F396404

General Info

Members Datasets Scaffolds Average Seq Length
302 164 604 151

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10019572|Ga0081538_100195724
Length 169
Sequence VPSCFPGLRKELLSGLGCVSRSKRERSRQAVREAVSRAGGLEQAAVSPRGRPHDPFTSELRRRDVLPLLVLHLIGEGPSYGNQLMEGIAGMTEGVLSVNPNTMYPLLRRLEEQGWIEGRWEHPERRTRRYYSLTGDGRAEYERLLEEVRPFLDSVKASIEEIVREVYGR

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
92 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
93 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
94 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
97 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
105 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
106 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 0.99
Rhizosphere 97.35
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10019572 3300005981 Bacteria 5022
2 LJQas_1035010 3300000549 Bacteria 590
3 JGI25407J50210_10056487 3300003373 Unclassified 989
4 JGI25407J50210_10087087 3300003373 Bacteria 774
5 JGI25407J50210_10126969 3300003373 Bacteria 628
6 Ga0070683_100017012 3300005329 Bacteria 6417
7 Ga0070683_100025277 3300005329 Bacteria 5331
8 Ga0070680_100001892 3300005336 Bacteria 15348
9 Ga0070680_100181781 3300005336 Bacteria 1771
10 Ga0070680_101295059 3300005336 Bacteria 631
11 Ga0070682_100017368 3300005337 Bacteria 4194
12 Ga0070660_100022218 3300005339 Bacteria 4688
13 Ga0070660_101083786 3300005339 Unclassified 678
14 Ga0070661_100020802 3300005344 Bacteria 4681
15 Ga0070692_10304138 3300005345 Bacteria 975
16 Ga0070668_100384254 3300005347 Bacteria 1195
17 Ga0070703_10327817 3300005406 Bacteria 647
18 Ga0070714_100346731 3300005435 Bacteria 1394
19 Ga0070705_100634991 3300005440 Bacteria 830
20 Ga0070700_100050003 3300005441 Bacteria 2597
21 Ga0070663_100711861 3300005455 Bacteria 854
22 Ga0070678_101833681 3300005456 Bacteria 572
23 Ga0070662_100101533 3300005457 Bacteria 2177
24 Ga0070681_10006842 3300005458 Bacteria 11099
25 Ga0070681_10101421 3300005458 Bacteria 2824
26 Ga0070679_100005736 3300005530 Bacteria 11513
27 Ga0070679_100046902 3300005530 Bacteria 4308
28 Ga0070684_100006962 3300005535 Bacteria 8784
29 Ga0070684_100014334 3300005535 Bacteria 6417
30 Ga0070684_101104350 3300005535 Bacteria 745
31 Ga0068853_100041658 3300005539 Bacteria 3924
32 Ga0070696_100118309 3300005546 Bacteria 1915
33 Ga0070696_100759348 3300005546 Bacteria 795
34 Ga0070704_100390558 3300005549 Bacteria 1185
35 Ga0068855_100369425 3300005563 Bacteria 1577
36 Ga0068855_101080565 3300005563 Bacteria 840
37 Ga0070664_100052256 3300005564 Bacteria 3461
38 Ga0070664_101020786 3300005564 Bacteria 778
39 Ga0070664_101439237 3300005564 Bacteria 652
40 Ga0068857_100116095 3300005577 Bacteria 2408
41 Ga0068854_100095772 3300005578 Bacteria 2216
42 Ga0068856_100012859 3300005614 Bacteria 8101
43 Ga0070702_100354421 3300005615 Bacteria 1035
44 Ga0070702_100507874 3300005615 Bacteria 886
45 Ga0068862_100314188 3300005844 Bacteria 1445
46 Ga0081455_10046025 3300005937 Bacteria 3790
47 Ga0081455_10474133 3300005937 Bacteria 848
48 Ga0081538_10000067 3300005981 Bacteria 97828
49 Ga0081538_10000125 3300005981 Bacteria 77932
50 Ga0081538_10001494 3300005981 Bacteria 24006
51 Ga0081538_10004324 3300005981 Bacteria 13131
52 Ga0081538_10004624 3300005981 Bacteria 12632
53 Ga0081538_10005486 3300005981 Bacteria 11389
54 Ga0081538_10014811 3300005981 Bacteria 6078
55 Ga0081538_10044242 3300005981 Bacteria 2781
56 Ga0081538_10055195 3300005981 Unclassified 2341
57 Ga0081538_10061577 3300005981 Bacteria 2147
58 Ga0081540_1067234 3300005983 Bacteria 1675
59 Ga0075365_10118772 3300006038 Bacteria 1822
60 Ga0075364_10604508 3300006051 Bacteria 749
61 Ga0075432_10013101 3300006058 Bacteria 2817
62 Ga0075428_100030464 3300006844 Bacteria 5966
63 Ga0075428_100040755 3300006844 Bacteria 5108
64 Ga0075428_100476020 3300006844 Bacteria 1337
65 Ga0075428_100493379 3300006844 Bacteria 1310
66 Ga0075430_100004485 3300006846 Bacteria 11761
67 Ga0075430_100043940 3300006846 Bacteria 3778
68 Ga0075430_100410602 3300006846 Bacteria 1118
69 Ga0075430_100738302 3300006846 Bacteria 812
70 Ga0075430_100758756 3300006846 Bacteria 799
71 Ga0075431_100029899 3300006847 Bacteria 5609
72 Ga0075431_100070188 3300006847 Bacteria 3614
73 Ga0075433_10118327 3300006852 Bacteria 2351
74 Ga0075434_100571398 3300006871 Bacteria 1150
75 Ga0075429_100036955 3300006880 Bacteria 4250
76 Ga0075429_100039447 3300006880 Bacteria 4110
77 Ga0075429_100467841 3300006880 Bacteria 1104
78 Ga0105240_10098692 3300009093 Bacteria 3556
79 Ga0105240_11717474 3300009093 Bacteria 655
80 Ga0111539_10194046 3300009094 Bacteria 2369
81 Ga0111539_10228337 3300009094 Bacteria 2168
82 Ga0111539_10545584 3300009094 Bacteria 1351
83 Ga0111539_10614326 3300009094 Bacteria 1266
84 Ga0105245_10028327 3300009098 Bacteria 4940
85 Ga0114129_10002439 3300009147 Bacteria 25811
86 Ga0114129_10161892 3300009147 Bacteria 3056
87 Ga0114129_10317093 3300009147 Bacteria 2073
88 Ga0114129_10502536 3300009147 Bacteria 1583
89 Ga0114129_10846174 3300009147 Bacteria 1163
90 Ga0114129_11071297 3300009147 Bacteria 1011
91 Ga0114129_11146382 3300009147 Unclassified 971
92 Ga0114129_11661672 3300009147 Bacteria 780
93 Ga0105243_11692758 3300009148 Bacteria 661
94 Ga0105237_10009224 3300009545 Bacteria 10588
95 Ga0105238_10022728 3300009551 Bacteria 6391
96 Ga0105249_10025729 3300009553 Bacteria 5300
97 Ga0105239_10073244 3300010375 Bacteria 3766
98 Ga0105239_10119434 3300010375 Bacteria 2926
99 Ga0157372_10090365 3300013307 Bacteria 3481
100 Ga0157372_10382565 3300013307 Bacteria 1640
101 Ga0157372_11107811 3300013307 Bacteria 916
102 Ga0157380_11973188 3300014326 Bacteria 645
103 Ga0206354_11583843 3300020081 Bacteria 1784
104 Ga0206353_10964208 3300020082 Bacteria 4788
105 Ga0207688_10236217 3300025901 Bacteria 1104
106 Ga0207645_10105274 3300025907 Bacteria 1823
107 Ga0207705_10458241 3300025909 Bacteria 989
108 Ga0207707_10091717 3300025912 Bacteria 2655
109 Ga0207707_10133000 3300025912 Bacteria 2175
110 Ga0207695_10338391 3300025913 Bacteria 1393
111 Ga0207671_10128272 3300025914 Bacteria 1945
112 Ga0207660_10589735 3300025917 Bacteria 905
113 Ga0207657_10017299 3300025919 Bacteria 6918
114 Ga0207657_10680864 3300025919 Bacteria 800
115 Ga0207649_10015042 3300025920 Bacteria 4346
116 Ga0207652_10043952 3300025921 Bacteria 3805
117 Ga0207652_10163806 3300025921 Bacteria 1993
118 Ga0207694_10175825 3300025924 Bacteria 1735
119 Ga0207690_10005394 3300025932 Bacteria 7534
120 Ga0207706_10020697 3300025933 Bacteria 5911
121 Ga0207661_10001343 3300025944 Bacteria 16509
122 Ga0207661_10010165 3300025944 Bacteria 6765
123 Ga0207679_10150519 3300025945 Bacteria 1893
124 Ga0207679_10816077 3300025945 Bacteria 851
125 Ga0207679_11305920 3300025945 Bacteria 666
126 Ga0207667_10331120 3300025949 Bacteria 1555
127 Ga0207712_10058738 3300025961 Bacteria 2719
128 Ga0207640_10568118 3300025981 Bacteria 955
129 Ga0207678_10495393 3300026067 Bacteria 1065
130 Ga0207708_10082141 3300026075 Bacteria 2477
131 Ga0207674_10264282 3300026116 Bacteria 1668
132 Ga0207675_100049621 3300026118 Bacteria 3916
133 Ga0207698_10295735 3300026142 Bacteria 1505
134 Ga0207428_10313346 3300027907 Bacteria 1160
135 Ga0307408_100384455 3300031548 Bacteria 1201
136 Ga0307405_10224523 3300031731 Bacteria 1380
137 Ga0307405_10271753 3300031731 Bacteria 1271
138 Ga0307405_10375177 3300031731 Bacteria 1105
139 Ga0307413_10011506 3300031824 Bacteria 4358
140 Ga0307413_10109133 3300031824 Bacteria 1848
141 Ga0307413_10165164 3300031824 Bacteria 1560
142 Ga0307413_10570179 3300031824 Bacteria 921
143 Ga0307413_10844906 3300031824 Bacteria 773
144 Ga0307413_10846294 3300031824 Bacteria 772
145 Ga0307410_10098110 3300031852 Bacteria 2095
146 Ga0307410_10121809 3300031852 Bacteria 1903
147 Ga0307410_10146201 3300031852 Bacteria 1754
148 Ga0307410_10360913 3300031852 Bacteria 1163
149 Ga0307410_10541472 3300031852 Bacteria 963
150 Ga0307406_10006148 3300031901 Bacteria 6603
151 Ga0307406_10088278 3300031901 Bacteria 2080
152 Ga0307406_10125630 3300031901 Bacteria 1791
153 Ga0307406_10219370 3300031901 Bacteria 1412
154 Ga0307406_10257191 3300031901 Bacteria 1319
155 Ga0307406_10661610 3300031901 Bacteria 868
156 Ga0307406_11563837 3300031901 Bacteria 582
157 Ga0307407_10027013 3300031903 Bacteria 3048
158 Ga0307407_10145654 3300031903 Bacteria 1533
159 Ga0307407_10297855 3300031903 Bacteria 1123
160 Ga0307407_10442356 3300031903 Bacteria 942
161 Ga0307407_11047036 3300031903 Bacteria 632
162 Ga0307412_10216252 3300031911 Bacteria 1466
163 Ga0307412_10259819 3300031911 Bacteria 1353
164 Ga0307409_100012111 3300031995 Bacteria 5477
165 Ga0307409_100084561 3300031995 Bacteria 2576
166 Ga0307409_100188802 3300031995 Bacteria 1832
167 Ga0307409_100202410 3300031995 Bacteria 1777
168 Ga0307409_100862516 3300031995 Bacteria 917
169 Ga0307409_102076582 3300031995 Bacteria 598
170 Ga0307416_100055866 3300032002 Bacteria 3182
171 Ga0307416_100130748 3300032002 Bacteria 2259
172 Ga0307416_100260192 3300032002 Bacteria 1695
173 Ga0307416_100321091 3300032002 Bacteria 1550
174 Ga0307416_100540999 3300032002 Bacteria 1236
175 Ga0307414_10243820 3300032004 Bacteria 1489
176 Ga0307414_10993105 3300032004 Bacteria 772
177 Ga0307411_10101172 3300032005 Bacteria 2039
178 Ga0307411_10243464 3300032005 Bacteria 1409
179 Ga0307411_10692768 3300032005 Bacteria 887
180 Ga0307411_10783450 3300032005 Bacteria 838
181 Ga0307415_100014897 3300032126 Bacteria 4588
182 Ga0307415_100020257 3300032126 Bacteria 4058
183 Ga0307415_100068415 3300032126 Bacteria 2485
184 Ga0307415_100429551 3300032126 Bacteria 1136
185 Ga0307415_101273712 3300032126 Bacteria 695
186 Ga0373929_0071335 3300035085 Bacteria 831
187 Ga0373949_0139151 3300035090 Bacteria 694
188 Ga0373939_0065493 3300035114 Bacteria 1169
189 Ga0373941_0040240 3300035115 Bacteria 1440
190 Ga0373960_0044018 3300035121 Bacteria 1302
191 Ga0373961_0069432 3300035241 Bacteria 1087
192 Ga0373962_0273737 3300035242 Bacteria 592
193 Ga0373937_0073100 3300036401 Bacteria 3163
194 Ga0373925_0705096 3300037068 Unclassified 832
195 Ga0395900_0022184 3300037418 Bacteria 6495
196 Ga0395898_0009408 3300037466 Bacteria 10263
197 Ga0395898_0795359 3300037466 Unclassified 886
198 Ga0395905_0017923 3300037471 Bacteria 6726
199 Ga0395905_1316857 3300037471 Bacteria 626
200 Ga0395901_0026958 3300038443 Bacteria 5900
201 Ga0395901_0065272 3300038443 Bacteria 3790
202 Ga0395901_0166071 3300038443 Bacteria 2318
203 Ga0395901_0261062 3300038443 Bacteria 1803
204 Ga0395901_0293715 3300038443 Bacteria 1686
205 Ga0395901_0557976 3300038443 Bacteria 1160
206 Ga0395901_0813621 3300038443 Unclassified 922
207 Ga0395901_0889720 3300038443 Bacteria 873
208 Ga0395901_1376911 3300038443 Bacteria 665
209 Ga0439450_039027 3300042008 Bacteria 1096
210 Ga0439455_0081460 3300042012 Bacteria 880
211 Ga0439459_0207700 3300042438 Bacteria 537
212 Ga0466964_0056733 3300044706 Bacteria 1620
213 Ga0466964_0251711 3300044706 Bacteria 871
214 Ga0466968_0210442 3300044735 Bacteria 913
215 Ga0466967_0042528 3300045976 Bacteria 3927
216 Ga0466967_0095298 3300045976 Bacteria 2712
217 Ga0466967_0189521 3300045976 Bacteria 1943
218 Ga0466967_0818964 3300045976 Bacteria 925
219 Ga0495603_0370421 3300046455 Bacteria 822
220 Ga0495629_0260083 3300046459 Bacteria 1193
221 Ga0495641_0002988 3300046461 Bacteria 12982
222 Ga0495584_0241933 3300046491 Bacteria 918
223 Ga0495596_0150742 3300046500 Bacteria 903
224 Ga0495596_0213959 3300046500 Bacteria 748
225 Ga0495616_0308881 3300046513 Bacteria 666
226 Ga0495620_0190416 3300046515 Bacteria 791
227 Ga0495630_0071743 3300046517 Bacteria 2607
228 Ga0495631_0012039 3300046518 Bacteria 4239
229 Ga0495637_0300428 3300046520 Bacteria 570
230 Ga0495644_0019450 3300046523 Bacteria 2593
231 Ga0495586_0251725 3300046535 Bacteria 1008
232 Ga0495621_0155613 3300046539 Bacteria 901
233 Ga0495656_0438127 3300046615 Bacteria 687
234 Ga0495668_0186314 3300046616 Bacteria 1137
235 Ga0495668_0324816 3300046616 Bacteria 844
236 Ga0495588_0156502 3300046674 Bacteria 1205
237 Ga0495657_0030220 3300046675 Bacteria 3796
238 Ga0495670_0396823 3300046691 Bacteria 745
239 Ga0495671_0320711 3300046692 Bacteria 744
240 Ga0495589_0267302 3300046794 Bacteria 797
241 Ga0495674_1418193 3300047319 Bacteria 517
242 Ga0495680_0365501 3300047322 Unclassified 1002
243 Ga0495673_0005598 3300047469 Bacteria 7560
244 Ga0495686_0000008 3300047472 Bacteria 727479
245 Ga0495686_0022067 3300047472 Bacteria 4216
246 Ga0495686_0111870 3300047472 Bacteria 1636
247 Ga0496109_0662486 3300048912 Bacteria 981
248 Ga0496111_0591906 3300048914 Bacteria 812
249 Ga0496112_0113308 3300048915 Bacteria 2683
250 Ga0501031_0148200 3300049568 Bacteria 1533
251 Ga0501031_1035513 3300049568 Bacteria 524
252 Ga0501036_0162974 3300049572 Bacteria 1880
253 Ga0501036_0185887 3300049572 Bacteria 1749
254 Ga0501039_0239254 3300049575 Bacteria 1427
255 Ga0501040_0090871 3300049576 Bacteria 2122
256 Ga0501040_0661227 3300049576 Bacteria 755
257 Ga0501041_0339670 3300049577 Bacteria 948
258 Ga0501042_0010153 3300049578 Bacteria 6301
259 Ga0501042_0540429 3300049578 Unclassified 847
260 Ga0501048_0042267 3300049582 Bacteria 3264
261 Ga0501048_0343719 3300049582 Bacteria 1064
262 Ga0501067_0287880 3300049583 Bacteria 915
263 Ga0501072_0050462 3300049588 Bacteria 3276
264 Ga0501074_0087827 3300049590 Bacteria 2227
265 Ga0501075_0081174 3300049591 Bacteria 2455
266 Ga0501077_0604262 3300049593 Bacteria 704
267 Ga0501079_1029555 3300049741 Unclassified 649
268 Ga0501079_1277382 3300049741 Bacteria 578
269 Ga0501081_0567977 3300049743 Bacteria 848
270 Ga0501081_1037944 3300049743 Bacteria 620
271 Ga0501271_004540 3300049768 Bacteria 1321
272 nmdc:mga0yw44_1202137_c1 3300050492 Bacteria 511
273 nmdc:mga0yw44_215114_c1 3300050492 Bacteria 1272
274 nmdc:mga05p37_1336064_c1 3300050507 Bacteria 727
275 nmdc:mga05p37_306188_c1 3300050507 Bacteria 1885
276 nmdc:mga05p37_4637_c1 3300050507 Bacteria 16077
277 nmdc:mga05p37_561094_c1 3300050507 Bacteria 1297
278 nmdc:mga05p37_650298_c1 3300050507 Unclassified 1181
279 nmdc:mga05p37_9722_c1 3300050507 Bacteria 11404
280 nmdc:mga09592_66734_c1 3300050508 Bacteria 3050
281 nmdc:mga09592_724645_c1 3300050508 Bacteria 845
282 nmdc:mga0qj67_1285737_c1 3300050509 Bacteria 567
283 nmdc:mga0qj67_2448_c1 3300050509 Bacteria 13215
284 nmdc:mga0qj67_412690_c1 3300050509 Bacteria 1089
285 nmdc:mga0qj67_888144_c1 3300050509 Bacteria 703
286 nmdc:mga06r32_1289395_c1 3300050510 Bacteria 675
287 nmdc:mga06r32_226059_c1 3300050510 Bacteria 1860
288 nmdc:mga06r32_37408_c1 3300050510 Bacteria 4590
289 nmdc:mga08y16_13256_c1 3300050511 Bacteria 8667
290 nmdc:mga08y16_156027_c1 3300050511 Bacteria 2372
291 nmdc:mga08y16_167260_c1 3300050511 Bacteria 2284
292 nmdc:mga08y16_6630_c1 3300050511 Bacteria 12143
293 nmdc:mga0a205_253302_c1 3300050515 Bacteria 1639
294 Ga0495655_0112007 3300053083 Bacteria 821
295 Ga0495619_0094417 3300053085 Bacteria 2029
296 Ga0500628_008722 3300053129 Bacteria 1771
297 Ga0501084_0017435 3300054114 Bacteria 5971
298 Ga0501082_0501241 3300060353 Bacteria 1061
299 Ga0501082_0630835 3300060353 Bacteria 938
300 Ga0530510_0122191 3300061734 Bacteria 1912
301 Ga0530510_0303813 3300061734 Bacteria 1194
302 Ga0530510_0404182 3300061734 Bacteria 1030
303 Ga0081538_10019572
304 LJQas_1035010
305 JGI25407J50210_10056487
306 JGI25407J50210_10087087
307 JGI25407J50210_10126969
308 Ga0070683_100017012
309 Ga0070683_100025277
310 Ga0070680_100001892
311 Ga0070680_100181781
312 Ga0070680_101295059
313 Ga0070682_100017368
314 Ga0070660_100022218
315 Ga0070660_101083786
316 Ga0070661_100020802
317 Ga0070692_10304138
318 Ga0070668_100384254
319 Ga0070703_10327817
320 Ga0070714_100346731
321 Ga0070705_100634991
322 Ga0070700_100050003
323 Ga0070663_100711861
324 Ga0070678_101833681
325 Ga0070662_100101533
326 Ga0070681_10006842
327 Ga0070681_10101421
328 Ga0070679_100005736
329 Ga0070679_100046902
330 Ga0070684_100006962
331 Ga0070684_100014334
332 Ga0070684_101104350
333 Ga0068853_100041658
334 Ga0070696_100118309
335 Ga0070696_100759348
336 Ga0070704_100390558
337 Ga0068855_100369425
338 Ga0068855_101080565
339 Ga0070664_100052256
340 Ga0070664_101020786
341 Ga0070664_101439237
342 Ga0068857_100116095
343 Ga0068854_100095772
344 Ga0068856_100012859
345 Ga0070702_100354421
346 Ga0070702_100507874
347 Ga0068862_100314188
348 Ga0081455_10046025
349 Ga0081455_10474133
350 Ga0081538_10000067
351 Ga0081538_10000125
352 Ga0081538_10001494
353 Ga0081538_10004324
354 Ga0081538_10004624
355 Ga0081538_10005486
356 Ga0081538_10014811
357 Ga0081538_10044242
358 Ga0081538_10055195
359 Ga0081538_10061577
360 Ga0081540_1067234
361 Ga0075365_10118772
362 Ga0075364_10604508
363 Ga0075432_10013101
364 Ga0075428_100030464
365 Ga0075428_100040755
366 Ga0075428_100476020
367 Ga0075428_100493379
368 Ga0075430_100004485
369 Ga0075430_100043940
370 Ga0075430_100410602
371 Ga0075430_100738302
372 Ga0075430_100758756
373 Ga0075431_100029899
374 Ga0075431_100070188
375 Ga0075433_10118327
376 Ga0075434_100571398
377 Ga0075429_100036955
378 Ga0075429_100039447
379 Ga0075429_100467841
380 Ga0105240_10098692
381 Ga0105240_11717474
382 Ga0111539_10194046
383 Ga0111539_10228337
384 Ga0111539_10545584
385 Ga0111539_10614326
386 Ga0105245_10028327
387 Ga0114129_10002439
388 Ga0114129_10161892
389 Ga0114129_10317093
390 Ga0114129_10502536
391 Ga0114129_10846174
392 Ga0114129_11071297
393 Ga0114129_11146382
394 Ga0114129_11661672
395 Ga0105243_11692758
396 Ga0105237_10009224
397 Ga0105238_10022728
398 Ga0105249_10025729
399 Ga0105239_10073244
400 Ga0105239_10119434
401 Ga0157372_10090365
402 Ga0157372_10382565
403 Ga0157372_11107811
404 Ga0157380_11973188
405 Ga0206354_11583843
406 Ga0206353_10964208
407 Ga0207688_10236217
408 Ga0207645_10105274
409 Ga0207705_10458241
410 Ga0207707_10091717
411 Ga0207707_10133000
412 Ga0207695_10338391
413 Ga0207671_10128272
414 Ga0207660_10589735
415 Ga0207657_10017299
416 Ga0207657_10680864
417 Ga0207649_10015042
418 Ga0207652_10043952
419 Ga0207652_10163806
420 Ga0207694_10175825
421 Ga0207690_10005394
422 Ga0207706_10020697
423 Ga0207661_10001343
424 Ga0207661_10010165
425 Ga0207679_10150519
426 Ga0207679_10816077
427 Ga0207679_11305920
428 Ga0207667_10331120
429 Ga0207712_10058738
430 Ga0207640_10568118
431 Ga0207678_10495393
432 Ga0207708_10082141
433 Ga0207674_10264282
434 Ga0207675_100049621
435 Ga0207698_10295735
436 Ga0207428_10313346
437 Ga0307408_100384455
438 Ga0307405_10224523
439 Ga0307405_10271753
440 Ga0307405_10375177
441 Ga0307413_10011506
442 Ga0307413_10109133
443 Ga0307413_10165164
444 Ga0307413_10570179
445 Ga0307413_10844906
446 Ga0307413_10846294
447 Ga0307410_10098110
448 Ga0307410_10121809
449 Ga0307410_10146201
450 Ga0307410_10360913
451 Ga0307410_10541472
452 Ga0307406_10006148
453 Ga0307406_10088278
454 Ga0307406_10125630
455 Ga0307406_10219370
456 Ga0307406_10257191
457 Ga0307406_10661610
458 Ga0307406_11563837
459 Ga0307407_10027013
460 Ga0307407_10145654
461 Ga0307407_10297855
462 Ga0307407_10442356
463 Ga0307407_11047036
464 Ga0307412_10216252
465 Ga0307412_10259819
466 Ga0307409_100012111
467 Ga0307409_100084561
468 Ga0307409_100188802
469 Ga0307409_100202410
470 Ga0307409_100862516
471 Ga0307409_102076582
472 Ga0307416_100055866
473 Ga0307416_100130748
474 Ga0307416_100260192
475 Ga0307416_100321091
476 Ga0307416_100540999
477 Ga0307414_10243820
478 Ga0307414_10993105
479 Ga0307411_10101172
480 Ga0307411_10243464
481 Ga0307411_10692768
482 Ga0307411_10783450
483 Ga0307415_100014897
484 Ga0307415_100020257
485 Ga0307415_100068415
486 Ga0307415_100429551
487 Ga0307415_101273712
488 Ga0373929_0071335
489 Ga0373949_0139151
490 Ga0373939_0065493
491 Ga0373941_0040240
492 Ga0373960_0044018
493 Ga0373961_0069432
494 Ga0373962_0273737
495 Ga0373937_0073100
496 Ga0373925_0705096
497 Ga0395900_0022184
498 Ga0395898_0009408
499 Ga0395898_0795359
500 Ga0395905_0017923
501 Ga0395905_1316857
502 Ga0395901_0026958
503 Ga0395901_0065272
504 Ga0395901_0166071
505 Ga0395901_0261062
506 Ga0395901_0293715
507 Ga0395901_0557976
508 Ga0395901_0813621
509 Ga0395901_0889720
510 Ga0395901_1376911
511 Ga0439450_039027
512 Ga0439455_0081460
513 Ga0439459_0207700
514 Ga0466964_0056733
515 Ga0466964_0251711
516 Ga0466968_0210442
517 Ga0466967_0042528
518 Ga0466967_0095298
519 Ga0466967_0189521
520 Ga0466967_0818964
521 Ga0495603_0370421
522 Ga0495629_0260083
523 Ga0495641_0002988
524 Ga0495584_0241933
525 Ga0495596_0150742
526 Ga0495596_0213959
527 Ga0495616_0308881
528 Ga0495620_0190416
529 Ga0495630_0071743
530 Ga0495631_0012039
531 Ga0495637_0300428
532 Ga0495644_0019450
533 Ga0495586_0251725
534 Ga0495621_0155613
535 Ga0495656_0438127
536 Ga0495668_0186314
537 Ga0495668_0324816
538 Ga0495588_0156502
539 Ga0495657_0030220
540 Ga0495670_0396823
541 Ga0495671_0320711
542 Ga0495589_0267302
543 Ga0495674_1418193
544 Ga0495680_0365501
545 Ga0495673_0005598
546 Ga0495686_0000008
547 Ga0495686_0022067
548 Ga0495686_0111870
549 Ga0496109_0662486
550 Ga0496111_0591906
551 Ga0496112_0113308
552 Ga0501031_0148200
553 Ga0501031_1035513
554 Ga0501036_0162974
555 Ga0501036_0185887
556 Ga0501039_0239254
557 Ga0501040_0090871
558 Ga0501040_0661227
559 Ga0501041_0339670
560 Ga0501042_0010153
561 Ga0501042_0540429
562 Ga0501048_0042267
563 Ga0501048_0343719
564 Ga0501067_0287880
565 Ga0501072_0050462
566 Ga0501074_0087827
567 Ga0501075_0081174
568 Ga0501077_0604262
569 Ga0501079_1029555
570 Ga0501079_1277382
571 Ga0501081_0567977
572 Ga0501081_1037944
573 Ga0501271_004540
574 nmdc:mga0yw44_1202137_c1
575 nmdc:mga0yw44_215114_c1
576 nmdc:mga05p37_1336064_c1
577 nmdc:mga05p37_306188_c1
578 nmdc:mga05p37_4637_c1
579 nmdc:mga05p37_561094_c1
580 nmdc:mga05p37_650298_c1
581 nmdc:mga05p37_9722_c1
582 nmdc:mga09592_66734_c1
583 nmdc:mga09592_724645_c1
584 nmdc:mga0qj67_1285737_c1
585 nmdc:mga0qj67_2448_c1
586 nmdc:mga0qj67_412690_c1
587 nmdc:mga0qj67_888144_c1
588 nmdc:mga06r32_1289395_c1
589 nmdc:mga06r32_226059_c1
590 nmdc:mga06r32_37408_c1
591 nmdc:mga08y16_13256_c1
592 nmdc:mga08y16_156027_c1
593 nmdc:mga08y16_167260_c1
594 nmdc:mga08y16_6630_c1
595 nmdc:mga0a205_253302_c1
596 Ga0495655_0112007
597 Ga0495619_0094417
598 Ga0500628_008722
599 Ga0501084_0017435
600 Ga0501082_0501241
601 Ga0501082_0630835
602 Ga0530510_0122191
603 Ga0530510_0303813
604 Ga0530510_0404182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

70

143

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y8t-assembly2.cif.gz_B crystal structure of bacillus subtilis padr in complex with p-coumaric acid 0.8727 52 129
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.8721 52 132
5x11-assembly4.cif.gz_G crystal structure of bacillus subtilis padr in complex with operator dna 0.872 52 132
5x11-assembly3.cif.gz_C crystal structure of bacillus subtilis padr in complex with operator dna 0.8704 52 132
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8691 48 144
ID Description Score Start End Superfamily
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9197 53 132 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8681 52 132 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8626 53 132 1.10.10.10
1yg2A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8601 53 130 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8552 46 144 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7V9CDE6-F1-model_v4 PadR family transcriptional regulator 0.9455 36 155
AF-A0A166GMP7-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9219 55 129
AF-A0A6I3DT19-F1-model_v4 deleted 0.918 53 132
AF-A0A7V9CDE6-F1-model_v4 PadR family transcriptional regulator 0.9159 36 155
AF-A0A1H6FPL3-F1-model_v4 DNA-binding transcriptional regulator, PadR family 0.9128 49 155 GO:0003677

Map