F396783

General Info

Members Datasets Scaffolds Average Seq Length
302 224 261 360

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3003665799|3003672492
Length 413
Sequence RGAGLHGLGPAPASRPPTDGIDVRDHFPSGAKCSRAAASSLVAAMSHNSFGHLFRVTTFGESHGPALGCVVDGCPPLIPLEAAEIQAELDRRRPGQSRFTTQRQEPDQVRILSGVFSDDRTEGRQLTTGTPIALMIENVDQRSKDYSEIRDSYRPGHADYAYDAKYGIRDYRGGGRSSARETAARVAAGAVARKVLPGVTIRGALVQIGPHAIDRARFDWDEVNNNPFFCPDPVAAGQWAEYLDGIRKAGSSVGAVIEVVAEGVPVGLGAPVYGKLDADLAAAMMSINAVKGVEIGDGFAAAALRGEENADEMRPGNDGRPIFLANHAGGVLGGISTGQPLVCRFAVKPTSSILTPRASVSRDNRPVDVMTKGRHDPCVGIRAVPVGEAMMACVLADHWLRHRGQVGEGIQPA

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
5 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
6 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
7 2643221651 Afipia sp. Root123D2 Isolate Unclassified
8 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
9 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
10 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
11 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
12 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
13 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
14 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
15 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
16 2842694124 Methylopila sp. R-72369 Isolate Unclassified
17 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
18 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
19 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
20 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
21 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
22 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
23 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
24 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
25 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
26 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
27 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
28 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
29 2902330777 Methylobacterium sp. 2A Isolate Unclassified
30 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
31 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
32 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
33 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
34 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
35 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
195 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
196 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
200 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
220 641522639 Methylobacterium sp. 4-46 Isolate Nodule
221 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
222 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
223 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
224 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.42
Metatranscriptomes 0
Isolates 13.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 1.32
Rhizoplane 2.32
Rhizosphere 72.19
Stem 0
Stem Tuber 0.33
Unclassified 17.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000535 3300003187 Bacteria 35206
2 JGI25406J46586_10000707 3300003203 Bacteria 15594
3 Ga0070660_100136303 3300005339 Bacteria 1967
4 Ga0070661_100069887 3300005344 Bacteria 2582
5 Ga0070661_100283379 3300005344 Bacteria 1286
6 Ga0070675_100287098 3300005354 Bacteria 1447
7 Ga0070671_100322916 3300005355 Bacteria 1316
8 Ga0070674_100005478 3300005356 Bacteria 7333
9 Ga0070709_10010485 3300005434 Bacteria 5134
10 Ga0070714_100063830 3300005435 Bacteria 3168
11 Ga0070714_100202341 3300005435 Bacteria 1817
12 Ga0070713_100032450 3300005436 Bacteria 4171
13 Ga0070678_100034419 3300005456 Bacteria 3528
14 Ga0070678_100038383 3300005456 Bacteria 3371
15 Ga0070662_100055468 3300005457 Bacteria 2875
16 Ga0070681_10244100 3300005458 Bacteria 1709
17 Ga0070699_100256389 3300005518 Bacteria 1564
18 Ga0070684_100221036 3300005535 Bacteria 1728
19 Ga0070697_100006439 3300005536 Bacteria 9090
20 Ga0070695_100008461 3300005545 Bacteria 6104
21 Ga0068855_100001158 3300005563 Bacteria 32691
22 Ga0068855_100145431 3300005563 Bacteria 2699
23 Ga0068856_100228742 3300005614 Bacteria 1875
24 Ga0068856_100370158 3300005614 Bacteria 1452
25 Ga0068864_100062657 3300005618 Bacteria 3222
26 Ga0068861_100307983 3300005719 Bacteria 1374
27 Ga0068863_100013148 3300005841 Bacteria 7990
28 Ga0081455_10145904 3300005937 Bacteria 1831
29 Ga0081539_10000054 3300005985 Bacteria 259053
30 Ga0075363_100075198 3300006048 Bacteria 1840
31 Ga0070712_100190983 3300006175 Bacteria 1603
32 Ga0075367_10006217 3300006178 Bacteria 6014
33 Ga0075369_10018780 3300006186 Bacteria 2818
34 Ga0075370_10023807 3300006353 Bacteria 3377
35 Ga0075436_100000751 3300006914 Bacteria 21452
36 Ga0075435_100080167 3300007076 Bacteria 2680
37 Ga0105240_10025206 3300009093 Bacteria 7822
38 Ga0111539_10039262 3300009094 Bacteria 5707
39 Ga0111539_10198136 3300009094 Bacteria 2342
40 Ga0105245_10006206 3300009098 Bacteria 10512
41 Ga0105245_10377821 3300009098 Bacteria 1410
42 Ga0105248_10019306 3300009177 Bacteria 7542
43 Ga0105239_10000105 3300010375 Bacteria 117635
44 Ga0157372_10027752 3300013307 Bacteria 6170
45 Ga0213876_10002190 3300021384 Bacteria 11526
46 Ga0213875_10002098 3300021388 Bacteria 12228
47 Ga0213875_10002797 3300021388 Bacteria 10263
48 Ga0213875_10013929 3300021388 Bacteria 3933
49 Ga0213875_10015867 3300021388 Bacteria 3659
50 Ga0213875_10018169 3300021388 Bacteria 3391
51 Ga0213875_10022871 3300021388 Bacteria 2988
52 Ga0209130_1002834 3300025284 Bacteria 8050
53 Ga0209025_1000146 3300025294 Bacteria 180022
54 Ga0209758_1004822 3300025297 Bacteria 10888
55 Ga0207426_1000046 3300025302 Bacteria 422271
56 Ga0207682_10000502 3300025893 Bacteria 17995
57 Ga0207692_10010137 3300025898 Bacteria 3960
58 Ga0207642_10014608 3300025899 Bacteria 2902
59 Ga0207688_10073178 3300025901 Bacteria 1947
60 Ga0207680_10114671 3300025903 Bacteria 1754
61 Ga0207699_10030819 3300025906 Bacteria 3005
62 Ga0207645_10044975 3300025907 Bacteria 2823
63 Ga0207707_10167551 3300025912 Bacteria 1920
64 Ga0207695_10010961 3300025913 Bacteria 11024
65 Ga0207693_10008979 3300025915 Bacteria 8156
66 Ga0207657_10112086 3300025919 Bacteria 2252
67 Ga0207652_10130769 3300025921 Bacteria 2239
68 Ga0207652_10151461 3300025921 Bacteria 2077
69 Ga0207646_10358364 3300025922 Bacteria 1318
70 Ga0207659_10117943 3300025926 Bacteria 2029
71 Ga0207687_10199986 3300025927 Bacteria 1561
72 Ga0207700_10039856 3300025928 Bacteria 3424
73 Ga0207700_10324622 3300025928 Bacteria 1335
74 Ga0207700_10358698 3300025928 Bacteria 1271
75 Ga0207706_10029061 3300025933 Bacteria 4937
76 Ga0207669_10037659 3300025937 Bacteria 2777
77 Ga0207691_10001713 3300025940 Bacteria 21596
78 Ga0207711_10002689 3300025941 Bacteria 15719
79 Ga0207667_10077994 3300025949 Bacteria 3434
80 Ga0207667_10349223 3300025949 Bacteria 1509
81 Ga0207708_10079151 3300026075 Bacteria 2524
82 Ga0207648_10023152 3300026089 Bacteria 5571
83 Ga0207683_10002207 3300026121 Bacteria 17110
84 Ga0207683_10071973 3300026121 Bacteria 3057
85 Ga0207683_10229422 3300026121 Bacteria 1693
86 Ga0207698_10089313 3300026142 Bacteria 2516
87 Ga0268266_10000514 3300028379 Bacteria 54510
88 Ga0268266_10167521 3300028379 Bacteria 1992
89 Ga0268265_10313679 3300028380 Bacteria 1417
90 Ga0268264_10063739 3300028381 Bacteria 3100
91 Ga0265338_10026420 3300028800 Bacteria 5856
92 Ga0265338_10029629 3300028800 Bacteria 5419
93 Ga0265338_10050725 3300028800 Bacteria 3746
94 Ga0265338_10125851 3300028800 Bacteria 2034
95 Ga0265325_10001335 3300031241 Bacteria 17486
96 Ga0265340_10064963 3300031247 Bacteria 1738
97 Ga0265331_10001082 3300031250 Bacteria 20989
98 Ga0265331_10001721 3300031250 Bacteria 15754
99 Ga0265316_10199949 3300031344 Bacteria 1482
100 Ga0307513_10095076 3300031456 Bacteria 3022
101 Ga0265313_10003473 3300031595 Bacteria 12725
102 Ga0307508_10067276 3300031616 Bacteria 3151
103 Ga0265314_10035984 3300031711 Bacteria 3603
104 Ga0265342_10037893 3300031712 Bacteria 2938
105 Ga0316576_10018093 3300031727 Bacteria 4803
106 Ga0316576_10041083 3300031727 Bacteria 3327
107 Ga0316576_10084939 3300031727 Bacteria 2352
108 Ga0316576_10099947 3300031727 Bacteria 2167
109 Ga0316578_10002431 3300031728 Bacteria 8166
110 Ga0316578_10026700 3300031728 Bacteria 3258
111 Ga0373934_0014736 3300035086 Bacteria 2962
112 Ga0373923_0042197 3300035111 Bacteria 1883
113 Ga0373953_0004459 3300035117 Bacteria 4467
114 Ga0373954_0013529 3300035118 Bacteria 3638
115 Ga0373962_0049135 3300035242 Bacteria 1212
116 Ga0316574_0029037 3300035398 Bacteria 3339
117 Ga0316574_0213882 3300035398 Bacteria 1236
118 Ga0373935_0244757 3300035692 Bacteria 1253
119 Ga0373927_0045706 3300035695 Bacteria 2832
120 Ga0373933_0045464 3300035724 Bacteria 2604
121 Ga0373937_0000640 3300036401 Bacteria 30696
122 Ga0373937_0033267 3300036401 Bacteria 4681
123 Ga0373937_0165108 3300036401 Bacteria 2076
124 Ga0373925_0022148 3300037068 Bacteria 4633
125 Ga0436364_0512657 3300037853 Bacteria 42864
126 Ga0436364_0656171 3300037853 Bacteria 13437
127 Ga0436364_0732417 3300037853 Bacteria 1662
128 Ga0436364_1468280 3300037853 Bacteria 60501
129 Ga0436364_1480127 3300037853 Bacteria 34894
130 Ga0400483_280433 3300039062 Bacteria 5048
131 Ga0436365_0097042 3300039437 Bacteria 195024
132 Ga0436365_0142693 3300039437 Bacteria 1813
133 Ga0436365_0604472 3300039437 Bacteria 2561
134 Ga0436365_0620663 3300039437 Bacteria 3539
135 Ga0436365_0651981 3300039437 Bacteria 6884
136 Ga0436365_0709706 3300039437 Bacteria 1525
137 Ga0436360_0962259 3300039438 Bacteria 2835
138 Ga0436360_1017874 3300039438 Bacteria 2320
139 Ga0436361_1160729 3300039447 Bacteria 3430
140 Ga0436362_0598278 3300039453 Bacteria 2148
141 Ga0436362_0894474 3300039453 Bacteria 7063
142 Ga0439453_0000074 3300041408 Bacteria 7439
143 Ga0466972_0149766 3300044658 Bacteria 1097
144 Ga0466963_0024993 3300044694 Bacteria 3805
145 Ga0466968_0003779 3300044735 Bacteria 5610
146 Ga0451576_0001652 3300045051 Bacteria 37060
147 Ga0466967_0007437 3300045976 Bacteria 7900
148 Ga0466967_0049776 3300045976 Bacteria 3667
149 Ga0495590_0013859 3300046457 Bacteria 2956
150 Ga0495638_0074985 3300046460 Bacteria 2062
151 Ga0495638_0176108 3300046460 Bacteria 1224
152 Ga0495662_0051924 3300046476 Bacteria 1979
153 Ga0495662_0113609 3300046476 Bacteria 1328
154 Ga0495664_0001365 3300046477 Bacteria 12892
155 Ga0495628_0011302 3300046516 Bacteria 7553
156 Ga0495630_0108681 3300046517 Bacteria 2101
157 Ga0495652_0231178 3300046529 Bacteria 1383
158 Ga0495640_0024636 3300046533 Bacteria 4376
159 Ga0495587_0012418 3300046536 Bacteria 5360
160 Ga0495587_0196593 3300046536 Bacteria 1141
161 Ga0495598_0019247 3300046537 Bacteria 1787
162 Ga0495621_0003932 3300046539 Bacteria 4132
163 Ga0495645_0000600 3300046543 Bacteria 24865
164 Ga0495622_0000699 3300046557 Bacteria 19021
165 Ga0495611_0031141 3300046648 Bacteria 2347
166 Ga0495599_0013498 3300046678 Bacteria 5047
167 Ga0495599_0015829 3300046678 Bacteria 4682
168 Ga0495646_0089560 3300046680 Bacteria 1780
169 Ga0495649_0047917 3300046694 Bacteria 2323
170 Ga0495674_0042015 3300047319 Bacteria 4081
171 Ga0495672_0006288 3300047320 Bacteria 9244
172 Ga0495672_0042724 3300047320 Bacteria 2731
173 Ga0495680_0060318 3300047322 Bacteria 2925
174 Ga0495683_0054915 3300047323 Bacteria 1984
175 Ga0495675_0123471 3300047444 Bacteria 1612
176 Ga0495685_019208 3300047447 Bacteria 2348
177 Ga0495686_0048876 3300047472 Bacteria 2665
178 Ga0495686_0070239 3300047472 Bacteria 2158
179 Ga0495602_0003217 3300048088 Bacteria 16863
180 Ga0495602_0069658 3300048088 Bacteria 3014
181 Ga0496100_0073550 3300048903 Bacteria 2288
182 Ga0496100_0215008 3300048903 Bacteria 1408
183 Ga0496105_0048069 3300048908 Bacteria 3522
184 Ga0496107_0074612 3300048910 Bacteria 2468
185 Ga0496110_0093614 3300048913 Bacteria 2690
186 Ga0496111_0115376 3300048914 Bacteria 1980
187 Ga0496114_0216349 3300048917 Bacteria 1681
188 Ga0496119_0000515 3300048922 Bacteria 52633
189 Ga0496119_0008877 3300048922 Bacteria 8743
190 Ga0496122_0001603 3300048925 Bacteria 35394
191 Ga0496123_0000995 3300048926 Bacteria 43400
192 Ga0496125_0097596 3300048928 Bacteria 2177
193 Ga0501292_000059 3300049515 Bacteria 22245
194 Ga0501031_0184125 3300049568 Bacteria 1364
195 Ga0501032_0032836 3300049569 Bacteria 3556
196 Ga0501033_0004499 3300049570 Bacteria 11156
197 Ga0501033_0143811 3300049570 Bacteria 1724
198 Ga0501034_0081914 3300049571 Bacteria 3229
199 Ga0501034_0453557 3300049571 Bacteria 1200
200 Ga0501036_0006781 3300049572 Bacteria 9302
201 Ga0501038_0019903 3300049574 Bacteria 6040
202 Ga0501038_0040577 3300049574 Bacteria 4063
203 Ga0501038_0289460 3300049574 Bacteria 1288
204 Ga0501039_0002217 3300049575 Bacteria 14363
205 Ga0501039_0036267 3300049575 Bacteria 3805
206 Ga0501043_0002292 3300049579 Bacteria 16231
207 Ga0501046_0007514 3300049580 Bacteria 9561
208 Ga0501047_0006215 3300049581 Bacteria 11224
209 Ga0501047_0036499 3300049581 Bacteria 4750
210 Ga0501047_0040758 3300049581 Bacteria 4490
211 Ga0501047_0123565 3300049581 Bacteria 2469
212 Ga0501047_0243381 3300049581 Bacteria 1649
213 Ga0501068_0049876 3300049584 Bacteria 2529
214 Ga0501069_0003277 3300049585 Bacteria 8308
215 Ga0501069_0042872 3300049585 Bacteria 2504
216 Ga0501070_0007401 3300049586 Bacteria 9326
217 Ga0501072_0079227 3300049588 Bacteria 2601
218 Ga0501073_0011498 3300049589 Bacteria 6472
219 Ga0501073_0019009 3300049589 Bacteria 4964
220 Ga0501073_0077058 3300049589 Bacteria 2320
221 Ga0501074_0020386 3300049590 Bacteria 4819
222 Ga0501074_0022595 3300049590 Bacteria 4572
223 Ga0501074_0025115 3300049590 Bacteria 4328
224 Ga0501206_000591 3300049653 Bacteria 4384
225 Ga0501224_000416 3300049664 Bacteria 5085
226 Ga0501261_000109 3300049690 Bacteria 12572
227 Ga0501080_0007993 3300049742 Bacteria 9585
228 Ga0501080_0107914 3300049742 Bacteria 2580
229 Ga0501083_0026587 3300049744 Bacteria 3999
230 Ga0501083_0150792 3300049744 Bacteria 1522
231 Ga0501279_001289 3300049775 Bacteria 3300
232 Ga0501282_000082 3300049778 Bacteria 11042
233 Ga0501035_0017347 3300049822 Bacteria 6638
234 Ga0501035_0058754 3300049822 Bacteria 3426
235 Ga0501044_0000263 3300049823 Bacteria 66364
236 Ga0501044_0018628 3300049823 Bacteria 7436
237 Ga0501044_0088143 3300049823 Bacteria 3133
238 Ga0501044_0117887 3300049823 Bacteria 2658
239 Ga0501044_0274337 3300049823 Bacteria 1621
240 Ga0501044_0275025 3300049823 Bacteria 1619
241 nmdc:mga00v17_129978_c1 3300050491 Bacteria 1609
242 nmdc:mga06z11_32793_c1 3300050494 Bacteria 2535
243 nmdc:mga08y16_5270_c1 3300050511 Bacteria 13511
244 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
245 Ga0495601_0014228 3300053077 Bacteria 4794
246 Ga0495601_0231048 3300053077 Bacteria 1208
247 Ga0495612_0000471 3300053078 Bacteria 16213
248 Ga0495595_0002863 3300053084 Bacteria 6800
249 Ga0495595_0043605 3300053084 Bacteria 2058
250 Ga0500578_0049661 3300053086 Bacteria 2691
251 Ga0500641_0049379 3300053096 Bacteria 1725
252 Ga0500556_0000075 3300053104 Bacteria 97335
253 Ga0500658_0012245 3300053134 Bacteria 3161
254 Ga0500577_0023217 3300053142 Bacteria 2069
255 Ga0500616_0000028 3300053153 Bacteria 435722
256 Ga0500616_0017963 3300053153 Bacteria 4004
257 Ga0500645_012025 3300053730 Bacteria 2806
258 Ga0501084_0012456 3300054114 Bacteria 7047
259 Ga0501082_0000772 3300060353 Bacteria 28062
260 Ga0501082_0118687 3300060353 Bacteria 2292
261 Ga0501082_0132553 3300060353 Bacteria 2162

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0184125 Ga0501031_0184125_344_1354 313
2 3300048903 Ga0496100_0215008 Ga0496100_0215008_20_1042 314
3 3300039447 Ga0436361_1160729 Ga0436361_1160729_807_1907 324
4 3300044658 Ga0466972_0149766 Ga0466972_0149766_14_1033 324
5 3300049572 Ga0501036_0006781 Ga0501036_0006781_2376_3491 324
6 3300049574 Ga0501038_0040577 Ga0501038_0040577_1765_2940 324
7 3300049575 Ga0501039_0036267 Ga0501039_0036267_552_1727 324
8 3300049581 Ga0501047_0036499 Ga0501047_0036499_1326_2501 324
9 3300049744 Ga0501083_0150792 Ga0501083_0150792_296_1411 324
10 3300005354 Ga0070675_100287098 Ga0070675_1002870982 329
11 3300005356 Ga0070674_100005478 Ga0070674_1000054782 329
12 3300005456 Ga0070678_100038383 Ga0070678_1000383831 329
13 3300025893 Ga0207682_10000502 Ga0207682_100005029 329
14 3300025899 Ga0207642_10014608 Ga0207642_100146082 329
15 3300025901 Ga0207688_10073178 Ga0207688_100731782 329
16 3300025903 Ga0207680_10114671 Ga0207680_101146712 329
17 3300025907 Ga0207645_10044975 Ga0207645_100449752 329
18 3300025926 Ga0207659_10117943 Ga0207659_101179432 329
19 3300025937 Ga0207669_10037659 Ga0207669_100376592 329
20 3300025940 Ga0207691_10001713 Ga0207691_1000171321 329
21 3300026089 Ga0207648_10023152 Ga0207648_100231521 329
22 3300026121 Ga0207683_10002207 Ga0207683_100022073 329
23 3300035242 Ga0373962_0049135 Ga0373962_0049135_16_1146 329
24 3300046537 Ga0495598_0019247 Ga0495598_0019247_264_1385 329
25 3300046539 Ga0495621_0003932 Ga0495621_0003932_1788_2909 329
26 3300036401 Ga0373937_0165108 Ga0373937_0165108_1022_2050 330
27 3300046536 Ga0495587_0196593 Ga0495587_0196593_90_1118 330
28 3300006353 Ga0075370_10023807 Ga0075370_100238072 332
29 3300044694 Ga0466963_0024993 Ga0466963_0024993_243_1361 332
30 3300045976 Ga0466967_0007437 Ga0466967_0007437_1323_2441 332
31 3300046460 Ga0495638_0176108 Ga0495638_0176108_17_1129 332
32 3300050491 nmdc:mga00v17_129978_c1 nmdc:mga00v17_129978_c1_256_1368 332
33 3300053086 Ga0500578_0049661 Ga0500578_0049661_911_1996 333
34 3300031456 Ga0307513_10095076 Ga0307513_100950761 334
35 3300041408 Ga0439453_0000074 Ga0439453_0000074_6124_7248 334
36 3300006175 Ga0070712_100190983 Ga0070712_1001909831 335
37 3300047472 Ga0495686_0048876 Ga0495686_0048876_1364_2452 335
38 3300049823 Ga0501044_0117887 Ga0501044_0117887_16_1035 335
39 3300053096 Ga0500641_0049379 Ga0500641_0049379_533_1621 335
40 3300009094 Ga0111539_10198136 Ga0111539_101981361 336
41 3300026121 Ga0207683_10229422 Ga0207683_102294222 336
42 3300031727 Ga0316576_10041083 Ga0316576_100410833 336
43 3300031728 Ga0316578_10002431 Ga0316578_100024314 336
44 3300046457 Ga0495590_0013859 Ga0495590_0013859_1108_2238 336
45 3300046557 Ga0495622_0000699 Ga0495622_0000699_5789_6919 336
46 3300046648 Ga0495611_0031141 Ga0495611_0031141_162_1292 336
47 3300046694 Ga0495649_0047917 Ga0495649_0047917_23_1153 336
48 3300047320 Ga0495672_0006288 Ga0495672_0006288_4363_5493 336
49 3300047323 Ga0495683_0054915 Ga0495683_0054915_42_1148 336
50 3300053134 Ga0500658_0012245 Ga0500658_0012245_1819_2904 336
51 3300021384 Ga0213876_10002190 Ga0213876_100021909 337
52 3300039437 Ga0436365_0097042 Ga0436365_0097042_117715_118824 337
53 3300047472 Ga0495686_0070239 Ga0495686_0070239_420_1511 338
54 3300048903 Ga0496100_0073550 Ga0496100_0073550_819_1934 338
55 3300049569 Ga0501032_0032836 Ga0501032_0032836_1394_2479 338
56 3300049570 Ga0501033_0004499 Ga0501033_0004499_5077_6162 338
57 3300049574 Ga0501038_0019903 Ga0501038_0019903_2279_3364 338
58 3300049575 Ga0501039_0002217 Ga0501039_0002217_4018_5103 338
59 3300049579 Ga0501043_0002292 Ga0501043_0002292_10939_12024 338
60 3300049580 Ga0501046_0007514 Ga0501046_0007514_7398_8483 338
61 3300049581 Ga0501047_0006215 Ga0501047_0006215_5278_6363 338
62 3300049585 Ga0501069_0003277 Ga0501069_0003277_5856_6941 338
63 3300049586 Ga0501070_0007401 Ga0501070_0007401_1522_2607 338
64 3300049589 Ga0501073_0019009 Ga0501073_0019009_2802_3887 338
65 3300049590 Ga0501074_0025115 Ga0501074_0025115_1367_2452 338
66 3300049742 Ga0501080_0007993 Ga0501080_0007993_4734_5819 338
67 3300049822 Ga0501035_0017347 Ga0501035_0017347_5098_6183 338
68 3300049823 Ga0501044_0018628 Ga0501044_0018628_1368_2453 338
69 3300005536 Ga0070697_100006439 Ga0070697_1000064399 339
70 3300005545 Ga0070695_100008461 Ga0070695_1000084613 339
71 3300005719 Ga0068861_100307983 Ga0068861_1003079832 339
72 3300006178 Ga0075367_10006217 Ga0075367_100062174 339
73 3300006914 Ga0075436_100000751 Ga0075436_1000007519 339
74 3300007076 Ga0075435_100080167 Ga0075435_1000801672 339
75 3300025922 Ga0207646_10358364 Ga0207646_103583642 339
76 3300026075 Ga0207708_10079151 Ga0207708_100791512 339
77 3300047447 Ga0495685_019208 Ga0495685_019208_151_1272 339
78 3300050494 nmdc:mga06z11_32793_c1 nmdc:mga06z11_32793_c1_1292_2410 339
79 3300050514 nmdc:mga08x19_22_c1 nmdc:mga08x19_22_c1_236725_237843 339
80 3300021388 Ga0213875_10018169 Ga0213875_100181692 340
81 3300005457 Ga0070662_100055468 Ga0070662_1000554682 341
82 3300025933 Ga0207706_10029061 Ga0207706_100290612 341
83 3300026142 Ga0207698_10089313 Ga0207698_100893131 341
84 3300045976 Ga0466967_0049776 Ga0466967_0049776_2222_3322 342
85 3300031241 Ga0265325_10001335 Ga0265325_100013355 343
86 3300049589 Ga0501073_0011498 Ga0501073_0011498_4040_5125 343
87 3300060353 Ga0501082_0118687 Ga0501082_0118687_42_1127 343
88 3300039437 Ga0436365_0651981 Ga0436365_0651981_3341_4459 344
89 3300005841 Ga0068863_100013148 Ga0068863_1000131483 346
90 3300048908 Ga0496105_0048069 Ga0496105_0048069_1839_2960 347
91 3300048910 Ga0496107_0074612 Ga0496107_0074612_839_1960 347
92 3300048913 Ga0496110_0093614 Ga0496110_0093614_1537_2658 347
93 3300048914 Ga0496111_0115376 Ga0496111_0115376_573_1694 347
94 3300048917 Ga0496114_0216349 Ga0496114_0216349_537_1658 347
95 3300006048 Ga0075363_100075198 Ga0075363_1000751982 348
96 3300013307 Ga0157372_10027752 Ga0157372_100277524 348
97 3300039062 Ga0400483_280433 Ga0400483_280433_224_1327 348
98 3300037853 Ga0436364_0732417 Ga0436364_0732417_302_1426 349
99 3300039437 Ga0436365_0709706 Ga0436365_0709706_305_1453 349
100 3300006186 Ga0075369_10018780 Ga0075369_100187804 350
101 3300031727 Ga0316576_10018093 Ga0316576_100180934 350
102 3300031727 Ga0316576_10084939 Ga0316576_100849392 350
103 3300031727 Ga0316576_10099947 Ga0316576_100999472 350
104 3300031728 Ga0316578_10026700 Ga0316578_100267002 350
105 3300035398 Ga0316574_0029037 Ga0316574_0029037_895_1956 350
106 3300035398 Ga0316574_0213882 Ga0316574_0213882_44_1105 350
107 iso_pu_bacteria 2899259804 2899259993 350
108 3300049570 Ga0501033_0143811 Ga0501033_0143811_217_1308 351
109 3300049571 Ga0501034_0081914 Ga0501034_0081914_1607_2698 351
110 3300049581 Ga0501047_0040758 Ga0501047_0040758_624_1715 351
111 3300049584 Ga0501068_0049876 Ga0501068_0049876_546_1637 351
112 3300049585 Ga0501069_0042872 Ga0501069_0042872_863_1954 351
113 3300049590 Ga0501074_0022595 Ga0501074_0022595_904_1995 351
114 3300049822 Ga0501035_0058754 Ga0501035_0058754_964_2055 351
115 3300049823 Ga0501044_0088143 Ga0501044_0088143_1189_2280 351
116 3300053153 Ga0500616_0017963 Ga0500616_0017963_2152_3276 351
117 iso_pu_bacteria 2643221651 2644289348 351
118 iso_pu_bacteria 2834578030 2834578674 351
119 iso_pu_bacteria 2854681122 2854684283 351
120 iso_pu_bacteria 2855020534 2855022373 351
121 iso_pu_bacteria 2883291878 2883295848 351
122 iso_pu_bacteria 2883354860 2883358630 351
123 iso_pu_bacteria 2899275550 2899279151 351
124 iso_pu_bacteria 2909399089 2909400376 351
125 iso_pu_bacteria 3000405567 3000406887 351
126 iso_pu_bacteria 641228493 641337188 351
127 iso_pu_bacteria 643348555 643392640 351
128 iso_pu_bacteria 8057132660 8057132782 351
129 iso_pu_bacteria 2513237087 2513589626 352
130 iso_pu_bacteria 2522572158 2523103905 352
131 iso_pu_bacteria 2545555834 2545677310 352
132 iso_pu_bacteria 2595698237 2596373694 352
133 iso_pu_bacteria 2643221605 2644036997 352
134 iso_pu_bacteria 2643221614 2644086604 352
135 iso_pu_bacteria 2643221661 2644341558 352
136 iso_pu_bacteria 2643221666 2644367845 352
137 iso_pu_bacteria 2738541281 2738743581 352
138 iso_pu_bacteria 2738543032 2739352488 352
139 iso_pu_bacteria 2821443989 2821448695 352
140 iso_pu_bacteria 2828305725 2828305893 352
141 iso_pu_bacteria 2829745981 2829750570 352
142 iso_pu_bacteria 2842694124 2842696258 352
143 iso_pu_bacteria 2842698319 2842698359 352
144 iso_pu_bacteria 2844533157 2844538256 352
145 iso_pu_bacteria 2848858292 2848859174 352
146 iso_pu_bacteria 2861691609 2861693507 352
147 iso_pu_bacteria 2889306138 2889307638 352
148 iso_pu_bacteria 2897803580 2897803772 352
149 iso_pu_bacteria 2902330777 2902333311 352
150 iso_pu_bacteria 2902405164 2902407095 352
151 iso_pu_bacteria 2928125067 2928127274 352
152 iso_pu_bacteria 2929199973 2929204844 352
153 iso_pu_bacteria 641522639 641640719 352
154 iso_pu_bacteria 643348564 643599608 352
155 iso_pu_bacteria 8055909800 8055914126 352
156 3300021388 Ga0213875_10022871 Ga0213875_100228712 353
157 3300037853 Ga0436364_0512657 Ga0436364_0512657_41448_42551 353
158 3300028800 Ga0265338_10029629 Ga0265338_100296292 354
159 3300039437 Ga0436365_0620663 Ga0436365_0620663_1861_2961 354
160 3300039453 Ga0436362_0894474 Ga0436362_0894474_3869_4969 354
161 3300005344 Ga0070661_100069887 Ga0070661_1000698872 355
162 3300005434 Ga0070709_10010485 Ga0070709_100104855 355
163 3300005435 Ga0070714_100063830 Ga0070714_1000638302 355
164 3300005435 Ga0070714_100202341 Ga0070714_1002023412 355
165 3300005436 Ga0070713_100032450 Ga0070713_1000324502 355
166 3300005456 Ga0070678_100034419 Ga0070678_1000344194 355
167 3300005458 Ga0070681_10244100 Ga0070681_102441001 355
168 3300005518 Ga0070699_100256389 Ga0070699_1002563892 355
169 3300005535 Ga0070684_100221036 Ga0070684_1002210361 355
170 3300005563 Ga0068855_100145431 Ga0068855_1001454312 355
171 3300005614 Ga0068856_100228742 Ga0068856_1002287422 355
172 3300005614 Ga0068856_100370158 Ga0068856_1003701581 355
173 3300005937 Ga0081455_10145904 Ga0081455_101459041 355
174 3300009098 Ga0105245_10006206 Ga0105245_1000620611 355
175 3300009098 Ga0105245_10377821 Ga0105245_103778212 355
176 3300021388 Ga0213875_10002098 Ga0213875_100020985 355
177 3300021388 Ga0213875_10002797 Ga0213875_100027977 355
178 3300025898 Ga0207692_10010137 Ga0207692_100101375 355
179 3300025906 Ga0207699_10030819 Ga0207699_100308193 355
180 3300025912 Ga0207707_10167551 Ga0207707_101675512 355
181 3300025915 Ga0207693_10008979 Ga0207693_100089795 355
182 3300025921 Ga0207652_10130769 Ga0207652_101307691 355
183 3300025927 Ga0207687_10199986 Ga0207687_101999862 355
184 3300025928 Ga0207700_10039856 Ga0207700_100398562 355
185 3300025928 Ga0207700_10324622 Ga0207700_103246221 355
186 3300025928 Ga0207700_10358698 Ga0207700_103586981 355
187 3300025949 Ga0207667_10349223 Ga0207667_103492232 355
188 3300026121 Ga0207683_10071973 Ga0207683_100719733 355
189 3300028800 Ga0265338_10026420 Ga0265338_100264205 355
190 3300028800 Ga0265338_10125851 Ga0265338_101258512 355
191 3300031250 Ga0265331_10001082 Ga0265331_1000108211 355
192 3300031344 Ga0265316_10199949 Ga0265316_101999492 355
193 3300031595 Ga0265313_10003473 Ga0265313_100034738 355
194 3300031616 Ga0307508_10067276 Ga0307508_100672762 355
195 3300031711 Ga0265314_10035984 Ga0265314_100359842 355
196 3300031712 Ga0265342_10037893 Ga0265342_100378932 355
197 3300035086 Ga0373934_0014736 Ga0373934_0014736_1123_2226 355
198 3300035111 Ga0373923_0042197 Ga0373923_0042197_500_1603 355
199 3300035117 Ga0373953_0004459 Ga0373953_0004459_989_2092 355
200 3300035118 Ga0373954_0013529 Ga0373954_0013529_2041_3144 355
201 3300035692 Ga0373935_0244757 Ga0373935_0244757_66_1169 355
202 3300035695 Ga0373927_0045706 Ga0373927_0045706_1152_2255 355
203 3300035724 Ga0373933_0045464 Ga0373933_0045464_777_1880 355
204 3300036401 Ga0373937_0000640 Ga0373937_0000640_2049_3152 355
205 3300036401 Ga0373937_0033267 Ga0373937_0033267_2267_3370 355
206 3300037068 Ga0373925_0022148 Ga0373925_0022148_1822_2925 355
207 3300037853 Ga0436364_1468280 Ga0436364_1468280_27373_28479 355
208 3300037853 Ga0436364_1480127 Ga0436364_1480127_10140_11243 355
209 3300039437 Ga0436365_0604472 Ga0436365_0604472_1227_2330 355
210 3300039453 Ga0436362_0598278 Ga0436362_0598278_341_1417 355
211 3300045051 Ga0451576_0001652 Ga0451576_0001652_11546_12649 355
212 3300046476 Ga0495662_0051924 Ga0495662_0051924_27_1130 355
213 3300046476 Ga0495662_0113609 Ga0495662_0113609_192_1295 355
214 3300046477 Ga0495664_0001365 Ga0495664_0001365_5249_6352 355
215 3300046516 Ga0495628_0011302 Ga0495628_0011302_1625_2728 355
216 3300046517 Ga0495630_0108681 Ga0495630_0108681_877_1980 355
217 3300046529 Ga0495652_0231178 Ga0495652_0231178_77_1180 355
218 3300046533 Ga0495640_0024636 Ga0495640_0024636_1489_2592 355
219 3300046536 Ga0495587_0012418 Ga0495587_0012418_693_1796 355
220 3300046543 Ga0495645_0000600 Ga0495645_0000600_23378_24481 355
221 3300046678 Ga0495599_0013498 Ga0495599_0013498_3196_4299 355
222 3300046678 Ga0495599_0015829 Ga0495599_0015829_2325_3428 355
223 3300046680 Ga0495646_0089560 Ga0495646_0089560_547_1650 355
224 3300047319 Ga0495674_0042015 Ga0495674_0042015_1384_2487 355
225 3300047320 Ga0495672_0042724 Ga0495672_0042724_361_1443 355
226 3300047322 Ga0495680_0060318 Ga0495680_0060318_524_1627 355
227 3300047444 Ga0495675_0123471 Ga0495675_0123471_131_1234 355
228 3300048088 Ga0495602_0003217 Ga0495602_0003217_14349_15452 355
229 3300048088 Ga0495602_0069658 Ga0495602_0069658_1106_2209 355
230 3300048922 Ga0496119_0008877 Ga0496119_0008877_3874_4977 355
231 3300049571 Ga0501034_0453557 Ga0501034_0453557_55_1137 355
232 3300049574 Ga0501038_0289460 Ga0501038_0289460_53_1132 355
233 3300049581 Ga0501047_0123565 Ga0501047_0123565_1102_2187 355
234 3300049589 Ga0501073_0077058 Ga0501073_0077058_329_1414 355
235 3300049823 Ga0501044_0274337 Ga0501044_0274337_38_1120 355
236 3300049823 Ga0501044_0275025 Ga0501044_0275025_440_1543 355
237 3300053077 Ga0495601_0014228 Ga0495601_0014228_290_1393 355
238 3300053077 Ga0495601_0231048 Ga0495601_0231048_52_1155 355
239 3300053078 Ga0495612_0000471 Ga0495612_0000471_11740_12843 355
240 3300053084 Ga0495595_0002863 Ga0495595_0002863_4314_5417 355
241 3300053084 Ga0495595_0043605 Ga0495595_0043605_570_1673 355
242 3300053153 Ga0500616_0000028 Ga0500616_0000028_236441_237520 355
243 3300060353 Ga0501082_0132553 Ga0501082_0132553_1003_2088 355
244 3300003187 JGI25151J46595_10000535 JGI25151J46595_1000053516 356
245 3300003203 JGI25406J46586_10000707 JGI25406J46586_100007072 356
246 3300005339 Ga0070660_100136303 Ga0070660_1001363032 356
247 3300005344 Ga0070661_100283379 Ga0070661_1002833791 356
248 3300005355 Ga0070671_100322916 Ga0070671_1003229161 356
249 3300005563 Ga0068855_100001158 Ga0068855_1000011586 356
250 3300005618 Ga0068864_100062657 Ga0068864_1000626572 356
251 3300005985 Ga0081539_10000054 Ga0081539_10000054194 356
252 3300009093 Ga0105240_10025206 Ga0105240_100252066 356
253 3300009094 Ga0111539_10039262 Ga0111539_100392622 356
254 3300009177 Ga0105248_10019306 Ga0105248_100193067 356
255 3300010375 Ga0105239_10000105 Ga0105239_10000105105 356
256 3300021388 Ga0213875_10013929 Ga0213875_100139293 356
257 3300021388 Ga0213875_10015867 Ga0213875_100158673 356
258 3300025284 Ga0209130_1002834 Ga0209130_10028346 356
259 3300025294 Ga0209025_1000146 Ga0209025_1000146156 356
260 3300025297 Ga0209758_1004822 Ga0209758_10048227 356
261 3300025302 Ga0207426_1000046 Ga0207426_1000046237 356
262 3300025913 Ga0207695_10010961 Ga0207695_100109616 356
263 3300025919 Ga0207657_10112086 Ga0207657_101120863 356
264 3300025921 Ga0207652_10151461 Ga0207652_101514612 356
265 3300025941 Ga0207711_10002689 Ga0207711_100026899 356
266 3300025949 Ga0207667_10077994 Ga0207667_100779943 356
267 3300028379 Ga0268266_10000514 Ga0268266_1000051418 356
268 3300028379 Ga0268266_10167521 Ga0268266_101675213 356
269 3300028380 Ga0268265_10313679 Ga0268265_103136791 356
270 3300028381 Ga0268264_10063739 Ga0268264_100637391 356
271 3300028800 Ga0265338_10050725 Ga0265338_100507253 356
272 3300031247 Ga0265340_10064963 Ga0265340_100649632 356
273 3300031250 Ga0265331_10001721 Ga0265331_100017214 356
274 3300037853 Ga0436364_0656171 Ga0436364_0656171_10644_11792 356
275 3300039437 Ga0436365_0142693 Ga0436365_0142693_142_1248 356
276 3300039438 Ga0436360_0962259 Ga0436360_0962259_1410_2546 356
277 3300039438 Ga0436360_1017874 Ga0436360_1017874_958_2067 356
278 3300044735 Ga0466968_0003779 Ga0466968_0003779_3295_4395 356
279 3300046460 Ga0495638_0074985 Ga0495638_0074985_850_1965 356
280 3300048922 Ga0496119_0000515 Ga0496119_0000515_21477_22589 356
281 3300048925 Ga0496122_0001603 Ga0496122_0001603_8150_9262 356
282 3300048926 Ga0496123_0000995 Ga0496123_0000995_6518_7630 356
283 3300048928 Ga0496125_0097596 Ga0496125_0097596_143_1267 356
284 3300049515 Ga0501292_000059 Ga0501292_000059_19399_20472 356
285 3300049581 Ga0501047_0243381 Ga0501047_0243381_166_1251 356
286 3300049588 Ga0501072_0079227 Ga0501072_0079227_855_1958 356
287 3300049590 Ga0501074_0020386 Ga0501074_0020386_3412_4515 356
288 3300049653 Ga0501206_000591 Ga0501206_000591_1743_2816 356
289 3300049664 Ga0501224_000416 Ga0501224_000416_2167_3240 356
290 3300049690 Ga0501261_000109 Ga0501261_000109_9836_10909 356
291 3300049742 Ga0501080_0107914 Ga0501080_0107914_1446_2549 356
292 3300049744 Ga0501083_0026587 Ga0501083_0026587_2583_3704 356
293 3300049775 Ga0501279_001289 Ga0501279_001289_501_1574 356
294 3300049778 Ga0501282_000082 Ga0501282_000082_7345_8418 356
295 3300049823 Ga0501044_0000263 Ga0501044_0000263_37802_38926 356
296 3300050511 nmdc:mga08y16_5270_c1 nmdc:mga08y16_5270_c1_552_1676 356
297 3300053104 Ga0500556_0000075 Ga0500556_0000075_81697_82809 356
298 3300053142 Ga0500577_0023217 Ga0500577_0023217_416_1531 356
299 3300053730 Ga0500645_012025 Ga0500645_012025_1670_2782 356
300 3300054114 Ga0501084_0012456 Ga0501084_0012456_1183_2286 356
301 3300060353 Ga0501082_0000772 Ga0501082_0000772_8258_9355 356
302 iso_pu_bacteria 3003665799 3003672492 356

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01264

Chorismate_synt

Chorismate synthase

54

400

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z9a-assembly1.cif.gz_B crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9288 1 352
5z9a-assembly1.cif.gz_A crystal structure of chorismate synthase from pseudomonas aeruginosa 0.9263 1 353
5z9a-assembly1.cif.gz_A crystal structure of chorismate synthase from pseudomonas aeruginosa 0.919 1 353
5z9a-assembly1.cif.gz_B crystal structure of chorismate synthase from pseudomonas aeruginosa 0.918 1 352
1qxo-assembly1.cif.gz_C crystal structure of chorismate synthase complexed with oxidized fmn and epsp 0.9079 11 351
ID Description Score Start End Superfamily
af_Q58575_11_372_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9643 9 350 3.60.150.10
af_A0A1D8PTK1_42_412_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9537 9 355 3.60.150.10
af_P12008_1_360_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9497 1 353 3.60.150.10
af_P28777_108_376_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9456 111 355 3.60.150.10
af_P12008_1_360_3.60.150.10 Alpha Beta;4-Layer Sandwich;Chorismate synthase, AroC fold;Chorismate synthase AroC 0.9287 1 353 3.60.150.10
ID Description Score Start End GO Terms
AF-G1XZG7-F1-model_v4 deleted 0.9925 148 354
AF-A0A2E1B9F5-F1-model_v4 Chorismate synthase (EC 4.2.3.5) 0.9909 126 354 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A7V8A7J6-F1-model_v4 chorismate synthase (EC 4.2.3.5) 0.9847 191 356 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A519PBF2-F1-model_v4 Chorismate synthase (EC 4.2.3.5) 0.984 41 354 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181
AF-A0A382USP1-F1-model_v4 chorismate synthase (EC 4.2.3.5) 0.9831 129 356 GO:0004107
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0010181

Feature Viewer

pLDDT pTM Quality
90.38 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map