F396848

General Info

Members Datasets Scaffolds Average Seq Length
303 199 279 228

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10197089|Ga0070691_101970891
Length 265
Sequence MARRVFDLGLKTSDQQRPSSNIPLTSSIFTYLCSMAKILQIETATAICSVALSVNGKTISFKEEQGHNLHAANLTLFIDEVVRTAGLSYQELDAIAVSKGPGSYTGLRIGVSTAKGLCYALDKPLIAIETLEMMAAGYLAENPHYSGLICPMIDARRMEVYTSIFDLSLNIITPTEAKIIDETSFTDYLTQETLTFIGDGSAKCAEVLIHQNAKFDEANFNSATYMSRLANEAFGSSNFEDVAYFEPFYLKDFVVTQSKKQQAQG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541302 Pedobacter sp. CF074 Isolate Unclassified
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 2739367656 Pedobacter sp. CF523 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
16 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
17 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
18 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
19 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
20 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
21 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
22 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
23 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
24 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
25 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
134 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
135 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
136 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
150 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
154 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.75
Metatranscriptomes 0.33
Isolates 7.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 0
Rhizoplane 1.65
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 7.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1465161 2162886007 Bacteria 1432
2 JGI25152J39213_1002637 3300002773 Bacteria 6664
3 JGI25150J39212_1000049 3300002774 Bacteria 73898
4 JGI25151J46595_10000003 3300003187 Bacteria 715330
5 JGI25153J46596_10000154 3300003215 Bacteria 69318
6 rootH2_10056482 3300003320 Bacteria 2211
7 rootH2_10095376 3300003320 Bacteria 17934
8 rootH2_10286878 3300003320 Bacteria 1235
9 rootL2_10032483 3300003322 Bacteria 3380
10 Ga0065714_10006710 3300005288 Bacteria 4500
11 Ga0065714_10089768 3300005288 Bacteria 1967
12 Ga0065714_10134001 3300005288 Bacteria 1225
13 Ga0065704_10109127 3300005289 Bacteria 2011
14 Ga0065712_10087786 3300005290 Bacteria 2555
15 Ga0070658_10000091 3300005327 Bacteria 81263
16 Ga0070683_100001004 3300005329 Bacteria 21143
17 Ga0070683_100187047 3300005329 Bacteria 1966
18 Ga0070670_100286752 3300005331 Bacteria 1438
19 Ga0070670_100326270 3300005331 Bacteria 1346
20 Ga0070670_100426281 3300005331 Unclassified 1173
21 Ga0070682_100015226 3300005337 Bacteria 4453
22 Ga0070689_100026770 3300005340 Bacteria 4343
23 Ga0070691_10197089 3300005341 Bacteria 1056
24 Ga0070661_100000922 3300005344 Bacteria 21063
25 Ga0070669_100015753 3300005353 Bacteria 5390
26 Ga0070671_100058203 3300005355 Bacteria 3217
27 Ga0070671_100658880 3300005355 Unclassified 907
28 Ga0070688_100107756 3300005365 Unclassified 1848
29 Ga0070659_100070336 3300005366 Unclassified 2780
30 Ga0070667_100074526 3300005367 Bacteria 2896
31 Ga0070663_100042775 3300005455 Bacteria 3185
32 Ga0070662_100018859 3300005457 Bacteria 4674
33 Ga0070685_10129128 3300005466 Bacteria 1578
34 Ga0070679_100164571 3300005530 Bacteria 2192
35 Ga0070684_100000042 3300005535 Bacteria 89896
36 Ga0068853_100003672 3300005539 Bacteria 11770
37 Ga0068853_100010717 3300005539 Bacteria 7424
38 Ga0070665_100764057 3300005548 Bacteria 979
39 Ga0068855_100075797 3300005563 Bacteria 3905
40 Ga0070664_100000266 3300005564 Bacteria 37671
41 Ga0070664_100018138 3300005564 Bacteria 5777
42 Ga0070664_100087741 3300005564 Bacteria 2690
43 Ga0068857_100006612 3300005577 Bacteria 9955
44 Ga0068857_100180869 3300005577 Bacteria 1919
45 Ga0068857_100537795 3300005577 Bacteria 1100
46 Ga0068854_100011674 3300005578 Bacteria 5729
47 Ga0068852_100151694 3300005616 Unclassified 2156
48 Ga0068852_100591543 3300005616 Bacteria 1113
49 Ga0068859_100012944 3300005617 Bacteria 8382
50 Ga0068859_100016137 3300005617 Bacteria 7501
51 Ga0068859_100120171 3300005617 Bacteria 2694
52 Ga0068864_100038571 3300005618 Bacteria 4081
53 Ga0068861_100051333 3300005719 Bacteria 3130
54 Ga0068861_100767053 3300005719 Bacteria 902
55 Ga0068863_100029026 3300005841 Bacteria 5284
56 Ga0068858_100012456 3300005842 Bacteria 8019
57 Ga0068858_100367230 3300005842 Bacteria 1380
58 Ga0068860_100023035 3300005843 Bacteria 6023
59 Ga0075366_10037675 3300006195 Unclassified 2856
60 Ga0068871_100093721 3300006358 Bacteria 2506
61 Ga0075430_100636762 3300006846 Bacteria 879
62 Ga0075431_100156483 3300006847 Bacteria 2344
63 Ga0097620_100012943 3300006931 Bacteria 8382
64 Ga0097620_100016137 3300006931 Bacteria 7501
65 Ga0097620_100120169 3300006931 Bacteria 2694
66 Ga0105240_10000010 3300009093 Bacteria 537830
67 Ga0105240_10187480 3300009093 Bacteria 2435
68 Ga0105240_10502814 3300009093 Bacteria 1347
69 Ga0105247_10002375 3300009101 Bacteria 12826
70 Ga0114129_10239923 3300009147 Bacteria 2437
71 Ga0105241_10010042 3300009174 Bacteria 6949
72 Ga0105242_10177708 3300009176 Unclassified 1876
73 Ga0105237_10001016 3300009545 Bacteria 37771
74 Ga0105237_10038857 3300009545 Bacteria 4806
75 Ga0105249_10070285 3300009553 Bacteria 3231
76 Ga0105249_10077543 3300009553 Bacteria 3082
77 Ga0105239_10024694 3300010375 Bacteria 6620
78 Ga0105239_10040360 3300010375 Bacteria 5114
79 Ga0157373_10007307 3300013100 Bacteria 8225
80 Ga0157373_10089560 3300013100 Bacteria 2167
81 Ga0157371_10003037 3300013102 Bacteria 15587
82 Ga0157371_10006524 3300013102 Bacteria 9602
83 Ga0157371_10082049 3300013102 Bacteria 2283
84 Ga0157371_10095382 3300013102 Bacteria 2108
85 Ga0157371_10171978 3300013102 Unclassified 1548
86 Ga0157370_10020270 3300013104 Bacteria 6640
87 Ga0157370_10024857 3300013104 Bacteria 5932
88 Ga0157370_10106900 3300013104 Bacteria 2618
89 Ga0157370_10152625 3300013104 Bacteria 2149
90 Ga0157370_10184849 3300013104 Bacteria 1935
91 Ga0157370_10347847 3300013104 Bacteria 1366
92 Ga0157369_10005497 3300013105 Bacteria 14723
93 Ga0157369_10085873 3300013105 Bacteria 3362
94 Ga0157374_10027821 3300013296 Bacteria 5104
95 Ga0157374_10062669 3300013296 Unclassified 3486
96 Ga0157378_10003152 3300013297 Bacteria 14654
97 Ga0163162_10022713 3300013306 Bacteria 6185
98 Ga0163162_10584870 3300013306 Bacteria 1243
99 Ga0157372_10000015 3300013307 Bacteria 225365
100 Ga0157372_10413443 3300013307 Bacteria 1572
101 Ga0157372_10656277 3300013307 Bacteria 1222
102 Ga0157372_10796079 3300013307 Bacteria 1098
103 Ga0157375_10011362 3300013308 Bacteria 7861
104 Ga0157375_10024213 3300013308 Bacteria 5614
105 Ga0157375_10787564 3300013308 Bacteria 1100
106 Ga0157380_10000129 3300014326 Bacteria 41853
107 Ga0182008_10000009 3300014497 Bacteria 331416
108 Ga0182008_10048316 3300014497 Bacteria 2113
109 Ga0182008_10073996 3300014497 Bacteria 1676
110 Ga0157379_10226171 3300014968 Bacteria 1696
111 Ga0157379_10295217 3300014968 Bacteria 1476
112 Ga0157376_11171707 3300014969 Unclassified 796
113 Ga0182006_1001050 3300015261 Bacteria 17847
114 Ga0182006_1001177 3300015261 Bacteria 16424
115 Ga0182007_10000080 3300015262 Bacteria 73401
116 Ga0182007_10005726 3300015262 Bacteria 5417
117 Ga0182007_10035057 3300015262 Bacteria 1692
118 Ga0183373_1003 3300015682 Bacteria 558813
119 Ga0163161_10001026 3300017792 Bacteria 21295
120 Ga0163161_10001645 3300017792 Bacteria 16426
121 Ga0163161_10019127 3300017792 Bacteria 4802
122 Ga0163161_10071969 3300017792 Bacteria 2531
123 Ga0163161_10523824 3300017792 Bacteria 968
124 Ga0206351_10045802 3300020077 Bacteria 1338
125 Ga0207425_1000004 3300025245 Bacteria 1092421
126 Ga0209129_1000005 3300025258 Bacteria 777812
127 Ga0209025_1000009 3300025294 Bacteria 1092561
128 Ga0209758_1000010 3300025297 Bacteria 1092782
129 Ga0207710_10006643 3300025900 Bacteria 4930
130 Ga0207705_10000132 3300025909 Bacteria 81270
131 Ga0207654_10004338 3300025911 Bacteria 7149
132 Ga0207695_10000019 3300025913 Bacteria 732137
133 Ga0207671_10000667 3300025914 Bacteria 44873
134 Ga0207671_10005041 3300025914 Bacteria 12338
135 Ga0207649_10000644 3300025920 Bacteria 23288
136 Ga0207652_10133639 3300025921 Bacteria 2214
137 Ga0207652_10472332 3300025921 Unclassified 1130
138 Ga0207650_10358807 3300025925 Bacteria 1200
139 Ga0207644_10299522 3300025931 Unclassified 1295
140 Ga0207690_10050038 3300025932 Unclassified 2788
141 Ga0207706_10032203 3300025933 Bacteria 4669
142 Ga0207670_10214606 3300025936 Unclassified 1469
143 Ga0207661_10000781 3300025944 Bacteria 20721
144 Ga0207661_10161528 3300025944 Bacteria 1944
145 Ga0207679_10000733 3300025945 Bacteria 21828
146 Ga0207667_10092760 3300025949 Bacteria 3119
147 Ga0207712_10013550 3300025961 Bacteria 5228
148 Ga0207640_10210496 3300025981 Bacteria 1481
149 Ga0207658_10089383 3300025986 Bacteria 2384
150 Ga0207703_10280723 3300026035 Unclassified 1512
151 Ga0207639_10005779 3300026041 Bacteria 8376
152 Ga0207639_10007423 3300026041 Bacteria 7476
153 Ga0207639_10041435 3300026041 Bacteria 3445
154 Ga0207678_10061675 3300026067 Bacteria 3225
155 Ga0207708_10137823 3300026075 Bacteria 1912
156 Ga0207702_10171755 3300026078 Bacteria 1988
157 Ga0207641_10020546 3300026088 Bacteria 5424
158 Ga0207676_10025141 3300026095 Bacteria 4417
159 Ga0207674_10003645 3300026116 Bacteria 18783
160 Ga0207675_100915355 3300026118 Bacteria 894
161 Ga0207698_10113516 3300026142 Unclassified 2276
162 Ga0207698_10565194 3300026142 Bacteria 1117
163 Ga0209974_10105676 3300027876 Bacteria 987
164 Ga0268266_10161464 3300028379 Bacteria 2028
165 Ga0268264_10024319 3300028381 Bacteria 4946
166 Ga0268264_10382326 3300028381 Unclassified 1348
167 Ga0265323_10000405 3300028653 Bacteria 24740
168 Ga0307515_10060509 3300028794 Bacteria 5398
169 Ga0307515_10239484 3300028794 Bacteria 1589
170 Ga0316177_1179118 3300030731 Bacteria 21596
171 Ga0316176_1093215 3300030732 Bacteria 18436
172 Ga0316183_1008910 3300030742 Bacteria 14367
173 Ga0316181_1092332 3300030744 Bacteria 22982
174 Ga0265327_10192625 3300031251 Bacteria 927
175 Ga0265316_10023695 3300031344 Bacteria 5153
176 Ga0265342_10075645 3300031712 Bacteria 1953
177 Ga0316576_10035888 3300031727 Bacteria 3543
178 Ga0316576_10116195 3300031727 Unclassified 2008
179 Ga0307405_10000030 3300031731 Bacteria 99574
180 Ga0316577_10123204 3300031733 Bacteria 1457
181 Ga0307414_10000156 3300032004 Bacteria 45193
182 Ga0307414_10000641 3300032004 Bacteria 17892
183 Ga0307414_10242699 3300032004 Bacteria 1492
184 Ga0307414_10269360 3300032004 Unclassified 1425
185 Ga0316574_0051814 3300035398 Bacteria 2558
186 Ga0316574_0088722 3300035398 Bacteria 1970
187 Ga0316574_0217566 3300035398 Unclassified 1225
188 Ga0316584_0431371 3300036712 Bacteria 935
189 Ga0395899_0000332 3300037312 Bacteria 59463
190 Ga0395899_0027800 3300037312 Bacteria 4261
191 Ga0395900_0184853 3300037418 Bacteria 2116
192 Ga0395901_0023507 3300038443 Bacteria 6321
193 Ga0400483_076794 3300039062 Bacteria 36477
194 Ga0400483_173421 3300039062 Bacteria 32116
195 Ga0451795_1584742 3300041456 Bacteria 2385
196 Ga0451802_0225134 3300041460 Bacteria 822
197 Ga0451807_0533859 3300041486 Bacteria 947
198 Ga0451855_0254494 3300041511 Bacteria 1256
199 Ga0439442_006943 3300042002 Unclassified 2274
200 Ga0451577_0000030 3300042876 Bacteria 391423
201 Ga0451577_0000542 3300042876 Bacteria 62075
202 Ga0451577_0003644 3300042876 Bacteria 16925
203 Ga0451577_0033529 3300042876 Bacteria 4629
204 Ga0451577_0315969 3300042876 Bacteria 1416
205 Ga0453683_0000039 3300044673 Bacteria 228860
206 Ga0453683_0000040 3300044673 Bacteria 225430
207 Ga0453683_0005612 3300044673 Bacteria 8720
208 Ga0453683_0142130 3300044673 Bacteria 1515
209 Ga0466961_0063956 3300044693 Bacteria 2338
210 Ga0453684_0000225 3300044712 Bacteria 245902
211 Ga0453684_0000340 3300044712 Bacteria 194264
212 Ga0453684_0000461 3300044712 Bacteria 162371
213 Ga0453684_0000733 3300044712 Bacteria 114914
214 Ga0453684_0019831 3300044712 Bacteria 10201
215 Ga0453684_0074898 3300044712 Bacteria 4258
216 Ga0453684_0082580 3300044712 Bacteria 4002
217 Ga0453684_0213533 3300044712 Bacteria 2241
218 Ga0453684_0213984 3300044712 Bacteria 2238
219 Ga0453684_0224561 3300044712 Bacteria 2173
220 Ga0466959_0133986 3300045049 Bacteria 1755
221 Ga0466959_0269700 3300045049 Bacteria 1170
222 Ga0451576_0000093 3300045051 Bacteria 226300
223 Ga0451576_0000172 3300045051 Bacteria 162376
224 Ga0451576_0004571 3300045051 Bacteria 17879
225 Ga0451576_0053886 3300045051 Bacteria 4212
226 Ga0451576_0120973 3300045051 Bacteria 2725
227 Ga0451576_0559904 3300045051 Bacteria 1201
228 Ga0466958_0039310 3300045836 Bacteria 2842
229 Ga0495580_0148874 3300046472 Unclassified 1622
230 Ga0495585_0000777 3300046492 Bacteria 28217
231 Ga0495583_0072111 3300046506 Bacteria 1516
232 Ga0495610_0000787 3300046512 Bacteria 29709
233 Ga0495643_0076033 3300046522 Bacteria 1756
234 Ga0495644_0059658 3300046523 Bacteria 1434
235 Ga0495648_0032143 3300046524 Bacteria 3447
236 Ga0495609_0011743 3300046538 Bacteria 4165
237 Ga0495633_0000023 3300046558 Bacteria 226510
238 Ga0495625_0018400 3300046660 Bacteria 5457
239 Ga0495625_0103295 3300046660 Unclassified 1955
240 Ga0495661_0006816 3300046665 Bacteria 7998
241 Ga0495658_0024651 3300046683 Bacteria 3206
242 Ga0495672_0067376 3300047320 Unclassified 2039
243 Ga0495687_000736 3300047443 Bacteria 35743
244 Ga0495686_0135312 3300047472 Bacteria 1458
245 Ga0495686_0136012 3300047472 Bacteria 1453
246 Ga0496104_0665715 3300048907 Bacteria 950
247 Ga0496115_0019413 3300048918 Bacteria 5230
248 Ga0496126_0005123 3300048929 Bacteria 15180
249 Ga0501032_0010076 3300049569 Bacteria 6823
250 Ga0501032_0043622 3300049569 Bacteria 3036
251 Ga0501033_0018072 3300049570 Bacteria 5327
252 Ga0501034_0178125 3300049571 Bacteria 2091
253 Ga0501034_0180504 3300049571 Bacteria 2075
254 Ga0501036_0079155 3300049572 Bacteria 2780
255 Ga0501037_0021694 3300049573 Bacteria 4750
256 Ga0501037_0235054 3300049573 Bacteria 1286
257 Ga0501038_0131224 3300049574 Bacteria 2057
258 Ga0501043_0091378 3300049579 Bacteria 2393
259 Ga0501043_0177277 3300049579 Bacteria 1661
260 Ga0501043_0583267 3300049579 Unclassified 828
261 Ga0501046_0006756 3300049580 Bacteria 10131
262 Ga0501047_0245711 3300049581 Bacteria 1639
263 Ga0501070_0105146 3300049586 Bacteria 2334
264 Ga0501080_0177143 3300049742 Bacteria 1964
265 Ga0501080_0366414 3300049742 Bacteria 1299
266 Ga0501280_009191 3300049776 Bacteria 1375
267 Ga0501035_0028671 3300049822 Bacteria 5080
268 Ga0501035_0054108 3300049822 Bacteria 3587
269 Ga0501044_0021980 3300049823 Bacteria 6802
270 Ga0501044_0052997 3300049823 Bacteria 4176
271 Ga0501044_0082942 3300049823 Unclassified 3242
272 Ga0501044_0103210 3300049823 Bacteria 2866
273 Ga0501044_0431293 3300049823 Bacteria 1227
274 nmdc:mga0k408_3233_c1 3300050493 Bacteria 8623
275 nmdc:mga05p37_359073_c1 3300050507 Bacteria 1713
276 nmdc:mga09592_19360_c1 3300050508 Bacteria 5589
277 nmdc:mga0qj67_602399_c1 3300050509 Bacteria 879
278 nmdc:mga06r32_72141_c1 3300050510 Bacteria 3343
279 Ga0500641_0000719 3300053096 Bacteria 11981

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0180504 Ga0501034_0180504_1507_2055 170
2 3300006847 Ga0075431_100156483 Ga0075431_1001564831 191
3 3300048907 Ga0496104_0665715 Ga0496104_0665715_37_630 196
4 3300039062 Ga0400483_076794 Ga0400483_076794_13525_14244 209
5 3300039062 Ga0400483_173421 Ga0400483_173421_26283_27002 209
6 3300042876 Ga0451577_0033529 Ga0451577_0033529_1212_1907 212
7 3300044673 Ga0453683_0000040 Ga0453683_0000040_109337_110032 212
8 3300044712 Ga0453684_0019831 Ga0453684_0019831_7756_8451 212
9 3300049569 Ga0501032_0043622 Ga0501032_0043622_872_1549 212
10 3300049572 Ga0501036_0079155 Ga0501036_0079155_1634_2311 212
11 3300049573 Ga0501037_0021694 Ga0501037_0021694_279_956 212
12 3300049579 Ga0501043_0091378 Ga0501043_0091378_629_1306 212
13 3300049580 Ga0501046_0006756 Ga0501046_0006756_9171_9848 212
14 3300049581 Ga0501047_0245711 Ga0501047_0245711_596_1273 212
15 3300049742 Ga0501080_0366414 Ga0501080_0366414_494_1171 212
16 3300049823 Ga0501044_0021980 Ga0501044_0021980_2707_3384 212
17 3300017792 Ga0163161_10001645 Ga0163161_1000164518 213
18 3300031731 Ga0307405_10000030 Ga0307405_1000003038 214
19 iso_pu_bacteria 2881247448 2881249155 214
20 3300015261 Ga0182006_1001050 Ga0182006_10010506 215
21 3300005578 Ga0068854_100011674 Ga0068854_1000116747 217
22 3300009545 Ga0105237_10038857 Ga0105237_100388573 217
23 3300013104 Ga0157370_10347847 Ga0157370_103478472 217
24 3300025914 Ga0207671_10005041 Ga0207671_100050414 217
25 3300025981 Ga0207640_10210496 Ga0207640_102104962 217
26 3300048918 Ga0496115_0019413 Ga0496115_0019413_271_930 217
27 3300048929 Ga0496126_0005123 Ga0496126_0005123_4567_5226 217
28 iso_pu_bacteria 2890804823 2890806171 217
29 3300015261 Ga0182006_1001177 Ga0182006_100117716 218
30 3300017792 Ga0163161_10523824 Ga0163161_105238242 218
31 3300053096 Ga0500641_0000719 Ga0500641_0000719_7074_7736 218
32 3300035398 Ga0316574_0051814 Ga0316574_0051814_1187_1849 219
33 3300041511 Ga0451855_0254494 Ga0451855_0254494_534_1220 219
34 iso_pu_bacteria 2833640130 2833642144 219
35 iso_pu_bacteria 2929154850 2929158796 219
36 3300005548 Ga0070665_100764057 Ga0070665_1007640571 220
37 3300005719 Ga0068861_100767053 Ga0068861_1007670531 220
38 3300006195 Ga0075366_10037675 Ga0075366_100376754 220
39 3300009176 Ga0105242_10177708 Ga0105242_101777083 220
40 3300013104 Ga0157370_10152625 Ga0157370_101526252 220
41 3300026118 Ga0207675_100915355 Ga0207675_1009153551 220
42 3300028379 Ga0268266_10161464 Ga0268266_101614642 220
43 3300035398 Ga0316574_0088722 Ga0316574_0088722_209_880 220
44 3300036712 Ga0316584_0431371 Ga0316584_0431371_80_751 220
45 3300047472 Ga0495686_0136012 Ga0495686_0136012_293_955 220
46 3300050493 nmdc:mga0k408_3233_c1 nmdc:mga0k408_3233_c1_4337_4999 220
47 3300005331 Ga0070670_100426281 Ga0070670_1004262812 221
48 3300005353 Ga0070669_100015753 Ga0070669_1000157533 221
49 3300005466 Ga0070685_10129128 Ga0070685_101291283 221
50 3300005577 Ga0068857_100537795 Ga0068857_1005377952 221
51 3300005617 Ga0068859_100012944 Ga0068859_1000129448 221
52 3300005618 Ga0068864_100038571 Ga0068864_1000385713 221
53 3300005719 Ga0068861_100051333 Ga0068861_1000513334 221
54 3300005842 Ga0068858_100367230 Ga0068858_1003672301 221
55 3300005843 Ga0068860_100023035 Ga0068860_1000230355 221
56 3300006931 Ga0097620_100012943 Ga0097620_1000129438 221
57 3300009101 Ga0105247_10002375 Ga0105247_100023755 221
58 3300009553 Ga0105249_10077543 Ga0105249_100775432 221
59 3300013100 Ga0157373_10089560 Ga0157373_100895602 221
60 3300013307 Ga0157372_10413443 Ga0157372_104134431 221
61 3300013307 Ga0157372_10796079 Ga0157372_107960792 221
62 3300014968 Ga0157379_10295217 Ga0157379_102952172 221
63 3300015262 Ga0182007_10000080 Ga0182007_1000008013 221
64 3300017792 Ga0163161_10019127 Ga0163161_100191273 221
65 3300025900 Ga0207710_10006643 Ga0207710_100066434 221
66 3300025961 Ga0207712_10013550 Ga0207712_100135505 221
67 3300026095 Ga0207676_10025141 Ga0207676_100251414 221
68 3300027876 Ga0209974_10105676 Ga0209974_101056761 221
69 3300028381 Ga0268264_10024319 Ga0268264_100243193 221
70 3300037418 Ga0395900_0184853 Ga0395900_0184853_866_1534 221
71 3300041486 Ga0451807_0533859 Ga0451807_0533859_130_798 221
72 3300042002 Ga0439442_006943 Ga0439442_006943_972_1637 221
73 3300044673 Ga0453683_0142130 Ga0453683_0142130_562_1233 221
74 3300046522 Ga0495643_0076033 Ga0495643_0076033_643_1308 221
75 3300049569 Ga0501032_0010076 Ga0501032_0010076_4995_5672 221
76 3300049822 Ga0501035_0028671 Ga0501035_0028671_615_1292 221
77 3300049823 Ga0501044_0052997 Ga0501044_0052997_2164_2841 221
78 iso_pu_bacteria 2852623160 2852624153 221
79 iso_pu_bacteria 2884933994 2884936927 221
80 3300005539 Ga0068853_100010717 Ga0068853_1000107173 222
81 3300026041 Ga0207639_10007423 Ga0207639_100074233 222
82 3300049573 Ga0501037_0235054 Ga0501037_0235054_124_804 222
83 3300049574 Ga0501038_0131224 Ga0501038_0131224_127_807 222
84 3300049579 Ga0501043_0177277 Ga0501043_0177277_814_1494 222
85 3300049823 Ga0501044_0431293 Ga0501044_0431293_423_1103 222
86 iso_pu_bacteria 2739367663 2739644711 222
87 iso_pu_bacteria 2842903701 2842907902 222
88 3300003320 rootH2_10095376 rootH2_100953761 223
89 3300005290 Ga0065712_10087786 Ga0065712_100877862 223
90 3300005340 Ga0070689_100026770 Ga0070689_1000267702 223
91 3300005355 Ga0070671_100658880 Ga0070671_1006588801 223
92 3300005365 Ga0070688_100107756 Ga0070688_1001077563 223
93 3300005367 Ga0070667_100074526 Ga0070667_1000745263 223
94 3300005457 Ga0070662_100018859 Ga0070662_1000188594 223
95 3300005564 Ga0070664_100087741 Ga0070664_1000877413 223
96 3300005577 Ga0068857_100180869 Ga0068857_1001808693 223
97 3300005616 Ga0068852_100151694 Ga0068852_1001516942 223
98 3300005617 Ga0068859_100016137 Ga0068859_1000161373 223
99 3300005617 Ga0068859_100120171 Ga0068859_1001201714 223
100 3300005842 Ga0068858_100012456 Ga0068858_1000124562 223
101 3300006358 Ga0068871_100093721 Ga0068871_1000937211 223
102 3300006931 Ga0097620_100016137 Ga0097620_1000161373 223
103 3300006931 Ga0097620_100120169 Ga0097620_1001201692 223
104 3300009553 Ga0105249_10070285 Ga0105249_100702852 223
105 3300013102 Ga0157371_10082049 Ga0157371_100820492 223
106 3300013296 Ga0157374_10062669 Ga0157374_100626691 223
107 3300013306 Ga0163162_10022713 Ga0163162_100227135 223
108 3300013307 Ga0157372_10656277 Ga0157372_106562771 223
109 3300025933 Ga0207706_10032203 Ga0207706_100322034 223
110 3300025936 Ga0207670_10214606 Ga0207670_102146062 223
111 3300025986 Ga0207658_10089383 Ga0207658_100893832 223
112 3300026035 Ga0207703_10280723 Ga0207703_102807232 223
113 3300026041 Ga0207639_10041435 Ga0207639_100414353 223
114 3300026075 Ga0207708_10137823 Ga0207708_101378232 223
115 3300026142 Ga0207698_10113516 Ga0207698_101135163 223
116 3300028381 Ga0268264_10382326 Ga0268264_103823262 223
117 3300032004 Ga0307414_10000156 Ga0307414_100001564 223
118 3300044712 Ga0453684_0082580 Ga0453684_0082580_2514_3188 223
119 3300047320 Ga0495672_0067376 Ga0495672_0067376_729_1400 223
120 3300049579 Ga0501043_0583267 Ga0501043_0583267_119_790 223
121 iso_pu_bacteria 2585427687 2586210748 223
122 iso_pu_bacteria 2738541302 2738853373 223
123 iso_pu_bacteria 2738543023 2739304695 223
124 iso_pu_bacteria 2739367651 2739591156 223
125 iso_pu_bacteria 2739367656 2739615486 223
126 iso_pu_bacteria 2775506987 2776614419 223
127 iso_pu_bacteria 2818991437 2819548943 223
128 iso_pu_bacteria 2842722452 2842723334 223
129 iso_pu_bacteria 2842909656 2842909827 223
130 iso_pu_bacteria 2849281842 2849285346 223
131 iso_pu_bacteria 2857627736 2857628699 223
132 iso_pu_bacteria 2902048731 2902050200 223
133 iso_pu_bacteria 2939664404 2939664970 223
134 iso_pu_bacteria 2945997725 2946000144 223
135 iso_pu_bacteria 2954016120 2954017059 223
136 iso_pu_bacteria 3003233435 3003234111 223
137 3300003320 rootH2_10286878 rootH2_102868781 224
138 3300005331 Ga0070670_100286752 Ga0070670_1002867523 224
139 3300005841 Ga0068863_100029026 Ga0068863_1000290263 224
140 3300006846 Ga0075430_100636762 Ga0075430_1006367621 224
141 3300009147 Ga0114129_10239923 Ga0114129_102399233 224
142 3300010375 Ga0105239_10040360 Ga0105239_100403603 224
143 3300013308 Ga0157375_10024213 Ga0157375_100242135 224
144 3300014326 Ga0157380_10000129 Ga0157380_1000012928 224
145 3300014968 Ga0157379_10226171 Ga0157379_102261711 224
146 3300026088 Ga0207641_10020546 Ga0207641_100205463 224
147 3300028794 Ga0307515_10239484 Ga0307515_102394843 224
148 3300032004 Ga0307414_10242699 Ga0307414_102426993 224
149 3300032004 Ga0307414_10269360 Ga0307414_102693602 224
150 3300041460 Ga0451802_0225134 Ga0451802_0225134_21_695 224
151 3300045049 Ga0466959_0133986 Ga0466959_0133986_170_850 224
152 3300046472 Ga0495580_0148874 Ga0495580_0148874_190_864 224
153 3300047443 Ga0495687_000736 Ga0495687_000736_26908_27585 224
154 3300050507 nmdc:mga05p37_359073_c1 nmdc:mga05p37_359073_c1_277_966 224
155 3300050508 nmdc:mga09592_19360_c1 nmdc:mga09592_19360_c1_2437_3126 224
156 3300050509 nmdc:mga0qj67_602399_c1 nmdc:mga0qj67_602399_c1_136_825 224
157 3300050510 nmdc:mga06r32_72141_c1 nmdc:mga06r32_72141_c1_55_744 224
158 3300005288 Ga0065714_10134001 Ga0065714_101340011 225
159 3300009093 Ga0105240_10000010 Ga0105240_10000010294 225
160 3300009174 Ga0105241_10010042 Ga0105241_100100425 225
161 3300009545 Ga0105237_10001016 Ga0105237_1000101633 225
162 3300010375 Ga0105239_10024694 Ga0105239_100246943 225
163 3300013297 Ga0157378_10003152 Ga0157378_1000315215 225
164 3300013308 Ga0157375_10011362 Ga0157375_100113624 225
165 3300025911 Ga0207654_10004338 Ga0207654_100043386 225
166 3300025913 Ga0207695_10000019 Ga0207695_10000019161 225
167 3300026078 Ga0207702_10171755 Ga0207702_101717551 225
168 3300037312 Ga0395899_0027800 Ga0395899_0027800_1611_2297 225
169 3300038443 Ga0395901_0023507 Ga0395901_0023507_183_869 225
170 3300041456 Ga0451795_1584742 Ga0451795_1584742_1073_1762 225
171 3300046558 Ga0495633_0000023 Ga0495633_0000023_132969_133715 225
172 3300003320 rootH2_10056482 rootH2_100564823 226
173 3300003322 rootL2_10032483 rootL2_100324834 226
174 3300005327 Ga0070658_10000091 Ga0070658_1000009131 226
175 3300005329 Ga0070683_100001004 Ga0070683_10000100411 226
176 3300005329 Ga0070683_100187047 Ga0070683_1001870473 226
177 3300005331 Ga0070670_100326270 Ga0070670_1003262701 226
178 3300005337 Ga0070682_100015226 Ga0070682_1000152263 226
179 3300005344 Ga0070661_100000922 Ga0070661_10000092213 226
180 3300005355 Ga0070671_100058203 Ga0070671_1000582033 226
181 3300005366 Ga0070659_100070336 Ga0070659_1000703363 226
182 3300005530 Ga0070679_100164571 Ga0070679_1001645714 226
183 3300005535 Ga0070684_100000042 Ga0070684_10000004212 226
184 3300005539 Ga0068853_100003672 Ga0068853_10000367210 226
185 3300005563 Ga0068855_100075797 Ga0068855_1000757971 226
186 3300005564 Ga0070664_100000266 Ga0070664_10000026632 226
187 3300005564 Ga0070664_100018138 Ga0070664_1000181382 226
188 3300005577 Ga0068857_100006612 Ga0068857_1000066129 226
189 3300009093 Ga0105240_10187480 Ga0105240_101874802 226
190 3300009093 Ga0105240_10502814 Ga0105240_105028143 226
191 3300013102 Ga0157371_10095382 Ga0157371_100953823 226
192 3300013104 Ga0157370_10184849 Ga0157370_101848493 226
193 3300013105 Ga0157369_10085873 Ga0157369_100858734 226
194 3300013296 Ga0157374_10027821 Ga0157374_100278211 226
195 3300013306 Ga0163162_10584870 Ga0163162_105848702 226
196 3300013307 Ga0157372_10000015 Ga0157372_10000015100 226
197 3300014969 Ga0157376_11171707 Ga0157376_111717071 226
198 3300020077 Ga0206351_10045802 Ga0206351_100458022 226
199 3300025909 Ga0207705_10000132 Ga0207705_1000013231 226
200 3300025914 Ga0207671_10000667 Ga0207671_1000066749 226
201 3300025920 Ga0207649_10000644 Ga0207649_1000064411 226
202 3300025921 Ga0207652_10133639 Ga0207652_101336392 226
203 3300025921 Ga0207652_10472332 Ga0207652_104723322 226
204 3300025925 Ga0207650_10358807 Ga0207650_103588071 226
205 3300025931 Ga0207644_10299522 Ga0207644_102995222 226
206 3300025932 Ga0207690_10050038 Ga0207690_100500383 226
207 3300025944 Ga0207661_10000781 Ga0207661_1000078110 226
208 3300025944 Ga0207661_10161528 Ga0207661_101615283 226
209 3300025945 Ga0207679_10000733 Ga0207679_1000073314 226
210 3300025949 Ga0207667_10092760 Ga0207667_100927602 226
211 3300026041 Ga0207639_10005779 Ga0207639_100057796 226
212 3300026116 Ga0207674_10003645 Ga0207674_100036459 226
213 3300031251 Ga0265327_10192625 Ga0265327_101926252 226
214 3300037312 Ga0395899_0000332 Ga0395899_0000332_22339_23028 226
215 3300044693 Ga0466961_0063956 Ga0466961_0063956_517_1206 226
216 3300045049 Ga0466959_0269700 Ga0466959_0269700_123_812 226
217 3300045836 Ga0466958_0039310 Ga0466958_0039310_1782_2471 226
218 3300046523 Ga0495644_0059658 Ga0495644_0059658_458_1144 226
219 3300046660 Ga0495625_0103295 Ga0495625_0103295_713_1408 226
220 3300049570 Ga0501033_0018072 Ga0501033_0018072_3612_4310 226
221 3300049571 Ga0501034_0178125 Ga0501034_0178125_117_818 226
222 3300049586 Ga0501070_0105146 Ga0501070_0105146_1574_2272 226
223 3300049742 Ga0501080_0177143 Ga0501080_0177143_1219_1917 226
224 3300049822 Ga0501035_0054108 Ga0501035_0054108_57_755 226
225 3300049823 Ga0501044_0082942 Ga0501044_0082942_424_1122 226
226 3300049823 Ga0501044_0103210 Ga0501044_0103210_69_767 226
227 2162886007 SwRhRL2b_contig_1465161 SwRhRL2b_0911.00004710 227
228 3300002773 JGI25152J39213_1002637 JGI25152J39213_10026379 227
229 3300002774 JGI25150J39212_1000049 JGI25150J39212_100004930 227
230 3300003187 JGI25151J46595_10000003 JGI25151J46595_1000000330 227
231 3300003215 JGI25153J46596_10000154 JGI25153J46596_1000015439 227
232 3300005288 Ga0065714_10006710 Ga0065714_100067103 227
233 3300005288 Ga0065714_10089768 Ga0065714_100897682 227
234 3300005289 Ga0065704_10109127 Ga0065704_101091272 227
235 3300005341 Ga0070691_10197089 Ga0070691_101970891 227
236 3300005455 Ga0070663_100042775 Ga0070663_1000427755 227
237 3300005616 Ga0068852_100591543 Ga0068852_1005915431 227
238 3300013100 Ga0157373_10007307 Ga0157373_100073076 227
239 3300013102 Ga0157371_10003037 Ga0157371_1000303716 227
240 3300013102 Ga0157371_10006524 Ga0157371_100065244 227
241 3300013102 Ga0157371_10171978 Ga0157371_101719782 227
242 3300013104 Ga0157370_10020270 Ga0157370_100202705 227
243 3300013104 Ga0157370_10024857 Ga0157370_100248575 227
244 3300013104 Ga0157370_10106900 Ga0157370_101069002 227
245 3300013105 Ga0157369_10005497 Ga0157369_100054974 227
246 3300013308 Ga0157375_10787564 Ga0157375_107875642 227
247 3300014497 Ga0182008_10000009 Ga0182008_10000009104 227
248 3300014497 Ga0182008_10048316 Ga0182008_100483162 227
249 3300014497 Ga0182008_10073996 Ga0182008_100739964 227
250 3300015262 Ga0182007_10005726 Ga0182007_100057263 227
251 3300015262 Ga0182007_10035057 Ga0182007_100350574 227
252 3300015682 Ga0183373_1003 Ga0183373_1003226 227
253 3300017792 Ga0163161_10001026 Ga0163161_1000102623 227
254 3300017792 Ga0163161_10071969 Ga0163161_100719692 227
255 3300025245 Ga0207425_1000004 Ga0207425_1000004336 227
256 3300025258 Ga0209129_1000005 Ga0209129_1000005604 227
257 3300025294 Ga0209025_1000009 Ga0209025_1000009336 227
258 3300025297 Ga0209758_1000010 Ga0209758_1000010337 227
259 3300026067 Ga0207678_10061675 Ga0207678_100616755 227
260 3300026142 Ga0207698_10565194 Ga0207698_105651942 227
261 3300028653 Ga0265323_10000405 Ga0265323_1000040514 227
262 3300028794 Ga0307515_10060509 Ga0307515_100605095 227
263 3300030731 Ga0316177_1179118 Ga0316177_11791186 227
264 3300030732 Ga0316176_1093215 Ga0316176_10932152 227
265 3300030742 Ga0316183_1008910 Ga0316183_10089104 227
266 3300030744 Ga0316181_1092332 Ga0316181_10923327 227
267 3300031344 Ga0265316_10023695 Ga0265316_100236954 227
268 3300031712 Ga0265342_10075645 Ga0265342_100756453 227
269 3300031727 Ga0316576_10035888 Ga0316576_100358884 227
270 3300031727 Ga0316576_10116195 Ga0316576_101161952 227
271 3300031733 Ga0316577_10123204 Ga0316577_101232042 227
272 3300032004 Ga0307414_10000641 Ga0307414_100006413 227
273 3300035398 Ga0316574_0217566 Ga0316574_0217566_171_884 227
274 3300042876 Ga0451577_0000030 Ga0451577_0000030_387137_387862 227
275 3300042876 Ga0451577_0000542 Ga0451577_0000542_35370_36080 227
276 3300042876 Ga0451577_0003644 Ga0451577_0003644_12072_12782 227
277 3300042876 Ga0451577_0315969 Ga0451577_0315969_333_1034 227
278 3300044673 Ga0453683_0000039 Ga0453683_0000039_8507_9250 227
279 3300044673 Ga0453683_0005612 Ga0453683_0005612_7920_8639 227
280 3300044712 Ga0453684_0000225 Ga0453684_0000225_119384_120094 227
281 3300044712 Ga0453684_0000340 Ga0453684_0000340_158183_158893 227
282 3300044712 Ga0453684_0000461 Ga0453684_0000461_3562_4287 227
283 3300044712 Ga0453684_0000733 Ga0453684_0000733_13888_14616 227
284 3300044712 Ga0453684_0074898 Ga0453684_0074898_1897_2607 227
285 3300044712 Ga0453684_0213533 Ga0453684_0213533_274_1026 227
286 3300044712 Ga0453684_0213984 Ga0453684_0213984_626_1327 227
287 3300044712 Ga0453684_0224561 Ga0453684_0224561_581_1291 227
288 3300045051 Ga0451576_0000093 Ga0451576_0000093_35370_36080 227
289 3300045051 Ga0451576_0000172 Ga0451576_0000172_158076_158801 227
290 3300045051 Ga0451576_0004571 Ga0451576_0004571_4967_5671 227
291 3300045051 Ga0451576_0053886 Ga0451576_0053886_3058_3759 227
292 3300045051 Ga0451576_0120973 Ga0451576_0120973_1689_2408 227
293 3300045051 Ga0451576_0559904 Ga0451576_0559904_209_949 227
294 3300046492 Ga0495585_0000777 Ga0495585_0000777_3605_4300 227
295 3300046506 Ga0495583_0072111 Ga0495583_0072111_779_1474 227
296 3300046512 Ga0495610_0000787 Ga0495610_0000787_964_1659 227
297 3300046524 Ga0495648_0032143 Ga0495648_0032143_288_983 227
298 3300046538 Ga0495609_0011743 Ga0495609_0011743_3362_4057 227
299 3300046660 Ga0495625_0018400 Ga0495625_0018400_3966_4661 227
300 3300046665 Ga0495661_0006816 Ga0495661_0006816_587_1276 227
301 3300046683 Ga0495658_0024651 Ga0495658_0024651_1788_2483 227
302 3300047472 Ga0495686_0135312 Ga0495686_0135312_450_1145 227
303 3300049776 Ga0501280_009191 Ga0501280_009191_191_880 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

63

256

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5br9-assembly3.cif.gz_E crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa 0.8961 1 217
5br9-assembly3.cif.gz_E crystal structure of an uncharacterized protein with similarity to peptidase yeaz from pseudomonas aeruginosa 0.8922 1 217
3r6m-assembly2.cif.gz_C crystal structure of vibrio parahaemolyticus yeaz 0.8784 2 208
4y0w-assembly1.cif.gz_C-2 yeaz from pseudomonas aeruginosa 0.8769 1 216
2gel-assembly1.cif.gz_A 2.05a crystal structure of salmonella typhimurium yeaz, form b 0.8744 3 216
ID Description Score Start End Superfamily
af_Q2FWL0_1_92_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.967 3 92 3.30.420.40
af_P76256_2_102_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9656 4 103 3.30.420.40
af_P76256_2_128_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9549 4 132 3.40.50.2000
af_A0A1D6MRI9_77_194_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9423 7 101 3.30.420.40
af_P76256_2_128_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9404 4 132 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A519MS36-F1-model_v4 deleted 0.9885 1 227
AF-A0A519MS36-F1-model_v4 deleted 0.9842 1 227
AF-A0A520DWJ7-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.982 67 227 GO:0002949
GO:0016740
AF-A0A7Y3ELP6-F1-model_v4 tRNA (Adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB 0.9773 3 97 GO:0002949
GO:0005829
GO:0016740
AF-A0A382ESK2-F1-model_v4 Gcp-like domain-containing protein 0.9758 3 101 GO:0002949
GO:0005829

Feature Viewer

pLDDT pTM Quality
94.21 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map