F396565

General Info

Members Datasets Scaffolds Average Seq Length
302 171 604 281

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10003158|Ga0307511_1000315810
Length 305
Sequence MSKINQHSNDLPNSPFRGRGGKVILAGAGPGDPELLTIKALRYLQKADVVITDRLVSEEILTNYTREDALIISVGKQCSKGASTPQSEINDLLVEHAGRGRLVVRLKGGDASIFSNILDELRTLATHQIPYEIIPGITAALGAAAYAAIPLTARGYSTAVRFLTHYKKDDLNESYWKDLAQTADTLVFYMSSEPLDHLVENLLQYGIGPDKWLAVIEQATTPLQNVYNCPIHEYLSAKRGSHYVSPTLIIIGKVAALHEPFQWLPDSHSKENYFAPVAAQTASPVVTRAAEPTLKKYAYADSAET

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
114 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
115 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
116 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
117 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
158 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
159 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
160 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
161 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
162 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
163 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
164 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
165 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
166 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
167 2738541278 Niastella sp. CF465 Isolate Unclassified
168 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
169 2818991444 Filimonas endophytica 3197 Isolate Unclassified
170 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
171 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0
Isolates 3.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0
Rhizoplane 1.32
Rhizosphere 87.42
Stem 0
Stem Tuber 0
Unclassified 12.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10003158 3300030521 Bacteria 16966
2 rootH1_10130558 3300003316 Bacteria 3808
3 rootH2_10023677 3300003320 Bacteria 21338
4 rootH2_10024559 3300003320 Bacteria 24277
5 rootL2_10001777 3300003322 Bacteria 2960
6 rootL2_10026427 3300003322 Bacteria 1516
7 rootH1_10135911 3300003323 Bacteria 2378
8 Ga0070683_100064753 3300005329 Bacteria 3403
9 Ga0070690_100070278 3300005330 Bacteria 2273
10 Ga0070670_100127041 3300005331 Unclassified 2201
11 Ga0070670_100432711 3300005331 Unclassified 1164
12 Ga0068869_100015905 3300005334 Bacteria 5061
13 Ga0070666_10000028 3300005335 Bacteria 144796
14 Ga0070666_10208428 3300005335 Bacteria 1376
15 Ga0070682_100227892 3300005337 Bacteria 1330
16 Ga0068868_100138774 3300005338 Bacteria 1994
17 Ga0070691_10025621 3300005341 Bacteria 2746
18 Ga0070691_10178365 3300005341 Unclassified 1104
19 Ga0070687_100213971 3300005343 Bacteria 1176
20 Ga0070668_100030592 3300005347 Bacteria 4093
21 Ga0070668_100423463 3300005347 Bacteria 1140
22 Ga0070675_100033881 3300005354 Bacteria 4142
23 Ga0070671_100003437 3300005355 Bacteria 12358
24 Ga0070671_100068616 3300005355 Bacteria 2957
25 Ga0070667_100003232 3300005367 Bacteria 13938
26 Ga0070663_100317281 3300005455 Bacteria 1252
27 Ga0070678_100562024 3300005456 Bacteria 1014
28 Ga0070681_10006598 3300005458 Bacteria 11301
29 Ga0070684_100009827 3300005535 Bacteria 7556
30 Ga0068853_100000730 3300005539 Bacteria 22729
31 Ga0070672_100251432 3300005543 Bacteria 1489
32 Ga0068855_100005983 3300005563 Bacteria 14842
33 Ga0068855_100009148 3300005563 Bacteria 11963
34 Ga0068855_100054386 3300005563 Bacteria 4705
35 Ga0068855_100209679 3300005563 Unclassified 2190
36 Ga0068857_100002029 3300005577 Bacteria 16411
37 Ga0068854_100172097 3300005578 Bacteria 1686
38 Ga0068856_100007851 3300005614 Bacteria 10420
39 Ga0068856_100391115 3300005614 Unclassified 1410
40 Ga0068852_100004018 3300005616 Bacteria 10342
41 Ga0068852_100376083 3300005616 Bacteria 1392
42 Ga0068859_100000012 3300005617 Bacteria 300376
43 Ga0068859_100000859 3300005617 Bacteria 30939
44 Ga0068859_100369673 3300005617 Bacteria 1529
45 Ga0068864_100120558 3300005618 Unclassified 2345
46 Ga0068864_100174541 3300005618 Bacteria 1961
47 Ga0068864_100206131 3300005618 Unclassified 1808
48 Ga0068866_10011380 3300005718 Bacteria 3848
49 Ga0068861_100340361 3300005719 Unclassified 1313
50 Ga0068851_10014960 3300005834 Bacteria 3691
51 Ga0068863_100013238 3300005841 Bacteria 7957
52 Ga0068863_100049303 3300005841 Bacteria 3993
53 Ga0068858_100004166 3300005842 Bacteria 14229
54 Ga0068860_100001749 3300005843 Bacteria 23145
55 Ga0068860_100016656 3300005843 Bacteria 7169
56 Ga0068860_100017849 3300005843 Bacteria 6911
57 Ga0068860_100176268 3300005843 Unclassified 2066
58 Ga0068860_100260695 3300005843 Unclassified 1690
59 Ga0075366_10115300 3300006195 Bacteria 1618
60 Ga0097621_100001267 3300006237 Bacteria 17448
61 Ga0097621_100187613 3300006237 Unclassified 1789
62 Ga0068871_100000704 3300006358 Bacteria 22713
63 Ga0068871_100024075 3300006358 Bacteria 4717
64 Ga0068871_100180386 3300006358 Unclassified 1814
65 Ga0068871_100205690 3300006358 Bacteria 1701
66 Ga0068871_100384245 3300006358 Bacteria 1248
67 Ga0075431_100054608 3300006847 Bacteria 4119
68 Ga0075429_100300076 3300006880 Bacteria 1406
69 Ga0068865_100102640 3300006881 Unclassified 2096
70 Ga0068865_100291413 3300006881 Bacteria 1303
71 Ga0097620_100000012 3300006931 Bacteria 300376
72 Ga0097620_100000859 3300006931 Bacteria 30939
73 Ga0097620_100369702 3300006931 Bacteria 1529
74 Ga0105240_10000023 3300009093 Bacteria 385028
75 Ga0105240_10000893 3300009093 Bacteria 53349
76 Ga0105240_10002999 3300009093 Bacteria 26556
77 Ga0105240_10015470 3300009093 Bacteria 10373
78 Ga0105240_10029275 3300009093 Bacteria 7179
79 Ga0105240_10040332 3300009093 Bacteria 5973
80 Ga0105240_10055938 3300009093 Bacteria 4938
81 Ga0105240_10846748 3300009093 Unclassified 987
82 Ga0114129_10007165 3300009147 Bacteria 15870
83 Ga0114129_10065166 3300009147 Bacteria 5085
84 Ga0105243_10048286 3300009148 Bacteria 3355
85 Ga0105241_10003136 3300009174 Bacteria 12295
86 Ga0105241_10203343 3300009174 Bacteria 1656
87 Ga0105242_10098518 3300009176 Unclassified 2473
88 Ga0105242_10241648 3300009176 Bacteria 1624
89 Ga0105242_10545818 3300009176 Bacteria 1110
90 Ga0105248_10007183 3300009177 Bacteria 12220
91 Ga0105237_10004328 3300009545 Bacteria 16462
92 Ga0105237_10011363 3300009545 Bacteria 9420
93 Ga0105237_10052768 3300009545 Bacteria 4080
94 Ga0105237_10110160 3300009545 Bacteria 2745
95 Ga0105237_10167639 3300009545 Bacteria 2196
96 Ga0105237_10345905 3300009545 Bacteria 1491
97 Ga0105238_10023396 3300009551 Bacteria 6298
98 Ga0105238_10081307 3300009551 Bacteria 3229
99 Ga0105238_10138185 3300009551 Unclassified 2414
100 Ga0105249_10003694 3300009553 Bacteria 13195
101 Ga0105249_10013608 3300009553 Bacteria 7185
102 Ga0105249_10142667 3300009553 Bacteria 2298
103 Ga0105249_10424390 3300009553 Bacteria 1364
104 Ga0105249_10610603 3300009553 Bacteria 1146
105 Ga0105249_10827935 3300009553 Unclassified 990
106 Ga0105249_10848095 3300009553 Bacteria 979
107 Ga0105239_10000128 3300010375 Bacteria 107095
108 Ga0105239_10001010 3300010375 Bacteria 39353
109 Ga0105239_10001102 3300010375 Bacteria 37330
110 Ga0105239_10001887 3300010375 Bacteria 27397
111 Ga0105239_10044383 3300010375 Bacteria 4874
112 Ga0105246_10088633 3300011119 Bacteria 2224
113 Ga0157371_10004659 3300013102 Bacteria 11874
114 Ga0157370_10001091 3300013104 Bacteria 34028
115 Ga0157370_10001225 3300013104 Bacteria 32118
116 Ga0157369_10041623 3300013105 Bacteria 5014
117 Ga0157369_10069725 3300013105 Bacteria 3777
118 Ga0157369_10450972 3300013105 Bacteria 1332
119 Ga0157374_10000002 3300013296 Bacteria 1054226
120 Ga0157374_10228943 3300013296 Bacteria 1825
121 Ga0157378_10013483 3300013297 Bacteria 7148
122 Ga0157378_10191557 3300013297 Unclassified 1929
123 Ga0163162_10000086 3300013306 Bacteria 85949
124 Ga0163162_10000282 3300013306 Bacteria 46472
125 Ga0163162_10002016 3300013306 Bacteria 19121
126 Ga0163162_10003354 3300013306 Bacteria 15318
127 Ga0163162_10006341 3300013306 Bacteria 11455
128 Ga0157372_10000573 3300013307 Bacteria 40317
129 Ga0157372_10018359 3300013307 Bacteria 7518
130 Ga0157372_10055809 3300013307 Bacteria 4412
131 Ga0157372_10721624 3300013307 Bacteria 1159
132 Ga0157372_10905181 3300013307 Bacteria 1023
133 Ga0157375_10000115 3300013308 Bacteria 77964
134 Ga0157375_10250748 3300013308 Bacteria 1931
135 Ga0157375_10331894 3300013308 Bacteria 1686
136 Ga0163163_10001214 3300014325 Bacteria 21788
137 Ga0163163_10024040 3300014325 Bacteria 5796
138 Ga0163163_10121735 3300014325 Bacteria 2643
139 Ga0163163_10891488 3300014325 Unclassified 953
140 Ga0157380_10392421 3300014326 Bacteria 1314
141 Ga0157379_10043589 3300014968 Bacteria 4006
142 Ga0157379_10045506 3300014968 Bacteria 3916
143 Ga0157376_10000467 3300014969 Bacteria 26068
144 Ga0157376_10002716 3300014969 Bacteria 12057
145 Ga0157376_10071506 3300014969 Bacteria 2948
146 Ga0157376_10115792 3300014969 Bacteria 2367
147 Ga0157376_10166846 3300014969 Unclassified 2001
148 Ga0182006_1000001 3300015261 Bacteria 1091090
149 Ga0163161_10005511 3300017792 Bacteria 8771
150 Ga0163161_10171516 3300017792 Bacteria 1659
151 Ga0207642_10222188 3300025899 Bacteria 1056
152 Ga0207680_10000515 3300025903 Bacteria 18445
153 Ga0207680_10194431 3300025903 Bacteria 1379
154 Ga0207647_10074731 3300025904 Bacteria 2041
155 Ga0207654_10003719 3300025911 Bacteria 7701
156 Ga0207654_10065937 3300025911 Bacteria 2134
157 Ga0207695_10000016 3300025913 Bacteria 771991
158 Ga0207695_10000128 3300025913 Bacteria 226098
159 Ga0207695_10006251 3300025913 Bacteria 15507
160 Ga0207695_10019363 3300025913 Bacteria 7838
161 Ga0207695_10088824 3300025913 Bacteria 3110
162 Ga0207695_10347496 3300025913 Unclassified 1371
163 Ga0207695_10557401 3300025913 Unclassified 1027
164 Ga0207671_10031252 3300025914 Bacteria 3967
165 Ga0207671_10092977 3300025914 Bacteria 2274
166 Ga0207671_10105364 3300025914 Bacteria 2139
167 Ga0207671_10229419 3300025914 Bacteria 1456
168 Ga0207694_10010885 3300025924 Bacteria 6869
169 Ga0207694_10197681 3300025924 Unclassified 1635
170 Ga0207659_10020520 3300025926 Bacteria 4369
171 Ga0207644_10008771 3300025931 Bacteria 6621
172 Ga0207644_10095651 3300025931 Unclassified 2222
173 Ga0207686_10152385 3300025934 Bacteria 1611
174 Ga0207704_10046567 3300025938 Bacteria 2586
175 Ga0207691_10069093 3300025940 Bacteria 3191
176 Ga0207711_10176257 3300025941 Unclassified 1942
177 Ga0207689_10006838 3300025942 Bacteria 10030
178 Ga0207689_10010894 3300025942 Bacteria 7819
179 Ga0207689_10129767 3300025942 Unclassified 2074
180 Ga0207661_10059366 3300025944 Bacteria 3082
181 Ga0207667_10000151 3300025949 Bacteria 104054
182 Ga0207667_10000502 3300025949 Bacteria 51671
183 Ga0207667_10018553 3300025949 Bacteria 7798
184 Ga0207667_10019745 3300025949 Bacteria 7512
185 Ga0207667_10088606 3300025949 Bacteria 3200
186 Ga0207667_10119097 3300025949 Unclassified 2721
187 Ga0207651_10046634 3300025960 Bacteria 2916
188 Ga0207712_10059041 3300025961 Bacteria 2713
189 Ga0207712_10217680 3300025961 Bacteria 1525
190 Ga0207668_10200026 3300025972 Bacteria 1590
191 Ga0207640_10123841 3300025981 Unclassified 1857
192 Ga0207658_10062952 3300025986 Bacteria 2778
193 Ga0207677_10261257 3300026023 Bacteria 1411
194 Ga0207703_10031134 3300026035 Bacteria 4216
195 Ga0207639_10003082 3300026041 Bacteria 11200
196 Ga0207639_10048957 3300026041 Bacteria 3202
197 Ga0207639_10356949 3300026041 Unclassified 1307
198 Ga0207702_10143204 3300026078 Bacteria 2166
199 Ga0207641_10011451 3300026088 Bacteria 7281
200 Ga0207641_10026831 3300026088 Bacteria 4756
201 Ga0207641_10192489 3300026088 Unclassified 1875
202 Ga0207641_10618421 3300026088 Unclassified 1062
203 Ga0207648_10255800 3300026089 Bacteria 1562
204 Ga0207648_10449018 3300026089 Bacteria 1174
205 Ga0207676_10050906 3300026095 Bacteria 3232
206 Ga0207676_10121205 3300026095 Unclassified 2206
207 Ga0207676_10207142 3300026095 Bacteria 1737
208 Ga0207676_10215281 3300026095 Unclassified 1707
209 Ga0207674_10005376 3300026116 Bacteria 15236
210 Ga0207675_100012580 3300026118 Bacteria 7905
211 Ga0207675_100276367 3300026118 Bacteria 1631
212 Ga0207683_10357327 3300026121 Bacteria 1341
213 Ga0207698_10024835 3300026142 Bacteria 4212
214 Ga0268264_10001722 3300028381 Bacteria 20135
215 Ga0268264_10002806 3300028381 Bacteria 15215
216 Ga0268264_10010077 3300028381 Bacteria 7823
217 Ga0307517_10004401 3300028786 Bacteria 21639
218 Ga0307515_10000010 3300028794 Bacteria 651586
219 Ga0307515_10077934 3300028794 Bacteria 4368
220 Ga0307515_10157919 3300028794 Bacteria 2330
221 Ga0307515_10241017 3300028794 Bacteria 1579
222 Ga0265327_10001284 3300031251 Bacteria 33021
223 Ga0307509_10006906 3300031507 Bacteria 15076
224 Ga0307509_10057873 3300031507 Bacteria 4107
225 Ga0307516_10003127 3300031730 Bacteria 21526
226 Ga0307516_10282061 3300031730 Bacteria 1343
227 Ga0307510_10015073 3300033180 Bacteria 9137
228 Ga0373927_0060224 3300035695 Bacteria 2456
229 Ga0395900_0014224 3300037418 Bacteria 8122
230 Ga0395900_0180472 3300037418 Unclassified 2146
231 Ga0395905_0004754 3300037471 Bacteria 14035
232 Ga0395901_0018592 3300038443 Bacteria 7097
233 Ga0439436_0000413 3300041404 Bacteria 10744
234 Ga0439433_0015438 3300041999 Bacteria 1686
235 Ga0439449_0001602 3300042007 Bacteria 8873
236 Ga0439449_0003547 3300042007 Bacteria 6061
237 Ga0439457_008702 3300042014 Bacteria 2383
238 Ga0439457_015215 3300042014 Unclassified 1719
239 Ga0439462_0020800 3300042015 Bacteria 1712
240 Ga0466972_0000104 3300044658 Bacteria 73886
241 Ga0466965_0186079 3300044683 Bacteria 1097
242 Ga0466966_0000193 3300044684 Bacteria 40730
243 Ga0466971_0086250 3300044719 Bacteria 1435
244 Ga0466971_0201901 3300044719 Bacteria 939
245 Ga0466968_0153529 3300044735 Unclassified 1059
246 Ga0466970_0000529 3300044765 Bacteria 18707
247 Ga0466970_0149233 3300044765 Bacteria 1291
248 Ga0466957_0001943 3300044842 Bacteria 10977
249 Ga0466960_0027613 3300044901 Bacteria 2591
250 Ga0466960_0103810 3300044901 Bacteria 1468
251 Ga0466959_0007615 3300045049 Bacteria 7609
252 Ga0466959_0061233 3300045049 Bacteria 2737
253 Ga0495606_0033364 3300046507 Bacteria 3551
254 Ga0495610_0000005 3300046512 Bacteria 924111
255 Ga0495668_0003676 3300046616 Bacteria 11333
256 Ga0495634_0168811 3300046642 Bacteria 1376
257 Ga0495611_0000440 3300046648 Bacteria 25587
258 Ga0495635_0049094 3300046663 Bacteria 2909
259 Ga0495686_0000016 3300047472 Bacteria 443701
260 Ga0496100_0017292 3300048903 Bacteria 4254
261 Ga0496101_0104027 3300048904 Unclassified 2129
262 Ga0496102_0104017 3300048905 Bacteria 2641
263 Ga0496110_0449486 3300048913 Bacteria 1174
264 Ga0496126_0379521 3300048929 Bacteria 1151
265 Ga0501290_003143 3300049513 Bacteria 2092
266 Ga0501032_0002459 3300049569 Bacteria 14470
267 Ga0501033_0059266 3300049570 Bacteria 2827
268 Ga0501034_0025888 3300049571 Bacteria 5974
269 Ga0501034_0026096 3300049571 Bacteria 5950
270 Ga0501037_0008913 3300049573 Bacteria 7347
271 Ga0501043_0054336 3300049579 Bacteria 3145
272 Ga0501047_0209898 3300049581 Bacteria 1806
273 Ga0501047_0458087 3300049581 Bacteria 1104
274 Ga0501225_0001814 3300049705 Bacteria 6688
275 Ga0501035_0039676 3300049822 Bacteria 4260
276 Ga0501044_0022366 3300049823 Bacteria 6739
277 nmdc:mga0k408_14340_c1 3300050493 Bacteria 4364
278 nmdc:mga05p37_11170_c1 3300050507 Bacteria 10673
279 nmdc:mga05p37_179814_c1 3300050507 Bacteria 2574
280 nmdc:mga09592_91913_c1 3300050508 Bacteria 2594
281 nmdc:mga06r32_173571_c1 3300050510 Bacteria 2140
282 nmdc:mga08y16_698835_c1 3300050511 Unclassified 1014
283 Ga0500578_0000100 3300053086 Bacteria 99827
284 Ga0500578_0027120 3300053086 Bacteria 3676
285 Ga0500646_0051914 3300053090 Bacteria 1185
286 Ga0500583_0000009 3300053092 Bacteria 160749
287 Ga0500583_0004029 3300053092 Bacteria 4725
288 Ga0500642_0040797 3300053130 Bacteria 2004
289 Ga0500652_040146 3300053131 Bacteria 1880
290 Ga0500604_0004825 3300053151 Bacteria 3574
291 Ga0500637_0024212 3300053178 Bacteria 3326
292 2587746654 2585428060 Bacteria 5304711
293 2588223750 2585428185 Bacteria 4969476
294 2588447143 2588253712 Bacteria 5403181
295 2590609796 2588254257 Bacteria 5436094
296 2729201202 2728369107 Bacteria 5082720
297 2738701322 2738541273 Bacteria 4048577
298 2738725996 2738541278 Bacteria 9755573
299 2739255620 2738543014 Bacteria 4048139
300 2819587885 2818991444 Bacteria 6968812
301 2842084656 2842083920 Bacteria 4857652
302 2905999362 2905999023 Bacteria 4591259
303 Ga0307511_10003158
304 rootH1_10130558
305 rootH2_10023677
306 rootH2_10024559
307 rootL2_10001777
308 rootL2_10026427
309 rootH1_10135911
310 Ga0070683_100064753
311 Ga0070690_100070278
312 Ga0070670_100127041
313 Ga0070670_100432711
314 Ga0068869_100015905
315 Ga0070666_10000028
316 Ga0070666_10208428
317 Ga0070682_100227892
318 Ga0068868_100138774
319 Ga0070691_10025621
320 Ga0070691_10178365
321 Ga0070687_100213971
322 Ga0070668_100030592
323 Ga0070668_100423463
324 Ga0070675_100033881
325 Ga0070671_100003437
326 Ga0070671_100068616
327 Ga0070667_100003232
328 Ga0070663_100317281
329 Ga0070678_100562024
330 Ga0070681_10006598
331 Ga0070684_100009827
332 Ga0068853_100000730
333 Ga0070672_100251432
334 Ga0068855_100005983
335 Ga0068855_100009148
336 Ga0068855_100054386
337 Ga0068855_100209679
338 Ga0068857_100002029
339 Ga0068854_100172097
340 Ga0068856_100007851
341 Ga0068856_100391115
342 Ga0068852_100004018
343 Ga0068852_100376083
344 Ga0068859_100000012
345 Ga0068859_100000859
346 Ga0068859_100369673
347 Ga0068864_100120558
348 Ga0068864_100174541
349 Ga0068864_100206131
350 Ga0068866_10011380
351 Ga0068861_100340361
352 Ga0068851_10014960
353 Ga0068863_100013238
354 Ga0068863_100049303
355 Ga0068858_100004166
356 Ga0068860_100001749
357 Ga0068860_100016656
358 Ga0068860_100017849
359 Ga0068860_100176268
360 Ga0068860_100260695
361 Ga0075366_10115300
362 Ga0097621_100001267
363 Ga0097621_100187613
364 Ga0068871_100000704
365 Ga0068871_100024075
366 Ga0068871_100180386
367 Ga0068871_100205690
368 Ga0068871_100384245
369 Ga0075431_100054608
370 Ga0075429_100300076
371 Ga0068865_100102640
372 Ga0068865_100291413
373 Ga0097620_100000012
374 Ga0097620_100000859
375 Ga0097620_100369702
376 Ga0105240_10000023
377 Ga0105240_10000893
378 Ga0105240_10002999
379 Ga0105240_10015470
380 Ga0105240_10029275
381 Ga0105240_10040332
382 Ga0105240_10055938
383 Ga0105240_10846748
384 Ga0114129_10007165
385 Ga0114129_10065166
386 Ga0105243_10048286
387 Ga0105241_10003136
388 Ga0105241_10203343
389 Ga0105242_10098518
390 Ga0105242_10241648
391 Ga0105242_10545818
392 Ga0105248_10007183
393 Ga0105237_10004328
394 Ga0105237_10011363
395 Ga0105237_10052768
396 Ga0105237_10110160
397 Ga0105237_10167639
398 Ga0105237_10345905
399 Ga0105238_10023396
400 Ga0105238_10081307
401 Ga0105238_10138185
402 Ga0105249_10003694
403 Ga0105249_10013608
404 Ga0105249_10142667
405 Ga0105249_10424390
406 Ga0105249_10610603
407 Ga0105249_10827935
408 Ga0105249_10848095
409 Ga0105239_10000128
410 Ga0105239_10001010
411 Ga0105239_10001102
412 Ga0105239_10001887
413 Ga0105239_10044383
414 Ga0105246_10088633
415 Ga0157371_10004659
416 Ga0157370_10001091
417 Ga0157370_10001225
418 Ga0157369_10041623
419 Ga0157369_10069725
420 Ga0157369_10450972
421 Ga0157374_10000002
422 Ga0157374_10228943
423 Ga0157378_10013483
424 Ga0157378_10191557
425 Ga0163162_10000086
426 Ga0163162_10000282
427 Ga0163162_10002016
428 Ga0163162_10003354
429 Ga0163162_10006341
430 Ga0157372_10000573
431 Ga0157372_10018359
432 Ga0157372_10055809
433 Ga0157372_10721624
434 Ga0157372_10905181
435 Ga0157375_10000115
436 Ga0157375_10250748
437 Ga0157375_10331894
438 Ga0163163_10001214
439 Ga0163163_10024040
440 Ga0163163_10121735
441 Ga0163163_10891488
442 Ga0157380_10392421
443 Ga0157379_10043589
444 Ga0157379_10045506
445 Ga0157376_10000467
446 Ga0157376_10002716
447 Ga0157376_10071506
448 Ga0157376_10115792
449 Ga0157376_10166846
450 Ga0182006_1000001
451 Ga0163161_10005511
452 Ga0163161_10171516
453 Ga0207642_10222188
454 Ga0207680_10000515
455 Ga0207680_10194431
456 Ga0207647_10074731
457 Ga0207654_10003719
458 Ga0207654_10065937
459 Ga0207695_10000016
460 Ga0207695_10000128
461 Ga0207695_10006251
462 Ga0207695_10019363
463 Ga0207695_10088824
464 Ga0207695_10347496
465 Ga0207695_10557401
466 Ga0207671_10031252
467 Ga0207671_10092977
468 Ga0207671_10105364
469 Ga0207671_10229419
470 Ga0207694_10010885
471 Ga0207694_10197681
472 Ga0207659_10020520
473 Ga0207644_10008771
474 Ga0207644_10095651
475 Ga0207686_10152385
476 Ga0207704_10046567
477 Ga0207691_10069093
478 Ga0207711_10176257
479 Ga0207689_10006838
480 Ga0207689_10010894
481 Ga0207689_10129767
482 Ga0207661_10059366
483 Ga0207667_10000151
484 Ga0207667_10000502
485 Ga0207667_10018553
486 Ga0207667_10019745
487 Ga0207667_10088606
488 Ga0207667_10119097
489 Ga0207651_10046634
490 Ga0207712_10059041
491 Ga0207712_10217680
492 Ga0207668_10200026
493 Ga0207640_10123841
494 Ga0207658_10062952
495 Ga0207677_10261257
496 Ga0207703_10031134
497 Ga0207639_10003082
498 Ga0207639_10048957
499 Ga0207639_10356949
500 Ga0207702_10143204
501 Ga0207641_10011451
502 Ga0207641_10026831
503 Ga0207641_10192489
504 Ga0207641_10618421
505 Ga0207648_10255800
506 Ga0207648_10449018
507 Ga0207676_10050906
508 Ga0207676_10121205
509 Ga0207676_10207142
510 Ga0207676_10215281
511 Ga0207674_10005376
512 Ga0207675_100012580
513 Ga0207675_100276367
514 Ga0207683_10357327
515 Ga0207698_10024835
516 Ga0268264_10001722
517 Ga0268264_10002806
518 Ga0268264_10010077
519 Ga0307517_10004401
520 Ga0307515_10000010
521 Ga0307515_10077934
522 Ga0307515_10157919
523 Ga0307515_10241017
524 Ga0265327_10001284
525 Ga0307509_10006906
526 Ga0307509_10057873
527 Ga0307516_10003127
528 Ga0307516_10282061
529 Ga0307510_10015073
530 Ga0373927_0060224
531 Ga0395900_0014224
532 Ga0395900_0180472
533 Ga0395905_0004754
534 Ga0395901_0018592
535 Ga0439436_0000413
536 Ga0439433_0015438
537 Ga0439449_0001602
538 Ga0439449_0003547
539 Ga0439457_008702
540 Ga0439457_015215
541 Ga0439462_0020800
542 Ga0466972_0000104
543 Ga0466965_0186079
544 Ga0466966_0000193
545 Ga0466971_0086250
546 Ga0466971_0201901
547 Ga0466968_0153529
548 Ga0466970_0000529
549 Ga0466970_0149233
550 Ga0466957_0001943
551 Ga0466960_0027613
552 Ga0466960_0103810
553 Ga0466959_0007615
554 Ga0466959_0061233
555 Ga0495606_0033364
556 Ga0495610_0000005
557 Ga0495668_0003676
558 Ga0495634_0168811
559 Ga0495611_0000440
560 Ga0495635_0049094
561 Ga0495686_0000016
562 Ga0496100_0017292
563 Ga0496101_0104027
564 Ga0496102_0104017
565 Ga0496110_0449486
566 Ga0496126_0379521
567 Ga0501290_003143
568 Ga0501032_0002459
569 Ga0501033_0059266
570 Ga0501034_0025888
571 Ga0501034_0026096
572 Ga0501037_0008913
573 Ga0501043_0054336
574 Ga0501047_0209898
575 Ga0501047_0458087
576 Ga0501225_0001814
577 Ga0501035_0039676
578 Ga0501044_0022366
579 nmdc:mga0k408_14340_c1
580 nmdc:mga05p37_11170_c1
581 nmdc:mga05p37_179814_c1
582 nmdc:mga09592_91913_c1
583 nmdc:mga06r32_173571_c1
584 nmdc:mga08y16_698835_c1
585 Ga0500578_0000100
586 Ga0500578_0027120
587 Ga0500646_0051914
588 Ga0500583_0000009
589 Ga0500583_0004029
590 Ga0500642_0040797
591 Ga0500652_040146
592 Ga0500604_0004825
593 Ga0500637_0024212
594 2587746654
595 2588223750
596 2588447143
597 2590609796
598 2729201202
599 2738701322
600 2738725996
601 2739255620
602 2819587885
603 2842084656
604 2905999362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

22

234

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pr2-assembly1.cif.gz_A r261a/s128a s. typhimurium siroheme synthase 0.9322 1 246
6pr2-assembly1.cif.gz_B r261a/s128a s. typhimurium siroheme synthase 0.9293 2 245
6pr3-assembly1.cif.gz_A d262a/s128a s. typhimurium siroheme synthase 0.9286 1 247
6pr4-assembly1.cif.gz_A d262n/s128a s. typhimurium siroheme synthase 0.9273 1 247
6pr0-assembly1.cif.gz_B p133h-s128a s. typhimurium siroheme synthase 0.9258 2 247
ID Description Score Start End Superfamily
1pjsB05 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.8983 122 247 3.30.950.10
af_Q2FVM0_1_122_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8877 2 120 3.40.1010.10
1pjsB05 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.8848 122 247 3.30.950.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8844 1 120 3.40.1010.10
af_A0A0R0IWM0_102_225_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.8812 2 120 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A7C7JMX4-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9385 4 240 GO:0004851
GO:0019354
GO:0032259
AF-A0A1I5Z3T5-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9357 2 254 GO:0004851
GO:0019354
GO:0032259
AF-A0A4Q5UDU2-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9333 4 254 GO:0004851
GO:0019354
GO:0032259
AF-A0A5B8V4I5-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9325 1 259 GO:0004851
GO:0019354
GO:0032259
AF-A0A5B8V4I5-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9256 1 259 GO:0004851
GO:0019354
GO:0032259

Map