F396783
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 224 | 261 | 360 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3003665799|3003672492 |
| Length | 413 |
| Sequence | RGAGLHGLGPAPASRPPTDGIDVRDHFPSGAKCSRAAASSLVAAMSHNSFGHLFRVTTFGESHGPALGCVVDGCPPLIPLEAAEIQAELDRRRPGQSRFTTQRQEPDQVRILSGVFSDDRTEGRQLTTGTPIALMIENVDQRSKDYSEIRDSYRPGHADYAYDAKYGIRDYRGGGRSSARETAARVAAGAVARKVLPGVTIRGALVQIGPHAIDRARFDWDEVNNNPFFCPDPVAAGQWAEYLDGIRKAGSSVGAVIEVVAEGVPVGLGAPVYGKLDADLAAAMMSINAVKGVEIGDGFAAAALRGEENADEMRPGNDGRPIFLANHAGGVLGGISTGQPLVCRFAVKPTSSILTPRASVSRDNRPVDVMTKGRHDPCVGIRAVPVGEAMMACVLADHWLRHRGQVGEGIQPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 2 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 3 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 4 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 5 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 6 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 7 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 8 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 9 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 10 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 11 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 12 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 13 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 14 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 15 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 16 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 17 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 18 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 19 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 20 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 21 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 22 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 23 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 24 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 25 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 26 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 27 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 28 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 29 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 30 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 31 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 32 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 33 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 34 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 35 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 36 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 37 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 74 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 75 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 109 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 110 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 115 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 118 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 119 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 120 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 121 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 122 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 123 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 124 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 125 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 131 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 134 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 135 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 136 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 174 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 175 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 176 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 177 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 178 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 195 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 196 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 197 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 200 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 201 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 204 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 205 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 211 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 212 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 213 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 214 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 215 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 216 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 217 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 220 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 221 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 222 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 223 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 224 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.42 |
| Metatranscriptomes | 0 |
| Isolates | 13.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.29 |
| Nodule | 1.32 |
| Rhizoplane | 2.32 |
| Rhizosphere | 72.19 |
| Stem | 0 |
| Stem Tuber | 0.33 |
| Unclassified | 17.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000535 | 3300003187 | Bacteria | 35206 |
| 2 | JGI25406J46586_10000707 | 3300003203 | Bacteria | 15594 |
| 3 | Ga0070660_100136303 | 3300005339 | Bacteria | 1967 |
| 4 | Ga0070661_100069887 | 3300005344 | Bacteria | 2582 |
| 5 | Ga0070661_100283379 | 3300005344 | Bacteria | 1286 |
| 6 | Ga0070675_100287098 | 3300005354 | Bacteria | 1447 |
| 7 | Ga0070671_100322916 | 3300005355 | Bacteria | 1316 |
| 8 | Ga0070674_100005478 | 3300005356 | Bacteria | 7333 |
| 9 | Ga0070709_10010485 | 3300005434 | Bacteria | 5134 |
| 10 | Ga0070714_100063830 | 3300005435 | Bacteria | 3168 |
| 11 | Ga0070714_100202341 | 3300005435 | Bacteria | 1817 |
| 12 | Ga0070713_100032450 | 3300005436 | Bacteria | 4171 |
| 13 | Ga0070678_100034419 | 3300005456 | Bacteria | 3528 |
| 14 | Ga0070678_100038383 | 3300005456 | Bacteria | 3371 |
| 15 | Ga0070662_100055468 | 3300005457 | Bacteria | 2875 |
| 16 | Ga0070681_10244100 | 3300005458 | Bacteria | 1709 |
| 17 | Ga0070699_100256389 | 3300005518 | Bacteria | 1564 |
| 18 | Ga0070684_100221036 | 3300005535 | Bacteria | 1728 |
| 19 | Ga0070697_100006439 | 3300005536 | Bacteria | 9090 |
| 20 | Ga0070695_100008461 | 3300005545 | Bacteria | 6104 |
| 21 | Ga0068855_100001158 | 3300005563 | Bacteria | 32691 |
| 22 | Ga0068855_100145431 | 3300005563 | Bacteria | 2699 |
| 23 | Ga0068856_100228742 | 3300005614 | Bacteria | 1875 |
| 24 | Ga0068856_100370158 | 3300005614 | Bacteria | 1452 |
| 25 | Ga0068864_100062657 | 3300005618 | Bacteria | 3222 |
| 26 | Ga0068861_100307983 | 3300005719 | Bacteria | 1374 |
| 27 | Ga0068863_100013148 | 3300005841 | Bacteria | 7990 |
| 28 | Ga0081455_10145904 | 3300005937 | Bacteria | 1831 |
| 29 | Ga0081539_10000054 | 3300005985 | Bacteria | 259053 |
| 30 | Ga0075363_100075198 | 3300006048 | Bacteria | 1840 |
| 31 | Ga0070712_100190983 | 3300006175 | Bacteria | 1603 |
| 32 | Ga0075367_10006217 | 3300006178 | Bacteria | 6014 |
| 33 | Ga0075369_10018780 | 3300006186 | Bacteria | 2818 |
| 34 | Ga0075370_10023807 | 3300006353 | Bacteria | 3377 |
| 35 | Ga0075436_100000751 | 3300006914 | Bacteria | 21452 |
| 36 | Ga0075435_100080167 | 3300007076 | Bacteria | 2680 |
| 37 | Ga0105240_10025206 | 3300009093 | Bacteria | 7822 |
| 38 | Ga0111539_10039262 | 3300009094 | Bacteria | 5707 |
| 39 | Ga0111539_10198136 | 3300009094 | Bacteria | 2342 |
| 40 | Ga0105245_10006206 | 3300009098 | Bacteria | 10512 |
| 41 | Ga0105245_10377821 | 3300009098 | Bacteria | 1410 |
| 42 | Ga0105248_10019306 | 3300009177 | Bacteria | 7542 |
| 43 | Ga0105239_10000105 | 3300010375 | Bacteria | 117635 |
| 44 | Ga0157372_10027752 | 3300013307 | Bacteria | 6170 |
| 45 | Ga0213876_10002190 | 3300021384 | Bacteria | 11526 |
| 46 | Ga0213875_10002098 | 3300021388 | Bacteria | 12228 |
| 47 | Ga0213875_10002797 | 3300021388 | Bacteria | 10263 |
| 48 | Ga0213875_10013929 | 3300021388 | Bacteria | 3933 |
| 49 | Ga0213875_10015867 | 3300021388 | Bacteria | 3659 |
| 50 | Ga0213875_10018169 | 3300021388 | Bacteria | 3391 |
| 51 | Ga0213875_10022871 | 3300021388 | Bacteria | 2988 |
| 52 | Ga0209130_1002834 | 3300025284 | Bacteria | 8050 |
| 53 | Ga0209025_1000146 | 3300025294 | Bacteria | 180022 |
| 54 | Ga0209758_1004822 | 3300025297 | Bacteria | 10888 |
| 55 | Ga0207426_1000046 | 3300025302 | Bacteria | 422271 |
| 56 | Ga0207682_10000502 | 3300025893 | Bacteria | 17995 |
| 57 | Ga0207692_10010137 | 3300025898 | Bacteria | 3960 |
| 58 | Ga0207642_10014608 | 3300025899 | Bacteria | 2902 |
| 59 | Ga0207688_10073178 | 3300025901 | Bacteria | 1947 |
| 60 | Ga0207680_10114671 | 3300025903 | Bacteria | 1754 |
| 61 | Ga0207699_10030819 | 3300025906 | Bacteria | 3005 |
| 62 | Ga0207645_10044975 | 3300025907 | Bacteria | 2823 |
| 63 | Ga0207707_10167551 | 3300025912 | Bacteria | 1920 |
| 64 | Ga0207695_10010961 | 3300025913 | Bacteria | 11024 |
| 65 | Ga0207693_10008979 | 3300025915 | Bacteria | 8156 |
| 66 | Ga0207657_10112086 | 3300025919 | Bacteria | 2252 |
| 67 | Ga0207652_10130769 | 3300025921 | Bacteria | 2239 |
| 68 | Ga0207652_10151461 | 3300025921 | Bacteria | 2077 |
| 69 | Ga0207646_10358364 | 3300025922 | Bacteria | 1318 |
| 70 | Ga0207659_10117943 | 3300025926 | Bacteria | 2029 |
| 71 | Ga0207687_10199986 | 3300025927 | Bacteria | 1561 |
| 72 | Ga0207700_10039856 | 3300025928 | Bacteria | 3424 |
| 73 | Ga0207700_10324622 | 3300025928 | Bacteria | 1335 |
| 74 | Ga0207700_10358698 | 3300025928 | Bacteria | 1271 |
| 75 | Ga0207706_10029061 | 3300025933 | Bacteria | 4937 |
| 76 | Ga0207669_10037659 | 3300025937 | Bacteria | 2777 |
| 77 | Ga0207691_10001713 | 3300025940 | Bacteria | 21596 |
| 78 | Ga0207711_10002689 | 3300025941 | Bacteria | 15719 |
| 79 | Ga0207667_10077994 | 3300025949 | Bacteria | 3434 |
| 80 | Ga0207667_10349223 | 3300025949 | Bacteria | 1509 |
| 81 | Ga0207708_10079151 | 3300026075 | Bacteria | 2524 |
| 82 | Ga0207648_10023152 | 3300026089 | Bacteria | 5571 |
| 83 | Ga0207683_10002207 | 3300026121 | Bacteria | 17110 |
| 84 | Ga0207683_10071973 | 3300026121 | Bacteria | 3057 |
| 85 | Ga0207683_10229422 | 3300026121 | Bacteria | 1693 |
| 86 | Ga0207698_10089313 | 3300026142 | Bacteria | 2516 |
| 87 | Ga0268266_10000514 | 3300028379 | Bacteria | 54510 |
| 88 | Ga0268266_10167521 | 3300028379 | Bacteria | 1992 |
| 89 | Ga0268265_10313679 | 3300028380 | Bacteria | 1417 |
| 90 | Ga0268264_10063739 | 3300028381 | Bacteria | 3100 |
| 91 | Ga0265338_10026420 | 3300028800 | Bacteria | 5856 |
| 92 | Ga0265338_10029629 | 3300028800 | Bacteria | 5419 |
| 93 | Ga0265338_10050725 | 3300028800 | Bacteria | 3746 |
| 94 | Ga0265338_10125851 | 3300028800 | Bacteria | 2034 |
| 95 | Ga0265325_10001335 | 3300031241 | Bacteria | 17486 |
| 96 | Ga0265340_10064963 | 3300031247 | Bacteria | 1738 |
| 97 | Ga0265331_10001082 | 3300031250 | Bacteria | 20989 |
| 98 | Ga0265331_10001721 | 3300031250 | Bacteria | 15754 |
| 99 | Ga0265316_10199949 | 3300031344 | Bacteria | 1482 |
| 100 | Ga0307513_10095076 | 3300031456 | Bacteria | 3022 |
| 101 | Ga0265313_10003473 | 3300031595 | Bacteria | 12725 |
| 102 | Ga0307508_10067276 | 3300031616 | Bacteria | 3151 |
| 103 | Ga0265314_10035984 | 3300031711 | Bacteria | 3603 |
| 104 | Ga0265342_10037893 | 3300031712 | Bacteria | 2938 |
| 105 | Ga0316576_10018093 | 3300031727 | Bacteria | 4803 |
| 106 | Ga0316576_10041083 | 3300031727 | Bacteria | 3327 |
| 107 | Ga0316576_10084939 | 3300031727 | Bacteria | 2352 |
| 108 | Ga0316576_10099947 | 3300031727 | Bacteria | 2167 |
| 109 | Ga0316578_10002431 | 3300031728 | Bacteria | 8166 |
| 110 | Ga0316578_10026700 | 3300031728 | Bacteria | 3258 |
| 111 | Ga0373934_0014736 | 3300035086 | Bacteria | 2962 |
| 112 | Ga0373923_0042197 | 3300035111 | Bacteria | 1883 |
| 113 | Ga0373953_0004459 | 3300035117 | Bacteria | 4467 |
| 114 | Ga0373954_0013529 | 3300035118 | Bacteria | 3638 |
| 115 | Ga0373962_0049135 | 3300035242 | Bacteria | 1212 |
| 116 | Ga0316574_0029037 | 3300035398 | Bacteria | 3339 |
| 117 | Ga0316574_0213882 | 3300035398 | Bacteria | 1236 |
| 118 | Ga0373935_0244757 | 3300035692 | Bacteria | 1253 |
| 119 | Ga0373927_0045706 | 3300035695 | Bacteria | 2832 |
| 120 | Ga0373933_0045464 | 3300035724 | Bacteria | 2604 |
| 121 | Ga0373937_0000640 | 3300036401 | Bacteria | 30696 |
| 122 | Ga0373937_0033267 | 3300036401 | Bacteria | 4681 |
| 123 | Ga0373937_0165108 | 3300036401 | Bacteria | 2076 |
| 124 | Ga0373925_0022148 | 3300037068 | Bacteria | 4633 |
| 125 | Ga0436364_0512657 | 3300037853 | Bacteria | 42864 |
| 126 | Ga0436364_0656171 | 3300037853 | Bacteria | 13437 |
| 127 | Ga0436364_0732417 | 3300037853 | Bacteria | 1662 |
| 128 | Ga0436364_1468280 | 3300037853 | Bacteria | 60501 |
| 129 | Ga0436364_1480127 | 3300037853 | Bacteria | 34894 |
| 130 | Ga0400483_280433 | 3300039062 | Bacteria | 5048 |
| 131 | Ga0436365_0097042 | 3300039437 | Bacteria | 195024 |
| 132 | Ga0436365_0142693 | 3300039437 | Bacteria | 1813 |
| 133 | Ga0436365_0604472 | 3300039437 | Bacteria | 2561 |
| 134 | Ga0436365_0620663 | 3300039437 | Bacteria | 3539 |
| 135 | Ga0436365_0651981 | 3300039437 | Bacteria | 6884 |
| 136 | Ga0436365_0709706 | 3300039437 | Bacteria | 1525 |
| 137 | Ga0436360_0962259 | 3300039438 | Bacteria | 2835 |
| 138 | Ga0436360_1017874 | 3300039438 | Bacteria | 2320 |
| 139 | Ga0436361_1160729 | 3300039447 | Bacteria | 3430 |
| 140 | Ga0436362_0598278 | 3300039453 | Bacteria | 2148 |
| 141 | Ga0436362_0894474 | 3300039453 | Bacteria | 7063 |
| 142 | Ga0439453_0000074 | 3300041408 | Bacteria | 7439 |
| 143 | Ga0466972_0149766 | 3300044658 | Bacteria | 1097 |
| 144 | Ga0466963_0024993 | 3300044694 | Bacteria | 3805 |
| 145 | Ga0466968_0003779 | 3300044735 | Bacteria | 5610 |
| 146 | Ga0451576_0001652 | 3300045051 | Bacteria | 37060 |
| 147 | Ga0466967_0007437 | 3300045976 | Bacteria | 7900 |
| 148 | Ga0466967_0049776 | 3300045976 | Bacteria | 3667 |
| 149 | Ga0495590_0013859 | 3300046457 | Bacteria | 2956 |
| 150 | Ga0495638_0074985 | 3300046460 | Bacteria | 2062 |
| 151 | Ga0495638_0176108 | 3300046460 | Bacteria | 1224 |
| 152 | Ga0495662_0051924 | 3300046476 | Bacteria | 1979 |
| 153 | Ga0495662_0113609 | 3300046476 | Bacteria | 1328 |
| 154 | Ga0495664_0001365 | 3300046477 | Bacteria | 12892 |
| 155 | Ga0495628_0011302 | 3300046516 | Bacteria | 7553 |
| 156 | Ga0495630_0108681 | 3300046517 | Bacteria | 2101 |
| 157 | Ga0495652_0231178 | 3300046529 | Bacteria | 1383 |
| 158 | Ga0495640_0024636 | 3300046533 | Bacteria | 4376 |
| 159 | Ga0495587_0012418 | 3300046536 | Bacteria | 5360 |
| 160 | Ga0495587_0196593 | 3300046536 | Bacteria | 1141 |
| 161 | Ga0495598_0019247 | 3300046537 | Bacteria | 1787 |
| 162 | Ga0495621_0003932 | 3300046539 | Bacteria | 4132 |
| 163 | Ga0495645_0000600 | 3300046543 | Bacteria | 24865 |
| 164 | Ga0495622_0000699 | 3300046557 | Bacteria | 19021 |
| 165 | Ga0495611_0031141 | 3300046648 | Bacteria | 2347 |
| 166 | Ga0495599_0013498 | 3300046678 | Bacteria | 5047 |
| 167 | Ga0495599_0015829 | 3300046678 | Bacteria | 4682 |
| 168 | Ga0495646_0089560 | 3300046680 | Bacteria | 1780 |
| 169 | Ga0495649_0047917 | 3300046694 | Bacteria | 2323 |
| 170 | Ga0495674_0042015 | 3300047319 | Bacteria | 4081 |
| 171 | Ga0495672_0006288 | 3300047320 | Bacteria | 9244 |
| 172 | Ga0495672_0042724 | 3300047320 | Bacteria | 2731 |
| 173 | Ga0495680_0060318 | 3300047322 | Bacteria | 2925 |
| 174 | Ga0495683_0054915 | 3300047323 | Bacteria | 1984 |
| 175 | Ga0495675_0123471 | 3300047444 | Bacteria | 1612 |
| 176 | Ga0495685_019208 | 3300047447 | Bacteria | 2348 |
| 177 | Ga0495686_0048876 | 3300047472 | Bacteria | 2665 |
| 178 | Ga0495686_0070239 | 3300047472 | Bacteria | 2158 |
| 179 | Ga0495602_0003217 | 3300048088 | Bacteria | 16863 |
| 180 | Ga0495602_0069658 | 3300048088 | Bacteria | 3014 |
| 181 | Ga0496100_0073550 | 3300048903 | Bacteria | 2288 |
| 182 | Ga0496100_0215008 | 3300048903 | Bacteria | 1408 |
| 183 | Ga0496105_0048069 | 3300048908 | Bacteria | 3522 |
| 184 | Ga0496107_0074612 | 3300048910 | Bacteria | 2468 |
| 185 | Ga0496110_0093614 | 3300048913 | Bacteria | 2690 |
| 186 | Ga0496111_0115376 | 3300048914 | Bacteria | 1980 |
| 187 | Ga0496114_0216349 | 3300048917 | Bacteria | 1681 |
| 188 | Ga0496119_0000515 | 3300048922 | Bacteria | 52633 |
| 189 | Ga0496119_0008877 | 3300048922 | Bacteria | 8743 |
| 190 | Ga0496122_0001603 | 3300048925 | Bacteria | 35394 |
| 191 | Ga0496123_0000995 | 3300048926 | Bacteria | 43400 |
| 192 | Ga0496125_0097596 | 3300048928 | Bacteria | 2177 |
| 193 | Ga0501292_000059 | 3300049515 | Bacteria | 22245 |
| 194 | Ga0501031_0184125 | 3300049568 | Bacteria | 1364 |
| 195 | Ga0501032_0032836 | 3300049569 | Bacteria | 3556 |
| 196 | Ga0501033_0004499 | 3300049570 | Bacteria | 11156 |
| 197 | Ga0501033_0143811 | 3300049570 | Bacteria | 1724 |
| 198 | Ga0501034_0081914 | 3300049571 | Bacteria | 3229 |
| 199 | Ga0501034_0453557 | 3300049571 | Bacteria | 1200 |
| 200 | Ga0501036_0006781 | 3300049572 | Bacteria | 9302 |
| 201 | Ga0501038_0019903 | 3300049574 | Bacteria | 6040 |
| 202 | Ga0501038_0040577 | 3300049574 | Bacteria | 4063 |
| 203 | Ga0501038_0289460 | 3300049574 | Bacteria | 1288 |
| 204 | Ga0501039_0002217 | 3300049575 | Bacteria | 14363 |
| 205 | Ga0501039_0036267 | 3300049575 | Bacteria | 3805 |
| 206 | Ga0501043_0002292 | 3300049579 | Bacteria | 16231 |
| 207 | Ga0501046_0007514 | 3300049580 | Bacteria | 9561 |
| 208 | Ga0501047_0006215 | 3300049581 | Bacteria | 11224 |
| 209 | Ga0501047_0036499 | 3300049581 | Bacteria | 4750 |
| 210 | Ga0501047_0040758 | 3300049581 | Bacteria | 4490 |
| 211 | Ga0501047_0123565 | 3300049581 | Bacteria | 2469 |
| 212 | Ga0501047_0243381 | 3300049581 | Bacteria | 1649 |
| 213 | Ga0501068_0049876 | 3300049584 | Bacteria | 2529 |
| 214 | Ga0501069_0003277 | 3300049585 | Bacteria | 8308 |
| 215 | Ga0501069_0042872 | 3300049585 | Bacteria | 2504 |
| 216 | Ga0501070_0007401 | 3300049586 | Bacteria | 9326 |
| 217 | Ga0501072_0079227 | 3300049588 | Bacteria | 2601 |
| 218 | Ga0501073_0011498 | 3300049589 | Bacteria | 6472 |
| 219 | Ga0501073_0019009 | 3300049589 | Bacteria | 4964 |
| 220 | Ga0501073_0077058 | 3300049589 | Bacteria | 2320 |
| 221 | Ga0501074_0020386 | 3300049590 | Bacteria | 4819 |
| 222 | Ga0501074_0022595 | 3300049590 | Bacteria | 4572 |
| 223 | Ga0501074_0025115 | 3300049590 | Bacteria | 4328 |
| 224 | Ga0501206_000591 | 3300049653 | Bacteria | 4384 |
| 225 | Ga0501224_000416 | 3300049664 | Bacteria | 5085 |
| 226 | Ga0501261_000109 | 3300049690 | Bacteria | 12572 |
| 227 | Ga0501080_0007993 | 3300049742 | Bacteria | 9585 |
| 228 | Ga0501080_0107914 | 3300049742 | Bacteria | 2580 |
| 229 | Ga0501083_0026587 | 3300049744 | Bacteria | 3999 |
| 230 | Ga0501083_0150792 | 3300049744 | Bacteria | 1522 |
| 231 | Ga0501279_001289 | 3300049775 | Bacteria | 3300 |
| 232 | Ga0501282_000082 | 3300049778 | Bacteria | 11042 |
| 233 | Ga0501035_0017347 | 3300049822 | Bacteria | 6638 |
| 234 | Ga0501035_0058754 | 3300049822 | Bacteria | 3426 |
| 235 | Ga0501044_0000263 | 3300049823 | Bacteria | 66364 |
| 236 | Ga0501044_0018628 | 3300049823 | Bacteria | 7436 |
| 237 | Ga0501044_0088143 | 3300049823 | Bacteria | 3133 |
| 238 | Ga0501044_0117887 | 3300049823 | Bacteria | 2658 |
| 239 | Ga0501044_0274337 | 3300049823 | Bacteria | 1621 |
| 240 | Ga0501044_0275025 | 3300049823 | Bacteria | 1619 |
| 241 | nmdc:mga00v17_129978_c1 | 3300050491 | Bacteria | 1609 |
| 242 | nmdc:mga06z11_32793_c1 | 3300050494 | Bacteria | 2535 |
| 243 | nmdc:mga08y16_5270_c1 | 3300050511 | Bacteria | 13511 |
| 244 | nmdc:mga08x19_22_c1 | 3300050514 | Bacteria | 297462 |
| 245 | Ga0495601_0014228 | 3300053077 | Bacteria | 4794 |
| 246 | Ga0495601_0231048 | 3300053077 | Bacteria | 1208 |
| 247 | Ga0495612_0000471 | 3300053078 | Bacteria | 16213 |
| 248 | Ga0495595_0002863 | 3300053084 | Bacteria | 6800 |
| 249 | Ga0495595_0043605 | 3300053084 | Bacteria | 2058 |
| 250 | Ga0500578_0049661 | 3300053086 | Bacteria | 2691 |
| 251 | Ga0500641_0049379 | 3300053096 | Bacteria | 1725 |
| 252 | Ga0500556_0000075 | 3300053104 | Bacteria | 97335 |
| 253 | Ga0500658_0012245 | 3300053134 | Bacteria | 3161 |
| 254 | Ga0500577_0023217 | 3300053142 | Bacteria | 2069 |
| 255 | Ga0500616_0000028 | 3300053153 | Bacteria | 435722 |
| 256 | Ga0500616_0017963 | 3300053153 | Bacteria | 4004 |
| 257 | Ga0500645_012025 | 3300053730 | Bacteria | 2806 |
| 258 | Ga0501084_0012456 | 3300054114 | Bacteria | 7047 |
| 259 | Ga0501082_0000772 | 3300060353 | Bacteria | 28062 |
| 260 | Ga0501082_0118687 | 3300060353 | Bacteria | 2292 |
| 261 | Ga0501082_0132553 | 3300060353 | Bacteria | 2162 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0184125 | Ga0501031_0184125_344_1354 | 313 |
| 2 | 3300048903 | Ga0496100_0215008 | Ga0496100_0215008_20_1042 | 314 |
| 3 | 3300039447 | Ga0436361_1160729 | Ga0436361_1160729_807_1907 | 324 |
| 4 | 3300044658 | Ga0466972_0149766 | Ga0466972_0149766_14_1033 | 324 |
| 5 | 3300049572 | Ga0501036_0006781 | Ga0501036_0006781_2376_3491 | 324 |
| 6 | 3300049574 | Ga0501038_0040577 | Ga0501038_0040577_1765_2940 | 324 |
| 7 | 3300049575 | Ga0501039_0036267 | Ga0501039_0036267_552_1727 | 324 |
| 8 | 3300049581 | Ga0501047_0036499 | Ga0501047_0036499_1326_2501 | 324 |
| 9 | 3300049744 | Ga0501083_0150792 | Ga0501083_0150792_296_1411 | 324 |
| 10 | 3300005354 | Ga0070675_100287098 | Ga0070675_1002870982 | 329 |
| 11 | 3300005356 | Ga0070674_100005478 | Ga0070674_1000054782 | 329 |
| 12 | 3300005456 | Ga0070678_100038383 | Ga0070678_1000383831 | 329 |
| 13 | 3300025893 | Ga0207682_10000502 | Ga0207682_100005029 | 329 |
| 14 | 3300025899 | Ga0207642_10014608 | Ga0207642_100146082 | 329 |
| 15 | 3300025901 | Ga0207688_10073178 | Ga0207688_100731782 | 329 |
| 16 | 3300025903 | Ga0207680_10114671 | Ga0207680_101146712 | 329 |
| 17 | 3300025907 | Ga0207645_10044975 | Ga0207645_100449752 | 329 |
| 18 | 3300025926 | Ga0207659_10117943 | Ga0207659_101179432 | 329 |
| 19 | 3300025937 | Ga0207669_10037659 | Ga0207669_100376592 | 329 |
| 20 | 3300025940 | Ga0207691_10001713 | Ga0207691_1000171321 | 329 |
| 21 | 3300026089 | Ga0207648_10023152 | Ga0207648_100231521 | 329 |
| 22 | 3300026121 | Ga0207683_10002207 | Ga0207683_100022073 | 329 |
| 23 | 3300035242 | Ga0373962_0049135 | Ga0373962_0049135_16_1146 | 329 |
| 24 | 3300046537 | Ga0495598_0019247 | Ga0495598_0019247_264_1385 | 329 |
| 25 | 3300046539 | Ga0495621_0003932 | Ga0495621_0003932_1788_2909 | 329 |
| 26 | 3300036401 | Ga0373937_0165108 | Ga0373937_0165108_1022_2050 | 330 |
| 27 | 3300046536 | Ga0495587_0196593 | Ga0495587_0196593_90_1118 | 330 |
| 28 | 3300006353 | Ga0075370_10023807 | Ga0075370_100238072 | 332 |
| 29 | 3300044694 | Ga0466963_0024993 | Ga0466963_0024993_243_1361 | 332 |
| 30 | 3300045976 | Ga0466967_0007437 | Ga0466967_0007437_1323_2441 | 332 |
| 31 | 3300046460 | Ga0495638_0176108 | Ga0495638_0176108_17_1129 | 332 |
| 32 | 3300050491 | nmdc:mga00v17_129978_c1 | nmdc:mga00v17_129978_c1_256_1368 | 332 |
| 33 | 3300053086 | Ga0500578_0049661 | Ga0500578_0049661_911_1996 | 333 |
| 34 | 3300031456 | Ga0307513_10095076 | Ga0307513_100950761 | 334 |
| 35 | 3300041408 | Ga0439453_0000074 | Ga0439453_0000074_6124_7248 | 334 |
| 36 | 3300006175 | Ga0070712_100190983 | Ga0070712_1001909831 | 335 |
| 37 | 3300047472 | Ga0495686_0048876 | Ga0495686_0048876_1364_2452 | 335 |
| 38 | 3300049823 | Ga0501044_0117887 | Ga0501044_0117887_16_1035 | 335 |
| 39 | 3300053096 | Ga0500641_0049379 | Ga0500641_0049379_533_1621 | 335 |
| 40 | 3300009094 | Ga0111539_10198136 | Ga0111539_101981361 | 336 |
| 41 | 3300026121 | Ga0207683_10229422 | Ga0207683_102294222 | 336 |
| 42 | 3300031727 | Ga0316576_10041083 | Ga0316576_100410833 | 336 |
| 43 | 3300031728 | Ga0316578_10002431 | Ga0316578_100024314 | 336 |
| 44 | 3300046457 | Ga0495590_0013859 | Ga0495590_0013859_1108_2238 | 336 |
| 45 | 3300046557 | Ga0495622_0000699 | Ga0495622_0000699_5789_6919 | 336 |
| 46 | 3300046648 | Ga0495611_0031141 | Ga0495611_0031141_162_1292 | 336 |
| 47 | 3300046694 | Ga0495649_0047917 | Ga0495649_0047917_23_1153 | 336 |
| 48 | 3300047320 | Ga0495672_0006288 | Ga0495672_0006288_4363_5493 | 336 |
| 49 | 3300047323 | Ga0495683_0054915 | Ga0495683_0054915_42_1148 | 336 |
| 50 | 3300053134 | Ga0500658_0012245 | Ga0500658_0012245_1819_2904 | 336 |
| 51 | 3300021384 | Ga0213876_10002190 | Ga0213876_100021909 | 337 |
| 52 | 3300039437 | Ga0436365_0097042 | Ga0436365_0097042_117715_118824 | 337 |
| 53 | 3300047472 | Ga0495686_0070239 | Ga0495686_0070239_420_1511 | 338 |
| 54 | 3300048903 | Ga0496100_0073550 | Ga0496100_0073550_819_1934 | 338 |
| 55 | 3300049569 | Ga0501032_0032836 | Ga0501032_0032836_1394_2479 | 338 |
| 56 | 3300049570 | Ga0501033_0004499 | Ga0501033_0004499_5077_6162 | 338 |
| 57 | 3300049574 | Ga0501038_0019903 | Ga0501038_0019903_2279_3364 | 338 |
| 58 | 3300049575 | Ga0501039_0002217 | Ga0501039_0002217_4018_5103 | 338 |
| 59 | 3300049579 | Ga0501043_0002292 | Ga0501043_0002292_10939_12024 | 338 |
| 60 | 3300049580 | Ga0501046_0007514 | Ga0501046_0007514_7398_8483 | 338 |
| 61 | 3300049581 | Ga0501047_0006215 | Ga0501047_0006215_5278_6363 | 338 |
| 62 | 3300049585 | Ga0501069_0003277 | Ga0501069_0003277_5856_6941 | 338 |
| 63 | 3300049586 | Ga0501070_0007401 | Ga0501070_0007401_1522_2607 | 338 |
| 64 | 3300049589 | Ga0501073_0019009 | Ga0501073_0019009_2802_3887 | 338 |
| 65 | 3300049590 | Ga0501074_0025115 | Ga0501074_0025115_1367_2452 | 338 |
| 66 | 3300049742 | Ga0501080_0007993 | Ga0501080_0007993_4734_5819 | 338 |
| 67 | 3300049822 | Ga0501035_0017347 | Ga0501035_0017347_5098_6183 | 338 |
| 68 | 3300049823 | Ga0501044_0018628 | Ga0501044_0018628_1368_2453 | 338 |
| 69 | 3300005536 | Ga0070697_100006439 | Ga0070697_1000064399 | 339 |
| 70 | 3300005545 | Ga0070695_100008461 | Ga0070695_1000084613 | 339 |
| 71 | 3300005719 | Ga0068861_100307983 | Ga0068861_1003079832 | 339 |
| 72 | 3300006178 | Ga0075367_10006217 | Ga0075367_100062174 | 339 |
| 73 | 3300006914 | Ga0075436_100000751 | Ga0075436_1000007519 | 339 |
| 74 | 3300007076 | Ga0075435_100080167 | Ga0075435_1000801672 | 339 |
| 75 | 3300025922 | Ga0207646_10358364 | Ga0207646_103583642 | 339 |
| 76 | 3300026075 | Ga0207708_10079151 | Ga0207708_100791512 | 339 |
| 77 | 3300047447 | Ga0495685_019208 | Ga0495685_019208_151_1272 | 339 |
| 78 | 3300050494 | nmdc:mga06z11_32793_c1 | nmdc:mga06z11_32793_c1_1292_2410 | 339 |
| 79 | 3300050514 | nmdc:mga08x19_22_c1 | nmdc:mga08x19_22_c1_236725_237843 | 339 |
| 80 | 3300021388 | Ga0213875_10018169 | Ga0213875_100181692 | 340 |
| 81 | 3300005457 | Ga0070662_100055468 | Ga0070662_1000554682 | 341 |
| 82 | 3300025933 | Ga0207706_10029061 | Ga0207706_100290612 | 341 |
| 83 | 3300026142 | Ga0207698_10089313 | Ga0207698_100893131 | 341 |
| 84 | 3300045976 | Ga0466967_0049776 | Ga0466967_0049776_2222_3322 | 342 |
| 85 | 3300031241 | Ga0265325_10001335 | Ga0265325_100013355 | 343 |
| 86 | 3300049589 | Ga0501073_0011498 | Ga0501073_0011498_4040_5125 | 343 |
| 87 | 3300060353 | Ga0501082_0118687 | Ga0501082_0118687_42_1127 | 343 |
| 88 | 3300039437 | Ga0436365_0651981 | Ga0436365_0651981_3341_4459 | 344 |
| 89 | 3300005841 | Ga0068863_100013148 | Ga0068863_1000131483 | 346 |
| 90 | 3300048908 | Ga0496105_0048069 | Ga0496105_0048069_1839_2960 | 347 |
| 91 | 3300048910 | Ga0496107_0074612 | Ga0496107_0074612_839_1960 | 347 |
| 92 | 3300048913 | Ga0496110_0093614 | Ga0496110_0093614_1537_2658 | 347 |
| 93 | 3300048914 | Ga0496111_0115376 | Ga0496111_0115376_573_1694 | 347 |
| 94 | 3300048917 | Ga0496114_0216349 | Ga0496114_0216349_537_1658 | 347 |
| 95 | 3300006048 | Ga0075363_100075198 | Ga0075363_1000751982 | 348 |
| 96 | 3300013307 | Ga0157372_10027752 | Ga0157372_100277524 | 348 |
| 97 | 3300039062 | Ga0400483_280433 | Ga0400483_280433_224_1327 | 348 |
| 98 | 3300037853 | Ga0436364_0732417 | Ga0436364_0732417_302_1426 | 349 |
| 99 | 3300039437 | Ga0436365_0709706 | Ga0436365_0709706_305_1453 | 349 |
| 100 | 3300006186 | Ga0075369_10018780 | Ga0075369_100187804 | 350 |
| 101 | 3300031727 | Ga0316576_10018093 | Ga0316576_100180934 | 350 |
| 102 | 3300031727 | Ga0316576_10084939 | Ga0316576_100849392 | 350 |
| 103 | 3300031727 | Ga0316576_10099947 | Ga0316576_100999472 | 350 |
| 104 | 3300031728 | Ga0316578_10026700 | Ga0316578_100267002 | 350 |
| 105 | 3300035398 | Ga0316574_0029037 | Ga0316574_0029037_895_1956 | 350 |
| 106 | 3300035398 | Ga0316574_0213882 | Ga0316574_0213882_44_1105 | 350 |
| 107 | iso_pu_bacteria | 2899259804 | 2899259993 | 350 |
| 108 | 3300049570 | Ga0501033_0143811 | Ga0501033_0143811_217_1308 | 351 |
| 109 | 3300049571 | Ga0501034_0081914 | Ga0501034_0081914_1607_2698 | 351 |
| 110 | 3300049581 | Ga0501047_0040758 | Ga0501047_0040758_624_1715 | 351 |
| 111 | 3300049584 | Ga0501068_0049876 | Ga0501068_0049876_546_1637 | 351 |
| 112 | 3300049585 | Ga0501069_0042872 | Ga0501069_0042872_863_1954 | 351 |
| 113 | 3300049590 | Ga0501074_0022595 | Ga0501074_0022595_904_1995 | 351 |
| 114 | 3300049822 | Ga0501035_0058754 | Ga0501035_0058754_964_2055 | 351 |
| 115 | 3300049823 | Ga0501044_0088143 | Ga0501044_0088143_1189_2280 | 351 |
| 116 | 3300053153 | Ga0500616_0017963 | Ga0500616_0017963_2152_3276 | 351 |
| 117 | iso_pu_bacteria | 2643221651 | 2644289348 | 351 |
| 118 | iso_pu_bacteria | 2834578030 | 2834578674 | 351 |
| 119 | iso_pu_bacteria | 2854681122 | 2854684283 | 351 |
| 120 | iso_pu_bacteria | 2855020534 | 2855022373 | 351 |
| 121 | iso_pu_bacteria | 2883291878 | 2883295848 | 351 |
| 122 | iso_pu_bacteria | 2883354860 | 2883358630 | 351 |
| 123 | iso_pu_bacteria | 2899275550 | 2899279151 | 351 |
| 124 | iso_pu_bacteria | 2909399089 | 2909400376 | 351 |
| 125 | iso_pu_bacteria | 3000405567 | 3000406887 | 351 |
| 126 | iso_pu_bacteria | 641228493 | 641337188 | 351 |
| 127 | iso_pu_bacteria | 643348555 | 643392640 | 351 |
| 128 | iso_pu_bacteria | 8057132660 | 8057132782 | 351 |
| 129 | iso_pu_bacteria | 2513237087 | 2513589626 | 352 |
| 130 | iso_pu_bacteria | 2522572158 | 2523103905 | 352 |
| 131 | iso_pu_bacteria | 2545555834 | 2545677310 | 352 |
| 132 | iso_pu_bacteria | 2595698237 | 2596373694 | 352 |
| 133 | iso_pu_bacteria | 2643221605 | 2644036997 | 352 |
| 134 | iso_pu_bacteria | 2643221614 | 2644086604 | 352 |
| 135 | iso_pu_bacteria | 2643221661 | 2644341558 | 352 |
| 136 | iso_pu_bacteria | 2643221666 | 2644367845 | 352 |
| 137 | iso_pu_bacteria | 2738541281 | 2738743581 | 352 |
| 138 | iso_pu_bacteria | 2738543032 | 2739352488 | 352 |
| 139 | iso_pu_bacteria | 2821443989 | 2821448695 | 352 |
| 140 | iso_pu_bacteria | 2828305725 | 2828305893 | 352 |
| 141 | iso_pu_bacteria | 2829745981 | 2829750570 | 352 |
| 142 | iso_pu_bacteria | 2842694124 | 2842696258 | 352 |
| 143 | iso_pu_bacteria | 2842698319 | 2842698359 | 352 |
| 144 | iso_pu_bacteria | 2844533157 | 2844538256 | 352 |
| 145 | iso_pu_bacteria | 2848858292 | 2848859174 | 352 |
| 146 | iso_pu_bacteria | 2861691609 | 2861693507 | 352 |
| 147 | iso_pu_bacteria | 2889306138 | 2889307638 | 352 |
| 148 | iso_pu_bacteria | 2897803580 | 2897803772 | 352 |
| 149 | iso_pu_bacteria | 2902330777 | 2902333311 | 352 |
| 150 | iso_pu_bacteria | 2902405164 | 2902407095 | 352 |
| 151 | iso_pu_bacteria | 2928125067 | 2928127274 | 352 |
| 152 | iso_pu_bacteria | 2929199973 | 2929204844 | 352 |
| 153 | iso_pu_bacteria | 641522639 | 641640719 | 352 |
| 154 | iso_pu_bacteria | 643348564 | 643599608 | 352 |
| 155 | iso_pu_bacteria | 8055909800 | 8055914126 | 352 |
| 156 | 3300021388 | Ga0213875_10022871 | Ga0213875_100228712 | 353 |
| 157 | 3300037853 | Ga0436364_0512657 | Ga0436364_0512657_41448_42551 | 353 |
| 158 | 3300028800 | Ga0265338_10029629 | Ga0265338_100296292 | 354 |
| 159 | 3300039437 | Ga0436365_0620663 | Ga0436365_0620663_1861_2961 | 354 |
| 160 | 3300039453 | Ga0436362_0894474 | Ga0436362_0894474_3869_4969 | 354 |
| 161 | 3300005344 | Ga0070661_100069887 | Ga0070661_1000698872 | 355 |
| 162 | 3300005434 | Ga0070709_10010485 | Ga0070709_100104855 | 355 |
| 163 | 3300005435 | Ga0070714_100063830 | Ga0070714_1000638302 | 355 |
| 164 | 3300005435 | Ga0070714_100202341 | Ga0070714_1002023412 | 355 |
| 165 | 3300005436 | Ga0070713_100032450 | Ga0070713_1000324502 | 355 |
| 166 | 3300005456 | Ga0070678_100034419 | Ga0070678_1000344194 | 355 |
| 167 | 3300005458 | Ga0070681_10244100 | Ga0070681_102441001 | 355 |
| 168 | 3300005518 | Ga0070699_100256389 | Ga0070699_1002563892 | 355 |
| 169 | 3300005535 | Ga0070684_100221036 | Ga0070684_1002210361 | 355 |
| 170 | 3300005563 | Ga0068855_100145431 | Ga0068855_1001454312 | 355 |
| 171 | 3300005614 | Ga0068856_100228742 | Ga0068856_1002287422 | 355 |
| 172 | 3300005614 | Ga0068856_100370158 | Ga0068856_1003701581 | 355 |
| 173 | 3300005937 | Ga0081455_10145904 | Ga0081455_101459041 | 355 |
| 174 | 3300009098 | Ga0105245_10006206 | Ga0105245_1000620611 | 355 |
| 175 | 3300009098 | Ga0105245_10377821 | Ga0105245_103778212 | 355 |
| 176 | 3300021388 | Ga0213875_10002098 | Ga0213875_100020985 | 355 |
| 177 | 3300021388 | Ga0213875_10002797 | Ga0213875_100027977 | 355 |
| 178 | 3300025898 | Ga0207692_10010137 | Ga0207692_100101375 | 355 |
| 179 | 3300025906 | Ga0207699_10030819 | Ga0207699_100308193 | 355 |
| 180 | 3300025912 | Ga0207707_10167551 | Ga0207707_101675512 | 355 |
| 181 | 3300025915 | Ga0207693_10008979 | Ga0207693_100089795 | 355 |
| 182 | 3300025921 | Ga0207652_10130769 | Ga0207652_101307691 | 355 |
| 183 | 3300025927 | Ga0207687_10199986 | Ga0207687_101999862 | 355 |
| 184 | 3300025928 | Ga0207700_10039856 | Ga0207700_100398562 | 355 |
| 185 | 3300025928 | Ga0207700_10324622 | Ga0207700_103246221 | 355 |
| 186 | 3300025928 | Ga0207700_10358698 | Ga0207700_103586981 | 355 |
| 187 | 3300025949 | Ga0207667_10349223 | Ga0207667_103492232 | 355 |
| 188 | 3300026121 | Ga0207683_10071973 | Ga0207683_100719733 | 355 |
| 189 | 3300028800 | Ga0265338_10026420 | Ga0265338_100264205 | 355 |
| 190 | 3300028800 | Ga0265338_10125851 | Ga0265338_101258512 | 355 |
| 191 | 3300031250 | Ga0265331_10001082 | Ga0265331_1000108211 | 355 |
| 192 | 3300031344 | Ga0265316_10199949 | Ga0265316_101999492 | 355 |
| 193 | 3300031595 | Ga0265313_10003473 | Ga0265313_100034738 | 355 |
| 194 | 3300031616 | Ga0307508_10067276 | Ga0307508_100672762 | 355 |
| 195 | 3300031711 | Ga0265314_10035984 | Ga0265314_100359842 | 355 |
| 196 | 3300031712 | Ga0265342_10037893 | Ga0265342_100378932 | 355 |
| 197 | 3300035086 | Ga0373934_0014736 | Ga0373934_0014736_1123_2226 | 355 |
| 198 | 3300035111 | Ga0373923_0042197 | Ga0373923_0042197_500_1603 | 355 |
| 199 | 3300035117 | Ga0373953_0004459 | Ga0373953_0004459_989_2092 | 355 |
| 200 | 3300035118 | Ga0373954_0013529 | Ga0373954_0013529_2041_3144 | 355 |
| 201 | 3300035692 | Ga0373935_0244757 | Ga0373935_0244757_66_1169 | 355 |
| 202 | 3300035695 | Ga0373927_0045706 | Ga0373927_0045706_1152_2255 | 355 |
| 203 | 3300035724 | Ga0373933_0045464 | Ga0373933_0045464_777_1880 | 355 |
| 204 | 3300036401 | Ga0373937_0000640 | Ga0373937_0000640_2049_3152 | 355 |
| 205 | 3300036401 | Ga0373937_0033267 | Ga0373937_0033267_2267_3370 | 355 |
| 206 | 3300037068 | Ga0373925_0022148 | Ga0373925_0022148_1822_2925 | 355 |
| 207 | 3300037853 | Ga0436364_1468280 | Ga0436364_1468280_27373_28479 | 355 |
| 208 | 3300037853 | Ga0436364_1480127 | Ga0436364_1480127_10140_11243 | 355 |
| 209 | 3300039437 | Ga0436365_0604472 | Ga0436365_0604472_1227_2330 | 355 |
| 210 | 3300039453 | Ga0436362_0598278 | Ga0436362_0598278_341_1417 | 355 |
| 211 | 3300045051 | Ga0451576_0001652 | Ga0451576_0001652_11546_12649 | 355 |
| 212 | 3300046476 | Ga0495662_0051924 | Ga0495662_0051924_27_1130 | 355 |
| 213 | 3300046476 | Ga0495662_0113609 | Ga0495662_0113609_192_1295 | 355 |
| 214 | 3300046477 | Ga0495664_0001365 | Ga0495664_0001365_5249_6352 | 355 |
| 215 | 3300046516 | Ga0495628_0011302 | Ga0495628_0011302_1625_2728 | 355 |
| 216 | 3300046517 | Ga0495630_0108681 | Ga0495630_0108681_877_1980 | 355 |
| 217 | 3300046529 | Ga0495652_0231178 | Ga0495652_0231178_77_1180 | 355 |
| 218 | 3300046533 | Ga0495640_0024636 | Ga0495640_0024636_1489_2592 | 355 |
| 219 | 3300046536 | Ga0495587_0012418 | Ga0495587_0012418_693_1796 | 355 |
| 220 | 3300046543 | Ga0495645_0000600 | Ga0495645_0000600_23378_24481 | 355 |
| 221 | 3300046678 | Ga0495599_0013498 | Ga0495599_0013498_3196_4299 | 355 |
| 222 | 3300046678 | Ga0495599_0015829 | Ga0495599_0015829_2325_3428 | 355 |
| 223 | 3300046680 | Ga0495646_0089560 | Ga0495646_0089560_547_1650 | 355 |
| 224 | 3300047319 | Ga0495674_0042015 | Ga0495674_0042015_1384_2487 | 355 |
| 225 | 3300047320 | Ga0495672_0042724 | Ga0495672_0042724_361_1443 | 355 |
| 226 | 3300047322 | Ga0495680_0060318 | Ga0495680_0060318_524_1627 | 355 |
| 227 | 3300047444 | Ga0495675_0123471 | Ga0495675_0123471_131_1234 | 355 |
| 228 | 3300048088 | Ga0495602_0003217 | Ga0495602_0003217_14349_15452 | 355 |
| 229 | 3300048088 | Ga0495602_0069658 | Ga0495602_0069658_1106_2209 | 355 |
| 230 | 3300048922 | Ga0496119_0008877 | Ga0496119_0008877_3874_4977 | 355 |
| 231 | 3300049571 | Ga0501034_0453557 | Ga0501034_0453557_55_1137 | 355 |
| 232 | 3300049574 | Ga0501038_0289460 | Ga0501038_0289460_53_1132 | 355 |
| 233 | 3300049581 | Ga0501047_0123565 | Ga0501047_0123565_1102_2187 | 355 |
| 234 | 3300049589 | Ga0501073_0077058 | Ga0501073_0077058_329_1414 | 355 |
| 235 | 3300049823 | Ga0501044_0274337 | Ga0501044_0274337_38_1120 | 355 |
| 236 | 3300049823 | Ga0501044_0275025 | Ga0501044_0275025_440_1543 | 355 |
| 237 | 3300053077 | Ga0495601_0014228 | Ga0495601_0014228_290_1393 | 355 |
| 238 | 3300053077 | Ga0495601_0231048 | Ga0495601_0231048_52_1155 | 355 |
| 239 | 3300053078 | Ga0495612_0000471 | Ga0495612_0000471_11740_12843 | 355 |
| 240 | 3300053084 | Ga0495595_0002863 | Ga0495595_0002863_4314_5417 | 355 |
| 241 | 3300053084 | Ga0495595_0043605 | Ga0495595_0043605_570_1673 | 355 |
| 242 | 3300053153 | Ga0500616_0000028 | Ga0500616_0000028_236441_237520 | 355 |
| 243 | 3300060353 | Ga0501082_0132553 | Ga0501082_0132553_1003_2088 | 355 |
| 244 | 3300003187 | JGI25151J46595_10000535 | JGI25151J46595_1000053516 | 356 |
| 245 | 3300003203 | JGI25406J46586_10000707 | JGI25406J46586_100007072 | 356 |
| 246 | 3300005339 | Ga0070660_100136303 | Ga0070660_1001363032 | 356 |
| 247 | 3300005344 | Ga0070661_100283379 | Ga0070661_1002833791 | 356 |
| 248 | 3300005355 | Ga0070671_100322916 | Ga0070671_1003229161 | 356 |
| 249 | 3300005563 | Ga0068855_100001158 | Ga0068855_1000011586 | 356 |
| 250 | 3300005618 | Ga0068864_100062657 | Ga0068864_1000626572 | 356 |
| 251 | 3300005985 | Ga0081539_10000054 | Ga0081539_10000054194 | 356 |
| 252 | 3300009093 | Ga0105240_10025206 | Ga0105240_100252066 | 356 |
| 253 | 3300009094 | Ga0111539_10039262 | Ga0111539_100392622 | 356 |
| 254 | 3300009177 | Ga0105248_10019306 | Ga0105248_100193067 | 356 |
| 255 | 3300010375 | Ga0105239_10000105 | Ga0105239_10000105105 | 356 |
| 256 | 3300021388 | Ga0213875_10013929 | Ga0213875_100139293 | 356 |
| 257 | 3300021388 | Ga0213875_10015867 | Ga0213875_100158673 | 356 |
| 258 | 3300025284 | Ga0209130_1002834 | Ga0209130_10028346 | 356 |
| 259 | 3300025294 | Ga0209025_1000146 | Ga0209025_1000146156 | 356 |
| 260 | 3300025297 | Ga0209758_1004822 | Ga0209758_10048227 | 356 |
| 261 | 3300025302 | Ga0207426_1000046 | Ga0207426_1000046237 | 356 |
| 262 | 3300025913 | Ga0207695_10010961 | Ga0207695_100109616 | 356 |
| 263 | 3300025919 | Ga0207657_10112086 | Ga0207657_101120863 | 356 |
| 264 | 3300025921 | Ga0207652_10151461 | Ga0207652_101514612 | 356 |
| 265 | 3300025941 | Ga0207711_10002689 | Ga0207711_100026899 | 356 |
| 266 | 3300025949 | Ga0207667_10077994 | Ga0207667_100779943 | 356 |
| 267 | 3300028379 | Ga0268266_10000514 | Ga0268266_1000051418 | 356 |
| 268 | 3300028379 | Ga0268266_10167521 | Ga0268266_101675213 | 356 |
| 269 | 3300028380 | Ga0268265_10313679 | Ga0268265_103136791 | 356 |
| 270 | 3300028381 | Ga0268264_10063739 | Ga0268264_100637391 | 356 |
| 271 | 3300028800 | Ga0265338_10050725 | Ga0265338_100507253 | 356 |
| 272 | 3300031247 | Ga0265340_10064963 | Ga0265340_100649632 | 356 |
| 273 | 3300031250 | Ga0265331_10001721 | Ga0265331_100017214 | 356 |
| 274 | 3300037853 | Ga0436364_0656171 | Ga0436364_0656171_10644_11792 | 356 |
| 275 | 3300039437 | Ga0436365_0142693 | Ga0436365_0142693_142_1248 | 356 |
| 276 | 3300039438 | Ga0436360_0962259 | Ga0436360_0962259_1410_2546 | 356 |
| 277 | 3300039438 | Ga0436360_1017874 | Ga0436360_1017874_958_2067 | 356 |
| 278 | 3300044735 | Ga0466968_0003779 | Ga0466968_0003779_3295_4395 | 356 |
| 279 | 3300046460 | Ga0495638_0074985 | Ga0495638_0074985_850_1965 | 356 |
| 280 | 3300048922 | Ga0496119_0000515 | Ga0496119_0000515_21477_22589 | 356 |
| 281 | 3300048925 | Ga0496122_0001603 | Ga0496122_0001603_8150_9262 | 356 |
| 282 | 3300048926 | Ga0496123_0000995 | Ga0496123_0000995_6518_7630 | 356 |
| 283 | 3300048928 | Ga0496125_0097596 | Ga0496125_0097596_143_1267 | 356 |
| 284 | 3300049515 | Ga0501292_000059 | Ga0501292_000059_19399_20472 | 356 |
| 285 | 3300049581 | Ga0501047_0243381 | Ga0501047_0243381_166_1251 | 356 |
| 286 | 3300049588 | Ga0501072_0079227 | Ga0501072_0079227_855_1958 | 356 |
| 287 | 3300049590 | Ga0501074_0020386 | Ga0501074_0020386_3412_4515 | 356 |
| 288 | 3300049653 | Ga0501206_000591 | Ga0501206_000591_1743_2816 | 356 |
| 289 | 3300049664 | Ga0501224_000416 | Ga0501224_000416_2167_3240 | 356 |
| 290 | 3300049690 | Ga0501261_000109 | Ga0501261_000109_9836_10909 | 356 |
| 291 | 3300049742 | Ga0501080_0107914 | Ga0501080_0107914_1446_2549 | 356 |
| 292 | 3300049744 | Ga0501083_0026587 | Ga0501083_0026587_2583_3704 | 356 |
| 293 | 3300049775 | Ga0501279_001289 | Ga0501279_001289_501_1574 | 356 |
| 294 | 3300049778 | Ga0501282_000082 | Ga0501282_000082_7345_8418 | 356 |
| 295 | 3300049823 | Ga0501044_0000263 | Ga0501044_0000263_37802_38926 | 356 |
| 296 | 3300050511 | nmdc:mga08y16_5270_c1 | nmdc:mga08y16_5270_c1_552_1676 | 356 |
| 297 | 3300053104 | Ga0500556_0000075 | Ga0500556_0000075_81697_82809 | 356 |
| 298 | 3300053142 | Ga0500577_0023217 | Ga0500577_0023217_416_1531 | 356 |
| 299 | 3300053730 | Ga0500645_012025 | Ga0500645_012025_1670_2782 | 356 |
| 300 | 3300054114 | Ga0501084_0012456 | Ga0501084_0012456_1183_2286 | 356 |
| 301 | 3300060353 | Ga0501082_0000772 | Ga0501082_0000772_8258_9355 | 356 |
| 302 | iso_pu_bacteria | 3003665799 | 3003672492 | 356 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z9a-assembly1.cif.gz_B | crystal structure of chorismate synthase from pseudomonas aeruginosa | 0.9288 | 1 | 352 |
| 5z9a-assembly1.cif.gz_A | crystal structure of chorismate synthase from pseudomonas aeruginosa | 0.9263 | 1 | 353 |
| 5z9a-assembly1.cif.gz_A | crystal structure of chorismate synthase from pseudomonas aeruginosa | 0.919 | 1 | 353 |
| 5z9a-assembly1.cif.gz_B | crystal structure of chorismate synthase from pseudomonas aeruginosa | 0.918 | 1 | 352 |
| 1qxo-assembly1.cif.gz_C | crystal structure of chorismate synthase complexed with oxidized fmn and epsp | 0.9079 | 11 | 351 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58575_11_372_3.60.150.10 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9643 | 9 | 350 | 3.60.150.10 |
| af_A0A1D8PTK1_42_412_3.60.150.10 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9537 | 9 | 355 | 3.60.150.10 |
| af_P12008_1_360_3.60.150.10 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9497 | 1 | 353 | 3.60.150.10 |
| af_P28777_108_376_3.60.150.10 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9456 | 111 | 355 | 3.60.150.10 |
| af_P12008_1_360_3.60.150.10 | Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC | 0.9287 | 1 | 353 | 3.60.150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G1XZG7-F1-model_v4 | deleted | 0.9925 | 148 | 354 |
|
| AF-A0A2E1B9F5-F1-model_v4 | Chorismate synthase (EC 4.2.3.5) | 0.9909 | 126 | 354 |
GO:0004107
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0010181 |
| AF-A0A7V8A7J6-F1-model_v4 | chorismate synthase (EC 4.2.3.5) | 0.9847 | 191 | 356 |
GO:0004107
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0010181 |
| AF-A0A519PBF2-F1-model_v4 | Chorismate synthase (EC 4.2.3.5) | 0.984 | 41 | 354 |
GO:0004107
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0010181 |
| AF-A0A382USP1-F1-model_v4 | chorismate synthase (EC 4.2.3.5) | 0.9831 | 129 | 356 |
GO:0004107
GO:0005829 GO:0008652 GO:0009073 GO:0009423 GO:0010181 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar