883_1290 | 135 |
| 44 | 3300045051 | Ga0451576_2750096 | Ga0451576_2750096_53_460 | 135 |
| 45 | 3300046454 | Ga0495592_0595700 | Ga0495592_0595700_198_605 | 135 |
| 46 | 3300046462 | Ga0495651_0000233 | Ga0495651_0000233_14373_14780 | 135 |
| 47 | 3300046511 | Ga0495608_0351980 | Ga0495608_0351980_295_702 | 135 |
| 48 | 3300046616 | Ga0495668_0068317 | Ga0495668_0068317_54_464 | 135 |
| 49 | 3300046675 | Ga0495657_0018536 | Ga0495657_0018536_1227_1634 | 135 |
| 50 | 3300046675 | Ga0495657_0708793 | Ga0495657_0708793_153_560 | 135 |
| 51 | 3300046683 | Ga0495658_0655358 | Ga0495658_0655358_35_442 | 135 |
| 52 | 3300047315 | Ga0495581_0339041 | Ga0495581_0339041_44_451 | 135 |
| 53 | 3300048905 | Ga0496102_1068836 | Ga0496102_1068836_257_664 | 135 |
| 54 | 3300048908 | Ga0496105_1061608 | Ga0496105_1061608_166_573 | 135 |
| 55 | 3300050508 | nmdc:mga09592_49017_c1 | nmdc:mga09592_49017_c1_1518_1925 | 135 |
| 56 | 3300050510 | nmdc:mga06r32_50923_c1 | nmdc:mga06r32_50923_c1_1850_2257 | 135 |
| 57 | 3300050514 | nmdc:mga08x19_467722_c1 | nmdc:mga08x19_467722_c1_51_458 | 135 |
| 58 | 3300053077 | Ga0495601_0482588 | Ga0495601_0482588_68_475 | 135 |
| 59 | 3300005842 | Ga0068858_100188726 | Ga0068858_1001887262 | 137 |
| 60 | 3300025914 | Ga0207671_10015543 | Ga0207671_100155433 | 137 |
| 61 | 3300026035 | Ga0207703_10024011 | Ga0207703_100240113 | 137 |
| 62 | 3300045051 | Ga0451576_1462928 | Ga0451576_1462928_45_458 | 137 |
| 63 | 3300020070 | Ga0206356_10945099 | Ga0206356_109450992 | 138 |
| 64 | 3300014325 | Ga0163163_10059713 | Ga0163163_100597134 | 139 |
| 65 | 3300025918 | Ga0207662_11145059 | Ga0207662_111450591 | 139 |
| 66 | 3300005457 | Ga0070662_100003095 | Ga0070662_1000030952 | 148 |
| 67 | 3300031251 | Ga0265327_10044582 | Ga0265327_100445824 | 149 |
| 68 | 3300005459 | Ga0068867_100121635 | Ga0068867_1001216352 | 150 |
| 69 | 3300005543 | Ga0070672_100238324 | Ga0070672_1002383242 | 150 |
| 70 | 3300005842 | Ga0068858_101764903 | Ga0068858_1017649032 | 150 |
| 71 | 3300006237 | Ga0097621_101254597 | Ga0097621_1012545971 | 150 |
| 72 | 3300009176 | Ga0105242_10270392 | Ga0105242_102703923 | 150 |
| 73 | 3300009177 | Ga0105248_11112521 | Ga0105248_111125212 | 150 |
| 74 | 3300009545 | Ga0105237_10024786 | Ga0105237_100247865 | 150 |
| 75 | 3300025934 | Ga0207686_10465261 | Ga0207686_104652612 | 150 |
| 76 | 3300025938 | Ga0207704_10009678 | Ga0207704_100096783 | 150 |
| 77 | 3300025940 | Ga0207691_10002306 | Ga0207691_1000230613 | 150 |
| 78 | 3300026089 | Ga0207648_10002215 | Ga0207648_1000221511 | 150 |
| 79 | 3300027364 | Ga0209967_1002423 | Ga0209967_10024232 | 150 |
| 80 | 3300027395 | Ga0209996_1021378 | Ga0209996_10213781 | 150 |
| 81 | 3300027552 | Ga0209982_1004202 | Ga0209982_10042022 | 150 |
| 82 | 3300027617 | Ga0210002_1001414 | Ga0210002_10014143 | 150 |
| 83 | 3300027665 | Ga0209983_1001769 | Ga0209983_10017694 | 150 |
| 84 | 3300027876 | Ga0209974_10000198 | Ga0209974_1000019818 | 150 |
| 85 | 3300005347 | Ga0070668_101368395 | Ga0070668_1013683951 | 151 |
| 86 | 3300005356 | Ga0070674_100723654 | Ga0070674_1007236542 | 151 |
| 87 | 3300005441 | Ga0070700_100070752 | Ga0070700_1000707523 | 151 |
| 88 | 3300005577 | Ga0068857_101513225 | Ga0068857_1015132252 | 151 |
| 89 | 3300005840 | Ga0068870_10079961 | Ga0068870_100799612 | 151 |
| 90 | 3300005844 | Ga0068862_100006119 | Ga0068862_1000061196 | 151 |
| 91 | 3300009094 | Ga0111539_10146460 | Ga0111539_101464602 | 151 |
| 92 | 3300014325 | Ga0163163_10000050 | Ga0163163_1000005071 | 151 |
| 93 | 3300025907 | Ga0207645_10001571 | Ga0207645_1000157115 | 151 |
| 94 | 3300025908 | Ga0207643_10001503 | Ga0207643_100015038 | 151 |
| 95 | 3300025933 | Ga0207706_10001026 | Ga0207706_1000102611 | 151 |
| 96 | 3300025972 | Ga0207668_10226387 | Ga0207668_102263872 | 151 |
| 97 | 3300026075 | Ga0207708_10013179 | Ga0207708_100131792 | 151 |
| 98 | 3300026118 | Ga0207675_100001295 | Ga0207675_10000129513 | 151 |
| 99 | 3300027614 | Ga0209970_1031468 | Ga0209970_10314682 | 151 |
| 100 | 3300027682 | Ga0209971_1029220 | Ga0209971_10292202 | 151 |
| 101 | 3300009174 | Ga0105241_10672970 | Ga0105241_106729702 | 152 |
| 102 | 3300005333 | Ga0070677_10148953 | Ga0070677_101489531 | 153 |
| 103 | 3300005339 | Ga0070660_100098778 | Ga0070660_1000987781 | 153 |
| 104 | 3300006847 | Ga0075431_100170808 | Ga0075431_1001708082 | 153 |
| 105 | 3300009176 | Ga0105242_11362354 | Ga0105242_113623542 | 153 |
| 106 | 3300014326 | Ga0157380_10133301 | Ga0157380_101333012 | 153 |
| 107 | 3300025912 | Ga0207707_10493287 | Ga0207707_104932872 | 153 |
| 108 | 3300025919 | Ga0207657_10104810 | Ga0207657_101048101 | 153 |
| 109 | 3300044842 | Ga0466957_0103713 | Ga0466957_0103713_1048_1533 | 153 |
| 110 | 3300050508 | nmdc:mga09592_249999_c1 | nmdc:mga09592_249999_c1_782_1261 | 153 |
| 111 | 3300050511 | nmdc:mga08y16_68959_c1 | nmdc:mga08y16_68959_c1_3042_3521 | 153 |
| 112 | 3300005347 | Ga0070668_101209663 | Ga0070668_1012096631 | 154 |
| 113 | 3300005617 | Ga0068859_100680482 | Ga0068859_1006804822 | 154 |
| 114 | 3300005719 | Ga0068861_101000282 | Ga0068861_1010002821 | 154 |
| 115 | 3300005983 | Ga0081540_1000537 | Ga0081540_100053727 | 154 |
| 116 | 3300006931 | Ga0097620_100680498 | Ga0097620_1006804982 | 154 |
| 117 | 3300013307 | Ga0157372_10026832 | Ga0157372_100268324 | 154 |
| 118 | 3300025949 | Ga0207667_10753764 | Ga0207667_107537642 | 154 |
| 119 | 3300026035 | Ga0207703_10690034 | Ga0207703_106900342 | 154 |
| 120 | 3300044673 | Ga0453683_0282765 | Ga0453683_0282765_109_588 | 154 |
| 121 | 3300046526 | Ga0495666_0156918 | Ga0495666_0156918_100_567 | 154 |
| 122 | 3300046537 | Ga0495598_0102171 | Ga0495598_0102171_75_554 | 154 |
| 123 | 3300053139 | Ga0500568_0075074 | Ga0500568_0075074_698_1162 | 154 |
| 124 | 3300053153 | Ga0500616_0001180 | Ga0500616_0001180_4970_5434 | 154 |
| 125 | 3300049571 | Ga0501034_0385268 | Ga0501034_0385268_429_896 | 155 |
| 126 | 3300049573 | Ga0501037_0016223 | Ga0501037_0016223_285_752 | 155 |
| 127 | 3300049579 | Ga0501043_0069605 | Ga0501043_0069605_1685_2152 | 155 |
| 128 | 3300049822 | Ga0501035_0376428 | Ga0501035_0376428_278_745 | 155 |
| 129 | 3300049823 | Ga0501044_0716746 | Ga0501044_0716746_368_835 | 155 |
| 130 | 3300027543 | Ga0209999_1027666 | Ga0209999_10276662 | 156 |
| 131 | 3300005471 | Ga0070698_100363228 | Ga0070698_1003632282 | 157 |
| 132 | 3300042876 | Ga0451577_0157597 | Ga0451577_0157597_484_972 | 157 |
| 133 | 3300045051 | Ga0451576_0809823 | Ga0451576_0809823_313_786 | 157 |
| 134 | 3300005445 | Ga0070708_100272596 | Ga0070708_1002725961 | 158 |
| 135 | 3300031251 | Ga0265327_10004951 | Ga0265327_100049514 | 158 |
| 136 | 3300042436 | Ga0439435_0116551 | Ga0439435_0116551_225_701 | 158 |
| 137 | 3300005293 | Ga0065715_10248901 | Ga0065715_102489011 | 159 |
| 138 | 3300005328 | Ga0070676_10019404 | Ga0070676_100194044 | 159 |
| 139 | 3300005329 | Ga0070683_100017284 | Ga0070683_1000172842 | 159 |
| 140 | 3300005330 | Ga0070690_100012594 | Ga0070690_1000125943 | 159 |
| 141 | 3300005331 | Ga0070670_101485088 | Ga0070670_1014850881 | 159 |
| 142 | 3300005333 | Ga0070677_10153398 | Ga0070677_101533982 | 159 |
| 143 | 3300005338 | Ga0068868_100035090 | Ga0068868_1000350901 | 159 |
| 144 | 3300005338 | Ga0068868_100177435 | Ga0068868_1001774353 | 159 |
| 145 | 3300005339 | Ga0070660_100101881 | Ga0070660_1001018812 | 159 |
| 146 | 3300005343 | Ga0070687_100241888 | Ga0070687_1002418882 | 159 |
| 147 | 3300005344 | Ga0070661_100171706 | Ga0070661_1001717062 | 159 |
| 148 | 3300005355 | Ga0070671_100497861 | Ga0070671_1004978613 | 159 |
| 149 | 3300005364 | Ga0070673_100962481 | Ga0070673_1009624811 | 159 |
| 150 | 3300005366 | Ga0070659_100183036 | Ga0070659_1001830362 | 159 |
| 151 | 3300005367 | Ga0070667_100043617 | Ga0070667_1000436176 | 159 |
| 152 | 3300005445 | Ga0070708_100608583 | Ga0070708_1006085832 | 159 |
| 153 | 3300005455 | Ga0070663_100475277 | Ga0070663_1004752772 | 159 |
| 154 | 3300005455 | Ga0070663_101269802 | Ga0070663_1012698021 | 159 |
| 155 | 3300005457 | Ga0070662_100344245 | Ga0070662_1003442452 | 159 |
| 156 | 3300005459 | Ga0068867_100003457 | Ga0068867_10000345711 | 159 |
| 157 | 3300005459 | Ga0068867_100031637 | Ga0068867_1000316373 | 159 |
| 158 | 3300005466 | Ga0070685_10059573 | Ga0070685_100595732 | 159 |
| 159 | 3300005539 | Ga0068853_100334936 | Ga0068853_1003349363 | 159 |
| 160 | 3300005543 | Ga0070672_100694634 | Ga0070672_1006946342 | 159 |
| 161 | 3300005547 | Ga0070693_100137052 | Ga0070693_1001370522 | 159 |
| 162 | 3300005564 | Ga0070664_100042572 | Ga0070664_1000425723 | 159 |
| 163 | 3300005564 | Ga0070664_100249946 | Ga0070664_1002499462 | 159 |
| 164 | 3300005578 | Ga0068854_100074986 | Ga0068854_1000749862 | 159 |
| 165 | 3300005578 | Ga0068854_100209768 | Ga0068854_1002097682 | 159 |
| 166 | 3300005617 | Ga0068859_100860980 | Ga0068859_1008609802 | 159 |
| 167 | 3300005719 | Ga0068861_100259554 | Ga0068861_1002595542 | 159 |
| 168 | 3300005719 | Ga0068861_101447502 | Ga0068861_1014475021 | 159 |
| 169 | 3300005834 | Ga0068851_10240381 | Ga0068851_102403812 | 159 |
| 170 | 3300005840 | Ga0068870_10264028 | Ga0068870_102640282 | 159 |
| 171 | 3300005844 | Ga0068862_101320692 | Ga0068862_1013206922 | 159 |
| 172 | 3300006038 | Ga0075365_10140939 | Ga0075365_101409393 | 159 |
| 173 | 3300006163 | Ga0070715_10097659 | Ga0070715_100976594 | 159 |
| 174 | 3300006237 | Ga0097621_100562255 | Ga0097621_1005622552 | 159 |
| 175 | 3300006353 | Ga0075370_10384471 | Ga0075370_103844712 | 159 |
| 176 | 3300006358 | Ga0068871_100105173 | Ga0068871_1001051734 | 159 |
| 177 | 3300006358 | Ga0068871_100198731 | Ga0068871_1001987312 | 159 |
| 178 | 3300006844 | Ga0075428_100013669 | Ga0075428_1000136696 | 159 |
| 179 | 3300006844 | Ga0075428_100839048 | Ga0075428_1008390482 | 159 |
| 180 | 3300006914 | Ga0075436_100434958 | Ga0075436_1004349582 | 159 |
| 181 | 3300006931 | Ga0097620_100860949 | Ga0097620_1008609492 | 159 |
| 182 | 3300009094 | Ga0111539_10763722 | Ga0111539_107637222 | 159 |
| 183 | 3300009094 | Ga0111539_10963838 | Ga0111539_109638381 | 159 |
| 184 | 3300009098 | Ga0105245_10729976 | Ga0105245_107299761 | 159 |
| 185 | 3300009148 | Ga0105243_10555982 | Ga0105243_105559821 | 159 |
| 186 | 3300009176 | Ga0105242_10172944 | Ga0105242_101729443 | 159 |
| 187 | 3300009177 | Ga0105248_10066741 | Ga0105248_100667413 | 159 |
| 188 | 3300009551 | Ga0105238_10997087 | Ga0105238_109970871 | 159 |
| 189 | 3300009553 | Ga0105249_10284691 | Ga0105249_102846912 | 159 |
| 190 | 3300011119 | Ga0105246_10122595 | Ga0105246_101225951 | 159 |
| 191 | 3300013102 | Ga0157371_10023683 | Ga0157371_100236833 | 159 |
| 192 | 3300013104 | Ga0157370_10065301 | Ga0157370_100653012 | 159 |
| 193 | 3300013105 | Ga0157369_10277331 | Ga0157369_102773314 | 159 |
| 194 | 3300013296 | Ga0157374_10000047 | Ga0157374_1000004765 | 159 |
| 195 | 3300013296 | Ga0157374_10573058 | Ga0157374_105730582 | 159 |
| 196 | 3300013296 | Ga0157374_10827775 | Ga0157374_108277752 | 159 |
| 197 | 3300013297 | Ga0157378_10016554 | Ga0157378_100165544 | 159 |
| 198 | 3300013297 | Ga0157378_10019007 | Ga0157378_100190076 | 159 |
| 199 | 3300013297 | Ga0157378_10209960 | Ga0157378_102099603 | 159 |
| 200 | 3300013306 | Ga0163162_10004763 | Ga0163162_1000476312 | 159 |
| 201 | 3300013308 | Ga0157375_10038062 | Ga0157375_100380624 | 159 |
| 202 | 3300013308 | Ga0157375_10112340 | Ga0157375_101123401 | 159 |
| 203 | 3300013308 | Ga0157375_10991353 | Ga0157375_109913531 | 159 |
| 204 | 3300014326 | Ga0157380_10086184 | Ga0157380_100861843 | 159 |
| 205 | 3300014745 | Ga0157377_10253138 | Ga0157377_102531382 | 159 |
| 206 | 3300014968 | Ga0157379_10046693 | Ga0157379_100466932 | 159 |
| 207 | 3300014968 | Ga0157379_11283202 | Ga0157379_112832021 | 159 |
| 208 | 3300014969 | Ga0157376_10001129 | Ga0157376_100011297 | 159 |
| 209 | 3300017792 | Ga0163161_10494810 | Ga0163161_104948101 | 159 |
| 210 | 3300025321 | Ga0207656_10071010 | Ga0207656_100710101 | 159 |
| 211 | 3300025893 | Ga0207682_10043802 | Ga0207682_100438023 | 159 |
| 212 | 3300025903 | Ga0207680_10063440 | Ga0207680_100634403 | 159 |
| 213 | 3300025907 | Ga0207645_10004816 | Ga0207645_100048169 | 159 |
| 214 | 3300025907 | Ga0207645_10389498 | Ga0207645_103894981 | 159 |
| 215 | 3300025915 | Ga0207693_10276020 | Ga0207693_102760202 | 159 |
| 216 | 3300025918 | Ga0207662_10226869 | Ga0207662_102268692 | 159 |
| 217 | 3300025919 | Ga0207657_10097598 | Ga0207657_100975983 | 159 |
| 218 | 3300025920 | Ga0207649_10166596 | Ga0207649_101665962 | 159 |
| 219 | 3300025925 | Ga0207650_10149227 | Ga0207650_101492272 | 159 |
| 220 | 3300025931 | Ga0207644_10042958 | Ga0207644_100429583 | 159 |
| 221 | 3300025931 | Ga0207644_10257064 | Ga0207644_102570643 | 159 |
| 222 | 3300025933 | Ga0207706_10790919 | Ga0207706_107909191 | 159 |
| 223 | 3300025934 | Ga0207686_11062208 | Ga0207686_110622081 | 159 |
| 224 | 3300025940 | Ga0207691_10872222 | Ga0207691_108722221 | 159 |
| 225 | 3300025944 | Ga0207661_10616600 | Ga0207661_106166002 | 159 |
| 226 | 3300025945 | Ga0207679_10321444 | Ga0207679_103214442 | 159 |
| 227 | 3300025945 | Ga0207679_11864427 | Ga0207679_118644271 | 159 |
| 228 | 3300025972 | Ga0207668_10675584 | Ga0207668_106755842 | 159 |
| 229 | 3300025981 | Ga0207640_10206999 | Ga0207640_102069992 | 159 |
| 230 | 3300026041 | Ga0207639_10519146 | Ga0207639_105191463 | 159 |
| 231 | 3300026067 | Ga0207678_10269252 | Ga0207678_102692523 | 159 |
| 232 | 3300026067 | Ga0207678_10378487 | Ga0207678_103784871 | 159 |
| 233 | 3300026067 | Ga0207678_11253933 | Ga0207678_112539331 | 159 |
| 234 | 3300026088 | Ga0207641_10249391 | Ga0207641_102493912 | 159 |
| 235 | 3300026089 | Ga0207648_10004747 | Ga0207648_1000474717 | 159 |
| 236 | 3300026142 | Ga0207698_10084727 | Ga0207698_100847272 | 159 |
| 237 | 3300026142 | Ga0207698_10090808 | Ga0207698_100908085 | 159 |
| 238 | 3300028380 | Ga0268265_11314209 | Ga0268265_113142091 | 159 |
| 239 | 3300035089 | Ga0373944_0101410 | Ga0373944_0101410_461_940 | 159 |
| 240 | 3300035118 | Ga0373954_0044194 | Ga0373954_0044194_1123_1602 | 159 |
| 241 | 3300035120 | Ga0373957_0150031 | Ga0373957_0150031_272_751 | 159 |
| 242 | 3300035170 | Ga0373943_0033437 | Ga0373943_0033437_1364_1843 | 159 |
| 243 | 3300035170 | Ga0373943_0054388 | Ga0373943_0054388_68_547 | 159 |
| 244 | 3300035172 | Ga0373955_0234499 | Ga0373955_0234499_150_629 | 159 |
| 245 | 3300035692 | Ga0373935_0050516 | Ga0373935_0050516_521_1000 | 159 |
| 246 | 3300035695 | Ga0373927_0022505 | Ga0373927_0022505_2119_2598 | 159 |
| 247 | 3300035724 | Ga0373933_0461589 | Ga0373933_0461589_249_728 | 159 |
| 248 | 3300035724 | Ga0373933_0833976 | Ga0373933_0833976_86_565 | 159 |
| 249 | 3300035725 | Ga0373947_0036466 | Ga0373947_0036466_666_1145 | 159 |
| 250 | 3300035725 | Ga0373947_0247871 | Ga0373947_0247871_287_766 | 159 |
| 251 | 3300036401 | Ga0373937_0021634 | Ga0373937_0021634_5193_5672 | 159 |
| 252 | 3300037068 | Ga0373925_0029136 | Ga0373925_0029136_525_1004 | 159 |
| 253 | 3300037068 | Ga0373925_0180459 | Ga0373925_0180459_857_1336 | 159 |
| 254 | 3300041459 | Ga0451800_1686787 | Ga0451800_1686787_38_517 | 159 |
| 255 | 3300042125 | Ga0450923_016997 | Ga0450923_016997_753_1232 | 159 |
| 256 | 3300042134 | Ga0450898_035914 | Ga0450898_035914_154_633 | 159 |
| 257 | 3300045976 | Ga0466967_0060636 | Ga0466967_0060636_1303_1782 | 159 |
| 258 | 3300046459 | Ga0495629_0121147 | Ga0495629_0121147_872_1351 | 159 |
| 259 | 3300046463 | Ga0495653_0058070 | Ga0495653_0058070_1462_1941 | 159 |
| 260 | 3300046472 | Ga0495580_0284614 | Ga0495580_0284614_519_998 | 159 |
| 261 | 3300046473 | Ga0495582_0014163 | Ga0495582_0014163_2855_3334 | 159 |
| 262 | 3300046475 | Ga0495639_0004728 | Ga0495639_0004728_4867_5346 | 159 |
| 263 | 3300046475 | Ga0495639_0139272 | Ga0495639_0139272_575_1054 | 159 |
| 264 | 3300046526 | Ga0495666_0082407 | Ga0495666_0082407_821_1300 | 159 |
| 265 | 3300046531 | Ga0495665_0083227 | Ga0495665_0083227_736_1215 | 159 |
| 266 | 3300046559 | Ga0495667_0360168 | Ga0495667_0360168_61_540 | 159 |
| 267 | 3300046663 | Ga0495635_0028927 | Ga0495635_0028927_2653_3132 | 159 |
| 268 | 3300046663 | Ga0495635_0434733 | Ga0495635_0434733_115_594 | 159 |
| 269 | 3300046681 | Ga0495647_0014033 | Ga0495647_0014033_81_560 | 159 |
| 270 | 3300046681 | Ga0495647_0105691 | Ga0495647_0105691_178_657 | 159 |
| 271 | 3300046683 | Ga0495658_0005367 | Ga0495658_0005367_546_1025 | 159 |
| 272 | 3300046689 | Ga0495613_0039367 | Ga0495613_0039367_1042_1521 | 159 |
| 273 | 3300046809 | Ga0495600_0007944 | Ga0495600_0007944_4398_4877 | 159 |
| 274 | 3300046809 | Ga0495600_0482420 | Ga0495600_0482420_42_521 | 159 |
| 275 | 3300047315 | Ga0495581_0019333 | Ga0495581_0019333_957_1436 | 159 |
| 276 | 3300047322 | Ga0495680_0225283 | Ga0495680_0225283_597_1076 | 159 |
| 277 | 3300047471 | Ga0495684_0063014 | Ga0495684_0063014_2329_2808 | 159 |
| 278 | 3300048903 | Ga0496100_0217104 | Ga0496100_0217104_385_864 | 159 |
| 279 | 3300048906 | Ga0496103_0408593 | Ga0496103_0408593_379_858 | 159 |
| 280 | 3300048907 | Ga0496104_0083359 | Ga0496104_0083359_2135_2614 | 159 |
| 281 | 3300048907 | Ga0496104_0242617 | Ga0496104_0242617_366_845 | 159 |
| 282 | 3300048908 | Ga0496105_0010875 | Ga0496105_0010875_1562_2041 | 159 |
| 283 | 3300048908 | Ga0496105_0168051 | Ga0496105_0168051_111_590 | 159 |
| 284 | 3300048910 | Ga0496107_0058045 | Ga0496107_0058045_981_1460 | 159 |
| 285 | 3300048910 | Ga0496107_0394051 | Ga0496107_0394051_228_707 | 159 |
| 286 | 3300048911 | Ga0496108_0022736 | Ga0496108_0022736_2663_3142 | 159 |
| 287 | 3300048912 | Ga0496109_0120079 | Ga0496109_0120079_1847_2326 | 159 |
| 288 | 3300048913 | Ga0496110_0209096 | Ga0496110_0209096_789_1268 | 159 |
| 289 | 3300048913 | Ga0496110_0706312 | Ga0496110_0706312_324_803 | 159 |
| 290 | 3300048914 | Ga0496111_0597339 | Ga0496111_0597339_223_702 | 159 |
| 291 | 3300048915 | Ga0496112_0089744 | Ga0496112_0089744_1123_1602 | 159 |
| 292 | 3300048917 | Ga0496114_0089418 | Ga0496114_0089418_1952_2431 | 159 |
| 293 | 3300048917 | Ga0496114_0154412 | Ga0496114_0154412_1326_1805 | 159 |
| 294 | 3300048917 | Ga0496114_0540874 | Ga0496114_0540874_371_850 | 159 |
| 295 | 3300048918 | Ga0496115_0029766 | Ga0496115_0029766_2468_2947 | 159 |
| 296 | 3300050492 | nmdc:mga0yw44_127075_c1 | nmdc:mga0yw44_127075_c1_710_1189 | 159 |
| 297 | 3300050493 | nmdc:mga0k408_151596_c1 | nmdc:mga0k408_151596_c1_778_1257 | 159 |
| 298 | 3300050510 | nmdc:mga06r32_166152_c1 | nmdc:mga06r32_166152_c1_296_775 | 159 |
| 299 | 3300050511 | nmdc:mga08y16_329127_c1 | nmdc:mga08y16_329127_c1_378_857 | 159 |
| 300 | 3300053078 | Ga0495612_0317651 | Ga0495612_0317651_62_562 | 159 |
| 301 | 3300053084 | Ga0495595_0050383 | Ga0495595_0050383_1024_1503 | 159 |
| 302 | 3300053085 | Ga0495619_0114469 | Ga0495619_0114469_960_1439 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2imj-assembly2.cif.gz_D | x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. | 0.9768 | 8 | 155 |
| 2imj-assembly2.cif.gz_D | x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. | 0.9391 | 8 | 155 |
| 3ebt-assembly1.cif.gz_A-2 | crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution | 0.8944 | 21 | 129 |
| 1cqs-assembly1.cif.gz_B | crystal structure of d103e mutant with equilenineof ksi in pseudomonas putida | 0.8778 | 16 | 129 |
| 1w00-assembly1.cif.gz_B | crystal structure of mutant enzyme d103l of ketosteroid isomerase from pseudomonas putida biotype b | 0.8723 | 16 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2imjD01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9947 | 15 | 155 | 3.10.450.50 |
| 2imjD01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9806 | 15 | 155 | 3.10.450.50 |
| af_A0A1D8PD11_9_180_2.40.160.20 | Mainly Beta;Beta Barrel;Porin; | 0.8898 | 87 | 117 | 2.40.160.20 |
| 3ebtA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.877 | 19 | 129 | 3.10.450.50 |
| 4xdvE00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8709 | 21 | 129 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P4V4M4-F1-model_v4 | COGs COG3558 | 1 | 63 | 155 |
|
| AF-A0A3C0NIB0-F1-model_v4 | DUF1348 domain-containing protein | 0.9992 | 21 | 141 |
|
| AF-A0A1H7CD02-F1-model_v4 | DUF1348 domain-containing protein | 0.9991 | 63 | 159 |
|
| AF-A0A512HQ28-F1-model_v4 | 50S ribosomal protein L21 | 0.9991 | 58 | 159 |
|
| AF-J8V0J8-F1-model_v4 | deleted | 0.998 | 71 | 159 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar