F396848
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 199 | 279 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300005341|Ga0070691_10197089|Ga0070691_101970891 |
| Length | 265 |
| Sequence | MARRVFDLGLKTSDQQRPSSNIPLTSSIFTYLCSMAKILQIETATAICSVALSVNGKTISFKEEQGHNLHAANLTLFIDEVVRTAGLSYQELDAIAVSKGPGSYTGLRIGVSTAKGLCYALDKPLIAIETLEMMAAGYLAENPHYSGLICPMIDARRMEVYTSIFDLSLNIITPTEAKIIDETSFTDYLTQETLTFIGDGSAKCAEVLIHQNAKFDEANFNSATYMSRLANEAFGSSNFEDVAYFEPFYLKDFVVTQSKKQQAQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 4 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 5 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 6 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 7 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 8 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 9 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 10 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 11 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 12 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 13 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 14 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 15 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 16 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 17 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 18 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 19 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 20 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 21 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 22 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 23 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 24 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 25 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 26 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 27 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 28 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 29 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 30 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 31 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 132 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 133 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 134 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 135 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 136 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 137 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 141 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 142 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 143 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 144 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 145 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 146 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 149 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 150 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 154 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 155 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 156 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 159 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 178 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 179 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 180 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 192 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 195 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.75 |
| Metatranscriptomes | 0.33 |
| Isolates | 7.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.63 |
| Nodule | 0 |
| Rhizoplane | 1.65 |
| Rhizosphere | 87.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1465161 | 2162886007 | Bacteria | 1432 |
| 2 | JGI25152J39213_1002637 | 3300002773 | Bacteria | 6664 |
| 3 | JGI25150J39212_1000049 | 3300002774 | Bacteria | 73898 |
| 4 | JGI25151J46595_10000003 | 3300003187 | Bacteria | 715330 |
| 5 | JGI25153J46596_10000154 | 3300003215 | Bacteria | 69318 |
| 6 | rootH2_10056482 | 3300003320 | Bacteria | 2211 |
| 7 | rootH2_10095376 | 3300003320 | Bacteria | 17934 |
| 8 | rootH2_10286878 | 3300003320 | Bacteria | 1235 |
| 9 | rootL2_10032483 | 3300003322 | Bacteria | 3380 |
| 10 | Ga0065714_10006710 | 3300005288 | Bacteria | 4500 |
| 11 | Ga0065714_10089768 | 3300005288 | Bacteria | 1967 |
| 12 | Ga0065714_10134001 | 3300005288 | Bacteria | 1225 |
| 13 | Ga0065704_10109127 | 3300005289 | Bacteria | 2011 |
| 14 | Ga0065712_10087786 | 3300005290 | Bacteria | 2555 |
| 15 | Ga0070658_10000091 | 3300005327 | Bacteria | 81263 |
| 16 | Ga0070683_100001004 | 3300005329 | Bacteria | 21143 |
| 17 | Ga0070683_100187047 | 3300005329 | Bacteria | 1966 |
| 18 | Ga0070670_100286752 | 3300005331 | Bacteria | 1438 |
| 19 | Ga0070670_100326270 | 3300005331 | Bacteria | 1346 |
| 20 | Ga0070670_100426281 | 3300005331 | Unclassified | 1173 |
| 21 | Ga0070682_100015226 | 3300005337 | Bacteria | 4453 |
| 22 | Ga0070689_100026770 | 3300005340 | Bacteria | 4343 |
| 23 | Ga0070691_10197089 | 3300005341 | Bacteria | 1056 |
| 24 | Ga0070661_100000922 | 3300005344 | Bacteria | 21063 |
| 25 | Ga0070669_100015753 | 3300005353 | Bacteria | 5390 |
| 26 | Ga0070671_100058203 | 3300005355 | Bacteria | 3217 |
| 27 | Ga0070671_100658880 | 3300005355 | Unclassified | 907 |
| 28 | Ga0070688_100107756 | 3300005365 | Unclassified | 1848 |
| 29 | Ga0070659_100070336 | 3300005366 | Unclassified | 2780 |
| 30 | Ga0070667_100074526 | 3300005367 | Bacteria | 2896 |
| 31 | Ga0070663_100042775 | 3300005455 | Bacteria | 3185 |
| 32 | Ga0070662_100018859 | 3300005457 | Bacteria | 4674 |
| 33 | Ga0070685_10129128 | 3300005466 | Bacteria | 1578 |
| 34 | Ga0070679_100164571 | 3300005530 | Bacteria | 2192 |
| 35 | Ga0070684_100000042 | 3300005535 | Bacteria | 89896 |
| 36 | Ga0068853_100003672 | 3300005539 | Bacteria | 11770 |
| 37 | Ga0068853_100010717 | 3300005539 | Bacteria | 7424 |
| 38 | Ga0070665_100764057 | 3300005548 | Bacteria | 979 |
| 39 | Ga0068855_100075797 | 3300005563 | Bacteria | 3905 |
| 40 | Ga0070664_100000266 | 3300005564 | Bacteria | 37671 |
| 41 | Ga0070664_100018138 | 3300005564 | Bacteria | 5777 |
| 42 | Ga0070664_100087741 | 3300005564 | Bacteria | 2690 |
| 43 | Ga0068857_100006612 | 3300005577 | Bacteria | 9955 |
| 44 | Ga0068857_100180869 | 3300005577 | Bacteria | 1919 |
| 45 | Ga0068857_100537795 | 3300005577 | Bacteria | 1100 |
| 46 | Ga0068854_100011674 | 3300005578 | Bacteria | 5729 |
| 47 | Ga0068852_100151694 | 3300005616 | Unclassified | 2156 |
| 48 | Ga0068852_100591543 | 3300005616 | Bacteria | 1113 |
| 49 | Ga0068859_100012944 | 3300005617 | Bacteria | 8382 |
| 50 | Ga0068859_100016137 | 3300005617 | Bacteria | 7501 |
| 51 | Ga0068859_100120171 | 3300005617 | Bacteria | 2694 |
| 52 | Ga0068864_100038571 | 3300005618 | Bacteria | 4081 |
| 53 | Ga0068861_100051333 | 3300005719 | Bacteria | 3130 |
| 54 | Ga0068861_100767053 | 3300005719 | Bacteria | 902 |
| 55 | Ga0068863_100029026 | 3300005841 | Bacteria | 5284 |
| 56 | Ga0068858_100012456 | 3300005842 | Bacteria | 8019 |
| 57 | Ga0068858_100367230 | 3300005842 | Bacteria | 1380 |
| 58 | Ga0068860_100023035 | 3300005843 | Bacteria | 6023 |
| 59 | Ga0075366_10037675 | 3300006195 | Unclassified | 2856 |
| 60 | Ga0068871_100093721 | 3300006358 | Bacteria | 2506 |
| 61 | Ga0075430_100636762 | 3300006846 | Bacteria | 879 |
| 62 | Ga0075431_100156483 | 3300006847 | Bacteria | 2344 |
| 63 | Ga0097620_100012943 | 3300006931 | Bacteria | 8382 |
| 64 | Ga0097620_100016137 | 3300006931 | Bacteria | 7501 |
| 65 | Ga0097620_100120169 | 3300006931 | Bacteria | 2694 |
| 66 | Ga0105240_10000010 | 3300009093 | Bacteria | 537830 |
| 67 | Ga0105240_10187480 | 3300009093 | Bacteria | 2435 |
| 68 | Ga0105240_10502814 | 3300009093 | Bacteria | 1347 |
| 69 | Ga0105247_10002375 | 3300009101 | Bacteria | 12826 |
| 70 | Ga0114129_10239923 | 3300009147 | Bacteria | 2437 |
| 71 | Ga0105241_10010042 | 3300009174 | Bacteria | 6949 |
| 72 | Ga0105242_10177708 | 3300009176 | Unclassified | 1876 |
| 73 | Ga0105237_10001016 | 3300009545 | Bacteria | 37771 |
| 74 | Ga0105237_10038857 | 3300009545 | Bacteria | 4806 |
| 75 | Ga0105249_10070285 | 3300009553 | Bacteria | 3231 |
| 76 | Ga0105249_10077543 | 3300009553 | Bacteria | 3082 |
| 77 | Ga0105239_10024694 | 3300010375 | Bacteria | 6620 |
| 78 | Ga0105239_10040360 | 3300010375 | Bacteria | 5114 |
| 79 | Ga0157373_10007307 | 3300013100 | Bacteria | 8225 |
| 80 | Ga0157373_10089560 | 3300013100 | Bacteria | 2167 |
| 81 | Ga0157371_10003037 | 3300013102 | Bacteria | 15587 |
| 82 | Ga0157371_10006524 | 3300013102 | Bacteria | 9602 |
| 83 | Ga0157371_10082049 | 3300013102 | Bacteria | 2283 |
| 84 | Ga0157371_10095382 | 3300013102 | Bacteria | 2108 |
| 85 | Ga0157371_10171978 | 3300013102 | Unclassified | 1548 |
| 86 | Ga0157370_10020270 | 3300013104 | Bacteria | 6640 |
| 87 | Ga0157370_10024857 | 3300013104 | Bacteria | 5932 |
| 88 | Ga0157370_10106900 | 3300013104 | Bacteria | 2618 |
| 89 | Ga0157370_10152625 | 3300013104 | Bacteria | 2149 |
| 90 | Ga0157370_10184849 | 3300013104 | Bacteria | 1935 |
| 91 | Ga0157370_10347847 | 3300013104 | Bacteria | 1366 |
| 92 | Ga0157369_10005497 | 3300013105 | Bacteria | 14723 |
| 93 | Ga0157369_10085873 | 3300013105 | Bacteria | 3362 |
| 94 | Ga0157374_10027821 | 3300013296 | Bacteria | 5104 |
| 95 | Ga0157374_10062669 | 3300013296 | Unclassified | 3486 |
| 96 | Ga0157378_10003152 | 3300013297 | Bacteria | 14654 |
| 97 | Ga0163162_10022713 | 3300013306 | Bacteria | 6185 |
| 98 | Ga0163162_10584870 | 3300013306 | Bacteria | 1243 |
| 99 | Ga0157372_10000015 | 3300013307 | Bacteria | 225365 |
| 100 | Ga0157372_10413443 | 3300013307 | Bacteria | 1572 |
| 101 | Ga0157372_10656277 | 3300013307 | Bacteria | 1222 |
| 102 | Ga0157372_10796079 | 3300013307 | Bacteria | 1098 |
| 103 | Ga0157375_10011362 | 3300013308 | Bacteria | 7861 |
| 104 | Ga0157375_10024213 | 3300013308 | Bacteria | 5614 |
| 105 | Ga0157375_10787564 | 3300013308 | Bacteria | 1100 |
| 106 | Ga0157380_10000129 | 3300014326 | Bacteria | 41853 |
| 107 | Ga0182008_10000009 | 3300014497 | Bacteria | 331416 |
| 108 | Ga0182008_10048316 | 3300014497 | Bacteria | 2113 |
| 109 | Ga0182008_10073996 | 3300014497 | Bacteria | 1676 |
| 110 | Ga0157379_10226171 | 3300014968 | Bacteria | 1696 |
| 111 | Ga0157379_10295217 | 3300014968 | Bacteria | 1476 |
| 112 | Ga0157376_11171707 | 3300014969 | Unclassified | 796 |
| 113 | Ga0182006_1001050 | 3300015261 | Bacteria | 17847 |
| 114 | Ga0182006_1001177 | 3300015261 | Bacteria | 16424 |
| 115 | Ga0182007_10000080 | 3300015262 | Bacteria | 73401 |
| 116 | Ga0182007_10005726 | 3300015262 | Bacteria | 5417 |
| 117 | Ga0182007_10035057 | 3300015262 | Bacteria | 1692 |
| 118 | Ga0183373_1003 | 3300015682 | Bacteria | 558813 |
| 119 | Ga0163161_10001026 | 3300017792 | Bacteria | 21295 |
| 120 | Ga0163161_10001645 | 3300017792 | Bacteria | 16426 |
| 121 | Ga0163161_10019127 | 3300017792 | Bacteria | 4802 |
| 122 | Ga0163161_10071969 | 3300017792 | Bacteria | 2531 |
| 123 | Ga0163161_10523824 | 3300017792 | Bacteria | 968 |
| 124 | Ga0206351_10045802 | 3300020077 | Bacteria | 1338 |
| 125 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 126 | Ga0209129_1000005 | 3300025258 | Bacteria | 777812 |
| 127 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 128 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 129 | Ga0207710_10006643 | 3300025900 | Bacteria | 4930 |
| 130 | Ga0207705_10000132 | 3300025909 | Bacteria | 81270 |
| 131 | Ga0207654_10004338 | 3300025911 | Bacteria | 7149 |
| 132 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 133 | Ga0207671_10000667 | 3300025914 | Bacteria | 44873 |
| 134 | Ga0207671_10005041 | 3300025914 | Bacteria | 12338 |
| 135 | Ga0207649_10000644 | 3300025920 | Bacteria | 23288 |
| 136 | Ga0207652_10133639 | 3300025921 | Bacteria | 2214 |
| 137 | Ga0207652_10472332 | 3300025921 | Unclassified | 1130 |
| 138 | Ga0207650_10358807 | 3300025925 | Bacteria | 1200 |
| 139 | Ga0207644_10299522 | 3300025931 | Unclassified | 1295 |
| 140 | Ga0207690_10050038 | 3300025932 | Unclassified | 2788 |
| 141 | Ga0207706_10032203 | 3300025933 | Bacteria | 4669 |
| 142 | Ga0207670_10214606 | 3300025936 | Unclassified | 1469 |
| 143 | Ga0207661_10000781 | 3300025944 | Bacteria | 20721 |
| 144 | Ga0207661_10161528 | 3300025944 | Bacteria | 1944 |
| 145 | Ga0207679_10000733 | 3300025945 | Bacteria | 21828 |
| 146 | Ga0207667_10092760 | 3300025949 | Bacteria | 3119 |
| 147 | Ga0207712_10013550 | 3300025961 | Bacteria | 5228 |
| 148 | Ga0207640_10210496 | 3300025981 | Bacteria | 1481 |
| 149 | Ga0207658_10089383 | 3300025986 | Bacteria | 2384 |
| 150 | Ga0207703_10280723 | 3300026035 | Unclassified | 1512 |
| 151 | Ga0207639_10005779 | 3300026041 | Bacteria | 8376 |
| 152 | Ga0207639_10007423 | 3300026041 | Bacteria | 7476 |
| 153 | Ga0207639_10041435 | 3300026041 | Bacteria | 3445 |
| 154 | Ga0207678_10061675 | 3300026067 | Bacteria | 3225 |
| 155 | Ga0207708_10137823 | 3300026075 | Bacteria | 1912 |
| 156 | Ga0207702_10171755 | 3300026078 | Bacteria | 1988 |
| 157 | Ga0207641_10020546 | 3300026088 | Bacteria | 5424 |
| 158 | Ga0207676_10025141 | 3300026095 | Bacteria | 4417 |
| 159 | Ga0207674_10003645 | 3300026116 | Bacteria | 18783 |
| 160 | Ga0207675_100915355 | 3300026118 | Bacteria | 894 |
| 161 | Ga0207698_10113516 | 3300026142 | Unclassified | 2276 |
| 162 | Ga0207698_10565194 | 3300026142 | Bacteria | 1117 |
| 163 | Ga0209974_10105676 | 3300027876 | Bacteria | 987 |
| 164 | Ga0268266_10161464 | 3300028379 | Bacteria | 2028 |
| 165 | Ga0268264_10024319 | 3300028381 | Bacteria | 4946 |
| 166 | Ga0268264_10382326 | 3300028381 | Unclassified | 1348 |
| 167 | Ga0265323_10000405 | 3300028653 | Bacteria | 24740 |
| 168 | Ga0307515_10060509 | 3300028794 | Bacteria | 5398 |
| 169 | Ga0307515_10239484 | 3300028794 | Bacteria | 1589 |
| 170 | Ga0316177_1179118 | 3300030731 | Bacteria | 21596 |
| 171 | Ga0316176_1093215 | 3300030732 | Bacteria | 18436 |
| 172 | Ga0316183_1008910 | 3300030742 | Bacteria | 14367 |
| 173 | Ga0316181_1092332 | 3300030744 | Bacteria | 22982 |
| 174 | Ga0265327_10192625 | 3300031251 | Bacteria | 927 |
| 175 | Ga0265316_10023695 | 3300031344 | Bacteria | 5153 |
| 176 | Ga0265342_10075645 | 3300031712 | Bacteria | 1953 |
| 177 | Ga0316576_10035888 | 3300031727 | Bacteria | 3543 |
| 178 | Ga0316576_10116195 | 3300031727 | Unclassified | 2008 |
| 179 | Ga0307405_10000030 | 3300031731 | Bacteria | 99574 |
| 180 | Ga0316577_10123204 | 3300031733 | Bacteria | 1457 |
| 181 | Ga0307414_10000156 | 3300032004 | Bacteria | 45193 |
| 182 | Ga0307414_10000641 | 3300032004 | Bacteria | 17892 |
| 183 | Ga0307414_10242699 | 3300032004 | Bacteria | 1492 |
| 184 | Ga0307414_10269360 | 3300032004 | Unclassified | 1425 |
| 185 | Ga0316574_0051814 | 3300035398 | Bacteria | 2558 |
| 186 | Ga0316574_0088722 | 3300035398 | Bacteria | 1970 |
| 187 | Ga0316574_0217566 | 3300035398 | Unclassified | 1225 |
| 188 | Ga0316584_0431371 | 3300036712 | Bacteria | 935 |
| 189 | Ga0395899_0000332 | 3300037312 | Bacteria | 59463 |
| 190 | Ga0395899_0027800 | 3300037312 | Bacteria | 4261 |
| 191 | Ga0395900_0184853 | 3300037418 | Bacteria | 2116 |
| 192 | Ga0395901_0023507 | 3300038443 | Bacteria | 6321 |
| 193 | Ga0400483_076794 | 3300039062 | Bacteria | 36477 |
| 194 | Ga0400483_173421 | 3300039062 | Bacteria | 32116 |
| 195 | Ga0451795_1584742 | 3300041456 | Bacteria | 2385 |
| 196 | Ga0451802_0225134 | 3300041460 | Bacteria | 822 |
| 197 | Ga0451807_0533859 | 3300041486 | Bacteria | 947 |
| 198 | Ga0451855_0254494 | 3300041511 | Bacteria | 1256 |
| 199 | Ga0439442_006943 | 3300042002 | Unclassified | 2274 |
| 200 | Ga0451577_0000030 | 3300042876 | Bacteria | 391423 |
| 201 | Ga0451577_0000542 | 3300042876 | Bacteria | 62075 |
| 202 | Ga0451577_0003644 | 3300042876 | Bacteria | 16925 |
| 203 | Ga0451577_0033529 | 3300042876 | Bacteria | 4629 |
| 204 | Ga0451577_0315969 | 3300042876 | Bacteria | 1416 |
| 205 | Ga0453683_0000039 | 3300044673 | Bacteria | 228860 |
| 206 | Ga0453683_0000040 | 3300044673 | Bacteria | 225430 |
| 207 | Ga0453683_0005612 | 3300044673 | Bacteria | 8720 |
| 208 | Ga0453683_0142130 | 3300044673 | Bacteria | 1515 |
| 209 | Ga0466961_0063956 | 3300044693 | Bacteria | 2338 |
| 210 | Ga0453684_0000225 | 3300044712 | Bacteria | 245902 |
| 211 | Ga0453684_0000340 | 3300044712 | Bacteria | 194264 |
| 212 | Ga0453684_0000461 | 3300044712 | Bacteria | 162371 |
| 213 | Ga0453684_0000733 | 3300044712 | Bacteria | 114914 |
| 214 | Ga0453684_0019831 | 3300044712 | Bacteria | 10201 |
| 215 | Ga0453684_0074898 | 3300044712 | Bacteria | 4258 |
| 216 | Ga0453684_0082580 | 3300044712 | Bacteria | 4002 |
| 217 | Ga0453684_0213533 | 3300044712 | Bacteria | 2241 |
| 218 | Ga0453684_0213984 | 3300044712 | Bacteria | 2238 |
| 219 | Ga0453684_0224561 | 3300044712 | Bacteria | 2173 |
| 220 | Ga0466959_0133986 | 3300045049 | Bacteria | 1755 |
| 221 | Ga0466959_0269700 | 3300045049 | Bacteria | 1170 |
| 222 | Ga0451576_0000093 | 3300045051 | Bacteria | 226300 |
| 223 | Ga0451576_0000172 | 3300045051 | Bacteria | 162376 |
| 224 | Ga0451576_0004571 | 3300045051 | Bacteria | 17879 |
| 225 | Ga0451576_0053886 | 3300045051 | Bacteria | 4212 |
| 226 | Ga0451576_0120973 | 3300045051 | Bacteria | 2725 |
| 227 | Ga0451576_0559904 | 3300045051 | Bacteria | 1201 |
| 228 | Ga0466958_0039310 | 3300045836 | Bacteria | 2842 |
| 229 | Ga0495580_0148874 | 3300046472 | Unclassified | 1622 |
| 230 | Ga0495585_0000777 | 3300046492 | Bacteria | 28217 |
| 231 | Ga0495583_0072111 | 3300046506 | Bacteria | 1516 |
| 232 | Ga0495610_0000787 | 3300046512 | Bacteria | 29709 |
| 233 | Ga0495643_0076033 | 3300046522 | Bacteria | 1756 |
| 234 | Ga0495644_0059658 | 3300046523 | Bacteria | 1434 |
| 235 | Ga0495648_0032143 | 3300046524 | Bacteria | 3447 |
| 236 | Ga0495609_0011743 | 3300046538 | Bacteria | 4165 |
| 237 | Ga0495633_0000023 | 3300046558 | Bacteria | 226510 |
| 238 | Ga0495625_0018400 | 3300046660 | Bacteria | 5457 |
| 239 | Ga0495625_0103295 | 3300046660 | Unclassified | 1955 |
| 240 | Ga0495661_0006816 | 3300046665 | Bacteria | 7998 |
| 241 | Ga0495658_0024651 | 3300046683 | Bacteria | 3206 |
| 242 | Ga0495672_0067376 | 3300047320 | Unclassified | 2039 |
| 243 | Ga0495687_000736 | 3300047443 | Bacteria | 35743 |
| 244 | Ga0495686_0135312 | 3300047472 | Bacteria | 1458 |
| 245 | Ga0495686_0136012 | 3300047472 | Bacteria | 1453 |
| 246 | Ga0496104_0665715 | 3300048907 | Bacteria | 950 |
| 247 | Ga0496115_0019413 | 3300048918 | Bacteria | 5230 |
| 248 | Ga0496126_0005123 | 3300048929 | Bacteria | 15180 |
| 249 | Ga0501032_0010076 | 3300049569 | Bacteria | 6823 |
| 250 | Ga0501032_0043622 | 3300049569 | Bacteria | 3036 |
| 251 | Ga0501033_0018072 | 3300049570 | Bacteria | 5327 |
| 252 | Ga0501034_0178125 | 3300049571 | Bacteria | 2091 |
| 253 | Ga0501034_0180504 | 3300049571 | Bacteria | 2075 |
| 254 | Ga0501036_0079155 | 3300049572 | Bacteria | 2780 |
| 255 | Ga0501037_0021694 | 3300049573 | Bacteria | 4750 |
| 256 | Ga0501037_0235054 | 3300049573 | Bacteria | 1286 |
| 257 | Ga0501038_0131224 | 3300049574 | Bacteria | 2057 |
| 258 | Ga0501043_0091378 | 3300049579 | Bacteria | 2393 |
| 259 | Ga0501043_0177277 | 3300049579 | Bacteria | 1661 |
| 260 | Ga0501043_0583267 | 3300049579 | Unclassified | 828 |
| 261 | Ga0501046_0006756 | 3300049580 | Bacteria | 10131 |
| 262 | Ga0501047_0245711 | 3300049581 | Bacteria | 1639 |
| 263 | Ga0501070_0105146 | 3300049586 | Bacteria | 2334 |
| 264 | Ga0501080_0177143 | 3300049742 | Bacteria | 1964 |
| 265 | Ga0501080_0366414 | 3300049742 | Bacteria | 1299 |
| 266 | Ga0501280_009191 | 3300049776 | Bacteria | 1375 |
| 267 | Ga0501035_0028671 | 3300049822 | Bacteria | 5080 |
| 268 | Ga0501035_0054108 | 3300049822 | Bacteria | 3587 |
| 269 | Ga0501044_0021980 | 3300049823 | Bacteria | 6802 |
| 270 | Ga0501044_0052997 | 3300049823 | Bacteria | 4176 |
| 271 | Ga0501044_0082942 | 3300049823 | Unclassified | 3242 |
| 272 | Ga0501044_0103210 | 3300049823 | Bacteria | 2866 |
| 273 | Ga0501044_0431293 | 3300049823 | Bacteria | 1227 |
| 274 | nmdc:mga0k408_3233_c1 | 3300050493 | Bacteria | 8623 |
| 275 | nmdc:mga05p37_359073_c1 | 3300050507 | Bacteria | 1713 |
| 276 | nmdc:mga09592_19360_c1 | 3300050508 | Bacteria | 5589 |
| 277 | nmdc:mga0qj67_602399_c1 | 3300050509 | Bacteria | 879 |
| 278 | nmdc:mga06r32_72141_c1 | 3300050510 | Bacteria | 3343 |
| 279 | Ga0500641_0000719 | 3300053096 | Bacteria | 11981 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0180504 | Ga0501034_0180504_1507_2055 | 170 |
| 2 | 3300006847 | Ga0075431_100156483 | Ga0075431_1001564831 | 191 |
| 3 | 3300048907 | Ga0496104_0665715 | Ga0496104_0665715_37_630 | 196 |
| 4 | 3300039062 | Ga0400483_076794 | Ga0400483_076794_13525_14244 | 209 |
| 5 | 3300039062 | Ga0400483_173421 | Ga0400483_173421_26283_27002 | 209 |
| 6 | 3300042876 | Ga0451577_0033529 | Ga0451577_0033529_1212_1907 | 212 |
| 7 | 3300044673 | Ga0453683_0000040 | Ga0453683_0000040_109337_110032 | 212 |
| 8 | 3300044712 | Ga0453684_0019831 | Ga0453684_0019831_7756_8451 | 212 |
| 9 | 3300049569 | Ga0501032_0043622 | Ga0501032_0043622_872_1549 | 212 |
| 10 | 3300049572 | Ga0501036_0079155 | Ga0501036_0079155_1634_2311 | 212 |
| 11 | 3300049573 | Ga0501037_0021694 | Ga0501037_0021694_279_956 | 212 |
| 12 | 3300049579 | Ga0501043_0091378 | Ga0501043_0091378_629_1306 | 212 |
| 13 | 3300049580 | Ga0501046_0006756 | Ga0501046_0006756_9171_9848 | 212 |
| 14 | 3300049581 | Ga0501047_0245711 | Ga0501047_0245711_596_1273 | 212 |
| 15 | 3300049742 | Ga0501080_0366414 | Ga0501080_0366414_494_1171 | 212 |
| 16 | 3300049823 | Ga0501044_0021980 | Ga0501044_0021980_2707_3384 | 212 |
| 17 | 3300017792 | Ga0163161_10001645 | Ga0163161_1000164518 | 213 |
| 18 | 3300031731 | Ga0307405_10000030 | Ga0307405_1000003038 | 214 |
| 19 | iso_pu_bacteria | 2881247448 | 2881249155 | 214 |
| 20 | 3300015261 | Ga0182006_1001050 | Ga0182006_10010506 | 215 |
| 21 | 3300005578 | Ga0068854_100011674 | Ga0068854_1000116747 | 217 |
| 22 | 3300009545 | Ga0105237_10038857 | Ga0105237_100388573 | 217 |
| 23 | 3300013104 | Ga0157370_10347847 | Ga0157370_103478472 | 217 |
| 24 | 3300025914 | Ga0207671_10005041 | Ga0207671_100050414 | 217 |
| 25 | 3300025981 | Ga0207640_10210496 | Ga0207640_102104962 | 217 |
| 26 | 3300048918 | Ga0496115_0019413 | Ga0496115_0019413_271_930 | 217 |
| 27 | 3300048929 | Ga0496126_0005123 | Ga0496126_0005123_4567_5226 | 217 |
| 28 | iso_pu_bacteria | 2890804823 | 2890806171 | 217 |
| 29 | 3300015261 | Ga0182006_1001177 | Ga0182006_100117716 | 218 |
| 30 | 3300017792 | Ga0163161_10523824 | Ga0163161_105238242 | 218 |
| 31 | 3300053096 | Ga0500641_0000719 | Ga0500641_0000719_7074_7736 | 218 |
| 32 | 3300035398 | Ga0316574_0051814 | Ga0316574_0051814_1187_1849 | 219 |
| 33 | 3300041511 | Ga0451855_0254494 | Ga0451855_0254494_534_1220 | 219 |
| 34 | iso_pu_bacteria | 2833640130 | 2833642144 | 219 |
| 35 | iso_pu_bacteria | 2929154850 | 2929158796 | 219 |
| 36 | 3300005548 | Ga0070665_100764057 | Ga0070665_1007640571 | 220 |
| 37 | 3300005719 | Ga0068861_100767053 | Ga0068861_1007670531 | 220 |
| 38 | 3300006195 | Ga0075366_10037675 | Ga0075366_100376754 | 220 |
| 39 | 3300009176 | Ga0105242_10177708 | Ga0105242_101777083 | 220 |
| 40 | 3300013104 | Ga0157370_10152625 | Ga0157370_101526252 | 220 |
| 41 | 3300026118 | Ga0207675_100915355 | Ga0207675_1009153551 | 220 |
| 42 | 3300028379 | Ga0268266_10161464 | Ga0268266_101614642 | 220 |
| 43 | 3300035398 | Ga0316574_0088722 | Ga0316574_0088722_209_880 | 220 |
| 44 | 3300036712 | Ga0316584_0431371 | Ga0316584_0431371_80_751 | 220 |
| 45 | 3300047472 | Ga0495686_0136012 | Ga0495686_0136012_293_955 | 220 |
| 46 | 3300050493 | nmdc:mga0k408_3233_c1 | nmdc:mga0k408_3233_c1_4337_4999 | 220 |
| 47 | 3300005331 | Ga0070670_100426281 | Ga0070670_1004262812 | 221 |
| 48 | 3300005353 | Ga0070669_100015753 | Ga0070669_1000157533 | 221 |
| 49 | 3300005466 | Ga0070685_10129128 | Ga0070685_101291283 | 221 |
| 50 | 3300005577 | Ga0068857_100537795 | Ga0068857_1005377952 | 221 |
| 51 | 3300005617 | Ga0068859_100012944 | Ga0068859_1000129448 | 221 |
| 52 | 3300005618 | Ga0068864_100038571 | Ga0068864_1000385713 | 221 |
| 53 | 3300005719 | Ga0068861_100051333 | Ga0068861_1000513334 | 221 |
| 54 | 3300005842 | Ga0068858_100367230 | Ga0068858_1003672301 | 221 |
| 55 | 3300005843 | Ga0068860_100023035 | Ga0068860_1000230355 | 221 |
| 56 | 3300006931 | Ga0097620_100012943 | Ga0097620_1000129438 | 221 |
| 57 | 3300009101 | Ga0105247_10002375 | Ga0105247_100023755 | 221 |
| 58 | 3300009553 | Ga0105249_10077543 | Ga0105249_100775432 | 221 |
| 59 | 3300013100 | Ga0157373_10089560 | Ga0157373_100895602 | 221 |
| 60 | 3300013307 | Ga0157372_10413443 | Ga0157372_104134431 | 221 |
| 61 | 3300013307 | Ga0157372_10796079 | Ga0157372_107960792 | 221 |
| 62 | 3300014968 | Ga0157379_10295217 | Ga0157379_102952172 | 221 |
| 63 | 3300015262 | Ga0182007_10000080 | Ga0182007_1000008013 | 221 |
| 64 | 3300017792 | Ga0163161_10019127 | Ga0163161_100191273 | 221 |
| 65 | 3300025900 | Ga0207710_10006643 | Ga0207710_100066434 | 221 |
| 66 | 3300025961 | Ga0207712_10013550 | Ga0207712_100135505 | 221 |
| 67 | 3300026095 | Ga0207676_10025141 | Ga0207676_100251414 | 221 |
| 68 | 3300027876 | Ga0209974_10105676 | Ga0209974_101056761 | 221 |
| 69 | 3300028381 | Ga0268264_10024319 | Ga0268264_100243193 | 221 |
| 70 | 3300037418 | Ga0395900_0184853 | Ga0395900_0184853_866_1534 | 221 |
| 71 | 3300041486 | Ga0451807_0533859 | Ga0451807_0533859_130_798 | 221 |
| 72 | 3300042002 | Ga0439442_006943 | Ga0439442_006943_972_1637 | 221 |
| 73 | 3300044673 | Ga0453683_0142130 | Ga0453683_0142130_562_1233 | 221 |
| 74 | 3300046522 | Ga0495643_0076033 | Ga0495643_0076033_643_1308 | 221 |
| 75 | 3300049569 | Ga0501032_0010076 | Ga0501032_0010076_4995_5672 | 221 |
| 76 | 3300049822 | Ga0501035_0028671 | Ga0501035_0028671_615_1292 | 221 |
| 77 | 3300049823 | Ga0501044_0052997 | Ga0501044_0052997_2164_2841 | 221 |
| 78 | iso_pu_bacteria | 2852623160 | 2852624153 | 221 |
| 79 | iso_pu_bacteria | 2884933994 | 2884936927 | 221 |
| 80 | 3300005539 | Ga0068853_100010717 | Ga0068853_1000107173 | 222 |
| 81 | 3300026041 | Ga0207639_10007423 | Ga0207639_100074233 | 222 |
| 82 | 3300049573 | Ga0501037_0235054 | Ga0501037_0235054_124_804 | 222 |
| 83 | 3300049574 | Ga0501038_0131224 | Ga0501038_0131224_127_807 | 222 |
| 84 | 3300049579 | Ga0501043_0177277 | Ga0501043_0177277_814_1494 | 222 |
| 85 | 3300049823 | Ga0501044_0431293 | Ga0501044_0431293_423_1103 | 222 |
| 86 | iso_pu_bacteria | 2739367663 | 2739644711 | 222 |
| 87 | iso_pu_bacteria | 2842903701 | 2842907902 | 222 |
| 88 | 3300003320 | rootH2_10095376 | rootH2_100953761 | 223 |
| 89 | 3300005290 | Ga0065712_10087786 | Ga0065712_100877862 | 223 |
| 90 | 3300005340 | Ga0070689_100026770 | Ga0070689_1000267702 | 223 |
| 91 | 3300005355 | Ga0070671_100658880 | Ga0070671_1006588801 | 223 |
| 92 | 3300005365 | Ga0070688_100107756 | Ga0070688_1001077563 | 223 |
| 93 | 3300005367 | Ga0070667_100074526 | Ga0070667_1000745263 | 223 |
| 94 | 3300005457 | Ga0070662_100018859 | Ga0070662_1000188594 | 223 |
| 95 | 3300005564 | Ga0070664_100087741 | Ga0070664_1000877413 | 223 |
| 96 | 3300005577 | Ga0068857_100180869 | Ga0068857_1001808693 | 223 |
| 97 | 3300005616 | Ga0068852_100151694 | Ga0068852_1001516942 | 223 |
| 98 | 3300005617 | Ga0068859_100016137 | Ga0068859_1000161373 | 223 |
| 99 | 3300005617 | Ga0068859_100120171 | Ga0068859_1001201714 | 223 |
| 100 | 3300005842 | Ga0068858_100012456 | Ga0068858_1000124562 | 223 |
| 101 | 3300006358 | Ga0068871_100093721 | Ga0068871_1000937211 | 223 |
| 102 | 3300006931 | Ga0097620_100016137 | Ga0097620_1000161373 | 223 |
| 103 | 3300006931 | Ga0097620_100120169 | Ga0097620_1001201692 | 223 |
| 104 | 3300009553 | Ga0105249_10070285 | Ga0105249_100702852 | 223 |
| 105 | 3300013102 | Ga0157371_10082049 | Ga0157371_100820492 | 223 |
| 106 | 3300013296 | Ga0157374_10062669 | Ga0157374_100626691 | 223 |
| 107 | 3300013306 | Ga0163162_10022713 | Ga0163162_100227135 | 223 |
| 108 | 3300013307 | Ga0157372_10656277 | Ga0157372_106562771 | 223 |
| 109 | 3300025933 | Ga0207706_10032203 | Ga0207706_100322034 | 223 |
| 110 | 3300025936 | Ga0207670_10214606 | Ga0207670_102146062 | 223 |
| 111 | 3300025986 | Ga0207658_10089383 | Ga0207658_100893832 | 223 |
| 112 | 3300026035 | Ga0207703_10280723 | Ga0207703_102807232 | 223 |
| 113 | 3300026041 | Ga0207639_10041435 | Ga0207639_100414353 | 223 |
| 114 | 3300026075 | Ga0207708_10137823 | Ga0207708_101378232 | 223 |
| 115 | 3300026142 | Ga0207698_10113516 | Ga0207698_101135163 | 223 |
| 116 | 3300028381 | Ga0268264_10382326 | Ga0268264_103823262 | 223 |
| 117 | 3300032004 | Ga0307414_10000156 | Ga0307414_100001564 | 223 |
| 118 | 3300044712 | Ga0453684_0082580 | Ga0453684_0082580_2514_3188 | 223 |
| 119 | 3300047320 | Ga0495672_0067376 | Ga0495672_0067376_729_1400 | 223 |
| 120 | 3300049579 | Ga0501043_0583267 | Ga0501043_0583267_119_790 | 223 |
| 121 | iso_pu_bacteria | 2585427687 | 2586210748 | 223 |
| 122 | iso_pu_bacteria | 2738541302 | 2738853373 | 223 |
| 123 | iso_pu_bacteria | 2738543023 | 2739304695 | 223 |
| 124 | iso_pu_bacteria | 2739367651 | 2739591156 | 223 |
| 125 | iso_pu_bacteria | 2739367656 | 2739615486 | 223 |
| 126 | iso_pu_bacteria | 2775506987 | 2776614419 | 223 |
| 127 | iso_pu_bacteria | 2818991437 | 2819548943 | 223 |
| 128 | iso_pu_bacteria | 2842722452 | 2842723334 | 223 |
| 129 | iso_pu_bacteria | 2842909656 | 2842909827 | 223 |
| 130 | iso_pu_bacteria | 2849281842 | 2849285346 | 223 |
| 131 | iso_pu_bacteria | 2857627736 | 2857628699 | 223 |
| 132 | iso_pu_bacteria | 2902048731 | 2902050200 | 223 |
| 133 | iso_pu_bacteria | 2939664404 | 2939664970 | 223 |
| 134 | iso_pu_bacteria | 2945997725 | 2946000144 | 223 |
| 135 | iso_pu_bacteria | 2954016120 | 2954017059 | 223 |
| 136 | iso_pu_bacteria | 3003233435 | 3003234111 | 223 |
| 137 | 3300003320 | rootH2_10286878 | rootH2_102868781 | 224 |
| 138 | 3300005331 | Ga0070670_100286752 | Ga0070670_1002867523 | 224 |
| 139 | 3300005841 | Ga0068863_100029026 | Ga0068863_1000290263 | 224 |
| 140 | 3300006846 | Ga0075430_100636762 | Ga0075430_1006367621 | 224 |
| 141 | 3300009147 | Ga0114129_10239923 | Ga0114129_102399233 | 224 |
| 142 | 3300010375 | Ga0105239_10040360 | Ga0105239_100403603 | 224 |
| 143 | 3300013308 | Ga0157375_10024213 | Ga0157375_100242135 | 224 |
| 144 | 3300014326 | Ga0157380_10000129 | Ga0157380_1000012928 | 224 |
| 145 | 3300014968 | Ga0157379_10226171 | Ga0157379_102261711 | 224 |
| 146 | 3300026088 | Ga0207641_10020546 | Ga0207641_100205463 | 224 |
| 147 | 3300028794 | Ga0307515_10239484 | Ga0307515_102394843 | 224 |
| 148 | 3300032004 | Ga0307414_10242699 | Ga0307414_102426993 | 224 |
| 149 | 3300032004 | Ga0307414_10269360 | Ga0307414_102693602 | 224 |
| 150 | 3300041460 | Ga0451802_0225134 | Ga0451802_0225134_21_695 | 224 |
| 151 | 3300045049 | Ga0466959_0133986 | Ga0466959_0133986_170_850 | 224 |
| 152 | 3300046472 | Ga0495580_0148874 | Ga0495580_0148874_190_864 | 224 |
| 153 | 3300047443 | Ga0495687_000736 | Ga0495687_000736_26908_27585 | 224 |
| 154 | 3300050507 | nmdc:mga05p37_359073_c1 | nmdc:mga05p37_359073_c1_277_966 | 224 |
| 155 | 3300050508 | nmdc:mga09592_19360_c1 | nmdc:mga09592_19360_c1_2437_3126 | 224 |
| 156 | 3300050509 | nmdc:mga0qj67_602399_c1 | nmdc:mga0qj67_602399_c1_136_825 | 224 |
| 157 | 3300050510 | nmdc:mga06r32_72141_c1 | nmdc:mga06r32_72141_c1_55_744 | 224 |
| 158 | 3300005288 | Ga0065714_10134001 | Ga0065714_101340011 | 225 |
| 159 | 3300009093 | Ga0105240_10000010 | Ga0105240_10000010294 | 225 |
| 160 | 3300009174 | Ga0105241_10010042 | Ga0105241_100100425 | 225 |
| 161 | 3300009545 | Ga0105237_10001016 | Ga0105237_1000101633 | 225 |
| 162 | 3300010375 | Ga0105239_10024694 | Ga0105239_100246943 | 225 |
| 163 | 3300013297 | Ga0157378_10003152 | Ga0157378_1000315215 | 225 |
| 164 | 3300013308 | Ga0157375_10011362 | Ga0157375_100113624 | 225 |
| 165 | 3300025911 | Ga0207654_10004338 | Ga0207654_100043386 | 225 |
| 166 | 3300025913 | Ga0207695_10000019 | Ga0207695_10000019161 | 225 |
| 167 | 3300026078 | Ga0207702_10171755 | Ga0207702_101717551 | 225 |
| 168 | 3300037312 | Ga0395899_0027800 | Ga0395899_0027800_1611_2297 | 225 |
| 169 | 3300038443 | Ga0395901_0023507 | Ga0395901_0023507_183_869 | 225 |
| 170 | 3300041456 | Ga0451795_1584742 | Ga0451795_1584742_1073_1762 | 225 |
| 171 | 3300046558 | Ga0495633_0000023 | Ga0495633_0000023_132969_133715 | 225 |
| 172 | 3300003320 | rootH2_10056482 | rootH2_100564823 | 226 |
| 173 | 3300003322 | rootL2_10032483 | rootL2_100324834 | 226 |
| 174 | 3300005327 | Ga0070658_10000091 | Ga0070658_1000009131 | 226 |
| 175 | 3300005329 | Ga0070683_100001004 | Ga0070683_10000100411 | 226 |
| 176 | 3300005329 | Ga0070683_100187047 | Ga0070683_1001870473 | 226 |
| 177 | 3300005331 | Ga0070670_100326270 | Ga0070670_1003262701 | 226 |
| 178 | 3300005337 | Ga0070682_100015226 | Ga0070682_1000152263 | 226 |
| 179 | 3300005344 | Ga0070661_100000922 | Ga0070661_10000092213 | 226 |
| 180 | 3300005355 | Ga0070671_100058203 | Ga0070671_1000582033 | 226 |
| 181 | 3300005366 | Ga0070659_100070336 | Ga0070659_1000703363 | 226 |
| 182 | 3300005530 | Ga0070679_100164571 | Ga0070679_1001645714 | 226 |
| 183 | 3300005535 | Ga0070684_100000042 | Ga0070684_10000004212 | 226 |
| 184 | 3300005539 | Ga0068853_100003672 | Ga0068853_10000367210 | 226 |
| 185 | 3300005563 | Ga0068855_100075797 | Ga0068855_1000757971 | 226 |
| 186 | 3300005564 | Ga0070664_100000266 | Ga0070664_10000026632 | 226 |
| 187 | 3300005564 | Ga0070664_100018138 | Ga0070664_1000181382 | 226 |
| 188 | 3300005577 | Ga0068857_100006612 | Ga0068857_1000066129 | 226 |
| 189 | 3300009093 | Ga0105240_10187480 | Ga0105240_101874802 | 226 |
| 190 | 3300009093 | Ga0105240_10502814 | Ga0105240_105028143 | 226 |
| 191 | 3300013102 | Ga0157371_10095382 | Ga0157371_100953823 | 226 |
| 192 | 3300013104 | Ga0157370_10184849 | Ga0157370_101848493 | 226 |
| 193 | 3300013105 | Ga0157369_10085873 | Ga0157369_100858734 | 226 |
| 194 | 3300013296 | Ga0157374_10027821 | Ga0157374_100278211 | 226 |
| 195 | 3300013306 | Ga0163162_10584870 | Ga0163162_105848702 | 226 |
| 196 | 3300013307 | Ga0157372_10000015 | Ga0157372_10000015100 | 226 |
| 197 | 3300014969 | Ga0157376_11171707 | Ga0157376_111717071 | 226 |
| 198 | 3300020077 | Ga0206351_10045802 | Ga0206351_100458022 | 226 |
| 199 | 3300025909 | Ga0207705_10000132 | Ga0207705_1000013231 | 226 |
| 200 | 3300025914 | Ga0207671_10000667 | Ga0207671_1000066749 | 226 |
| 201 | 3300025920 | Ga0207649_10000644 | Ga0207649_1000064411 | 226 |
| 202 | 3300025921 | Ga0207652_10133639 | Ga0207652_101336392 | 226 |
| 203 | 3300025921 | Ga0207652_10472332 | Ga0207652_104723322 | 226 |
| 204 | 3300025925 | Ga0207650_10358807 | Ga0207650_103588071 | 226 |
| 205 | 3300025931 | Ga0207644_10299522 | Ga0207644_102995222 | 226 |
| 206 | 3300025932 | Ga0207690_10050038 | Ga0207690_100500383 | 226 |
| 207 | 3300025944 | Ga0207661_10000781 | Ga0207661_1000078110 | 226 |
| 208 | 3300025944 | Ga0207661_10161528 | Ga0207661_101615283 | 226 |
| 209 | 3300025945 | Ga0207679_10000733 | Ga0207679_1000073314 | 226 |
| 210 | 3300025949 | Ga0207667_10092760 | Ga0207667_100927602 | 226 |
| 211 | 3300026041 | Ga0207639_10005779 | Ga0207639_100057796 | 226 |
| 212 | 3300026116 | Ga0207674_10003645 | Ga0207674_100036459 | 226 |
| 213 | 3300031251 | Ga0265327_10192625 | Ga0265327_101926252 | 226 |
| 214 | 3300037312 | Ga0395899_0000332 | Ga0395899_0000332_22339_23028 | 226 |
| 215 | 3300044693 | Ga0466961_0063956 | Ga0466961_0063956_517_1206 | 226 |
| 216 | 3300045049 | Ga0466959_0269700 | Ga0466959_0269700_123_812 | 226 |
| 217 | 3300045836 | Ga0466958_0039310 | Ga0466958_0039310_1782_2471 | 226 |
| 218 | 3300046523 | Ga0495644_0059658 | Ga0495644_0059658_458_1144 | 226 |
| 219 | 3300046660 | Ga0495625_0103295 | Ga0495625_0103295_713_1408 | 226 |
| 220 | 3300049570 | Ga0501033_0018072 | Ga0501033_0018072_3612_4310 | 226 |
| 221 | 3300049571 | Ga0501034_0178125 | Ga0501034_0178125_117_818 | 226 |
| 222 | 3300049586 | Ga0501070_0105146 | Ga0501070_0105146_1574_2272 | 226 |
| 223 | 3300049742 | Ga0501080_0177143 | Ga0501080_0177143_1219_1917 | 226 |
| 224 | 3300049822 | Ga0501035_0054108 | Ga0501035_0054108_57_755 | 226 |
| 225 | 3300049823 | Ga0501044_0082942 | Ga0501044_0082942_424_1122 | 226 |
| 226 | 3300049823 | Ga0501044_0103210 | Ga0501044_0103210_69_767 | 226 |
| 227 | 2162886007 | SwRhRL2b_contig_1465161 | SwRhRL2b_0911.00004710 | 227 |
| 228 | 3300002773 | JGI25152J39213_1002637 | JGI25152J39213_10026379 | 227 |
| 229 | 3300002774 | JGI25150J39212_1000049 | JGI25150J39212_100004930 | 227 |
| 230 | 3300003187 | JGI25151J46595_10000003 | JGI25151J46595_1000000330 | 227 |
| 231 | 3300003215 | JGI25153J46596_10000154 | JGI25153J46596_1000015439 | 227 |
| 232 | 3300005288 | Ga0065714_10006710 | Ga0065714_100067103 | 227 |
| 233 | 3300005288 | Ga0065714_10089768 | Ga0065714_100897682 | 227 |
| 234 | 3300005289 | Ga0065704_10109127 | Ga0065704_101091272 | 227 |
| 235 | 3300005341 | Ga0070691_10197089 | Ga0070691_101970891 | 227 |
| 236 | 3300005455 | Ga0070663_100042775 | Ga0070663_1000427755 | 227 |
| 237 | 3300005616 | Ga0068852_100591543 | Ga0068852_1005915431 | 227 |
| 238 | 3300013100 | Ga0157373_10007307 | Ga0157373_100073076 | 227 |
| 239 | 3300013102 | Ga0157371_10003037 | Ga0157371_1000303716 | 227 |
| 240 | 3300013102 | Ga0157371_10006524 | Ga0157371_100065244 | 227 |
| 241 | 3300013102 | Ga0157371_10171978 | Ga0157371_101719782 | 227 |
| 242 | 3300013104 | Ga0157370_10020270 | Ga0157370_100202705 | 227 |
| 243 | 3300013104 | Ga0157370_10024857 | Ga0157370_100248575 | 227 |
| 244 | 3300013104 | Ga0157370_10106900 | Ga0157370_101069002 | 227 |
| 245 | 3300013105 | Ga0157369_10005497 | Ga0157369_100054974 | 227 |
| 246 | 3300013308 | Ga0157375_10787564 | Ga0157375_107875642 | 227 |
| 247 | 3300014497 | Ga0182008_10000009 | Ga0182008_10000009104 | 227 |
| 248 | 3300014497 | Ga0182008_10048316 | Ga0182008_100483162 | 227 |
| 249 | 3300014497 | Ga0182008_10073996 | Ga0182008_100739964 | 227 |
| 250 | 3300015262 | Ga0182007_10005726 | Ga0182007_100057263 | 227 |
| 251 | 3300015262 | Ga0182007_10035057 | Ga0182007_100350574 | 227 |
| 252 | 3300015682 | Ga0183373_1003 | Ga0183373_1003226 | 227 |
| 253 | 3300017792 | Ga0163161_10001026 | Ga0163161_1000102623 | 227 |
| 254 | 3300017792 | Ga0163161_10071969 | Ga0163161_100719692 | 227 |
| 255 | 3300025245 | Ga0207425_1000004 | Ga0207425_1000004336 | 227 |
| 256 | 3300025258 | Ga0209129_1000005 | Ga0209129_1000005604 | 227 |
| 257 | 3300025294 | Ga0209025_1000009 | Ga0209025_1000009336 | 227 |
| 258 | 3300025297 | Ga0209758_1000010 | Ga0209758_1000010337 | 227 |
| 259 | 3300026067 | Ga0207678_10061675 | Ga0207678_100616755 | 227 |
| 260 | 3300026142 | Ga0207698_10565194 | Ga0207698_105651942 | 227 |
| 261 | 3300028653 | Ga0265323_10000405 | Ga0265323_1000040514 | 227 |
| 262 | 3300028794 | Ga0307515_10060509 | Ga0307515_100605095 | 227 |
| 263 | 3300030731 | Ga0316177_1179118 | Ga0316177_11791186 | 227 |
| 264 | 3300030732 | Ga0316176_1093215 | Ga0316176_10932152 | 227 |
| 265 | 3300030742 | Ga0316183_1008910 | Ga0316183_10089104 | 227 |
| 266 | 3300030744 | Ga0316181_1092332 | Ga0316181_10923327 | 227 |
| 267 | 3300031344 | Ga0265316_10023695 | Ga0265316_100236954 | 227 |
| 268 | 3300031712 | Ga0265342_10075645 | Ga0265342_100756453 | 227 |
| 269 | 3300031727 | Ga0316576_10035888 | Ga0316576_100358884 | 227 |
| 270 | 3300031727 | Ga0316576_10116195 | Ga0316576_101161952 | 227 |
| 271 | 3300031733 | Ga0316577_10123204 | Ga0316577_101232042 | 227 |
| 272 | 3300032004 | Ga0307414_10000641 | Ga0307414_100006413 | 227 |
| 273 | 3300035398 | Ga0316574_0217566 | Ga0316574_0217566_171_884 | 227 |
| 274 | 3300042876 | Ga0451577_0000030 | Ga0451577_0000030_387137_387862 | 227 |
| 275 | 3300042876 | Ga0451577_0000542 | Ga0451577_0000542_35370_36080 | 227 |
| 276 | 3300042876 | Ga0451577_0003644 | Ga0451577_0003644_12072_12782 | 227 |
| 277 | 3300042876 | Ga0451577_0315969 | Ga0451577_0315969_333_1034 | 227 |
| 278 | 3300044673 | Ga0453683_0000039 | Ga0453683_0000039_8507_9250 | 227 |
| 279 | 3300044673 | Ga0453683_0005612 | Ga0453683_0005612_7920_8639 | 227 |
| 280 | 3300044712 | Ga0453684_0000225 | Ga0453684_0000225_119384_120094 | 227 |
| 281 | 3300044712 | Ga0453684_0000340 | Ga0453684_0000340_158183_158893 | 227 |
| 282 | 3300044712 | Ga0453684_0000461 | Ga0453684_0000461_3562_4287 | 227 |
| 283 | 3300044712 | Ga0453684_0000733 | Ga0453684_0000733_13888_14616 | 227 |
| 284 | 3300044712 | Ga0453684_0074898 | Ga0453684_0074898_1897_2607 | 227 |
| 285 | 3300044712 | Ga0453684_0213533 | Ga0453684_0213533_274_1026 | 227 |
| 286 | 3300044712 | Ga0453684_0213984 | Ga0453684_0213984_626_1327 | 227 |
| 287 | 3300044712 | Ga0453684_0224561 | Ga0453684_0224561_581_1291 | 227 |
| 288 | 3300045051 | Ga0451576_0000093 | Ga0451576_0000093_35370_36080 | 227 |
| 289 | 3300045051 | Ga0451576_0000172 | Ga0451576_0000172_158076_158801 | 227 |
| 290 | 3300045051 | Ga0451576_0004571 | Ga0451576_0004571_4967_5671 | 227 |
| 291 | 3300045051 | Ga0451576_0053886 | Ga0451576_0053886_3058_3759 | 227 |
| 292 | 3300045051 | Ga0451576_0120973 | Ga0451576_0120973_1689_2408 | 227 |
| 293 | 3300045051 | Ga0451576_0559904 | Ga0451576_0559904_209_949 | 227 |
| 294 | 3300046492 | Ga0495585_0000777 | Ga0495585_0000777_3605_4300 | 227 |
| 295 | 3300046506 | Ga0495583_0072111 | Ga0495583_0072111_779_1474 | 227 |
| 296 | 3300046512 | Ga0495610_0000787 | Ga0495610_0000787_964_1659 | 227 |
| 297 | 3300046524 | Ga0495648_0032143 | Ga0495648_0032143_288_983 | 227 |
| 298 | 3300046538 | Ga0495609_0011743 | Ga0495609_0011743_3362_4057 | 227 |
| 299 | 3300046660 | Ga0495625_0018400 | Ga0495625_0018400_3966_4661 | 227 |
| 300 | 3300046665 | Ga0495661_0006816 | Ga0495661_0006816_587_1276 | 227 |
| 301 | 3300046683 | Ga0495658_0024651 | Ga0495658_0024651_1788_2483 | 227 |
| 302 | 3300047472 | Ga0495686_0135312 | Ga0495686_0135312_450_1145 | 227 |
| 303 | 3300049776 | Ga0501280_009191 | Ga0501280_009191_191_880 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5br9-assembly3.cif.gz_E | crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa | 0.8961 | 1 | 217 |
| 5br9-assembly3.cif.gz_E | crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa | 0.8922 | 1 | 217 |
| 3r6m-assembly2.cif.gz_C | crystal structure of vibrio parahaemolyticus yeaz | 0.8784 | 2 | 208 |
| 4y0w-assembly1.cif.gz_C-2 | yeaz from pseudomonas aeruginosa | 0.8769 | 1 | 216 |
| 2gel-assembly1.cif.gz_A | 2.05a crystal structure of salmonella typhimurium yeaz, form b | 0.8744 | 3 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWL0_1_92_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.967 | 3 | 92 | 3.30.420.40 |
| af_P76256_2_102_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9656 | 4 | 103 | 3.30.420.40 |
| af_P76256_2_128_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9549 | 4 | 132 | 3.40.50.2000 |
| af_A0A1D6MRI9_77_194_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9423 | 7 | 101 | 3.30.420.40 |
| af_P76256_2_128_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9404 | 4 | 132 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519MS36-F1-model_v4 | deleted | 0.9885 | 1 | 227 |
|
| AF-A0A519MS36-F1-model_v4 | deleted | 0.9842 | 1 | 227 |
|
| AF-A0A520DWJ7-F1-model_v4 | tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | 0.982 | 67 | 227 |
GO:0002949
GO:0016740 |
| AF-A0A7Y3ELP6-F1-model_v4 | tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB | 0.9773 | 3 | 97 |
GO:0002949
GO:0005829 GO:0016740 |
| AF-A0A382ESK2-F1-model_v4 | Gcp-like domain-containing protein | 0.9758 | 3 | 101 |
GO:0002949
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar