F396903
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 158 | 303 | 419 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100184494|Ga0070699_1001844941 |
| Length | 458 |
| Sequence | MLRRRCRSYPQEPKAHANFTPEMARSSSPLRWRLKSAAILVFLFIFVVQGSQGFSVLSHEAIIDSEWDPVIKPLLLQQFPNATPDELKEAHAYAYGGAIIQDVGYYPFGNKLFSDLTHYIRSADFVRALVRDSQDLDEYAFALGALAHYVADNDGHRLAVNHAVPMLYPKLRRKFGNIVVYDQDPAAHLKTEFGFDVLEVAKGHYASDDYHNAIGFQVSKPLLQRAFQDTYSLDLTSVITKYDLAIGTFRYSVSNVIPQMTRVAWQTKKDDIRKEIPGITRRKFIYNISRASYKKSWKDQYKKPGFGTRLLSFLLRIVPKIGPFRALSFRAPTPEAGQLFMASFNTTIKDYADAVHEKEQTGELQIQNDNFDTGTVTGPGDYPLADATYAQLVDRLAKNHFQQISPELRQDILAYYSNLDAPFATKKNKKEWPRVVSEIDELKAITPAAVSAAAPAQH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 120 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 122 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 126 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 127 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 128 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 129 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 130 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0.99 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.66 |
| Rhizosphere | 98.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_3469666 | 2162886011 | Bacteria | 2153 |
| 2 | JGI24751J29686_10002808 | 3300002459 | Bacteria | 3506 |
| 3 | Ga0065712_10076546 | 3300005290 | Bacteria | 3641 |
| 4 | Ga0065715_10010671 | 3300005293 | Bacteria | 2287 |
| 5 | Ga0070676_10021379 | 3300005328 | Bacteria | 3623 |
| 6 | Ga0070683_100000668 | 3300005329 | Bacteria | 24820 |
| 7 | Ga0070683_100132639 | 3300005329 | Bacteria | 2358 |
| 8 | Ga0070690_100065401 | 3300005330 | Bacteria | 2351 |
| 9 | Ga0070670_100007431 | 3300005331 | Bacteria | 9305 |
| 10 | Ga0068869_100043812 | 3300005334 | Unclassified | 3216 |
| 11 | Ga0070666_10040296 | 3300005335 | Bacteria | 3117 |
| 12 | Ga0070680_100028982 | 3300005336 | Bacteria | 4444 |
| 13 | Ga0070680_100059713 | 3300005336 | Bacteria | 3121 |
| 14 | Ga0070682_100049426 | 3300005337 | Bacteria | 2622 |
| 15 | Ga0068868_100079752 | 3300005338 | Bacteria | 2623 |
| 16 | Ga0070660_100015293 | 3300005339 | Bacteria | 5537 |
| 17 | Ga0070660_100047400 | 3300005339 | Bacteria | 3298 |
| 18 | Ga0070660_100079121 | 3300005339 | Bacteria | 2579 |
| 19 | Ga0070689_100097290 | 3300005340 | Bacteria | 2327 |
| 20 | Ga0070691_10002000 | 3300005341 | Bacteria | 8990 |
| 21 | Ga0070661_100026511 | 3300005344 | Bacteria | 4168 |
| 22 | Ga0070692_10050435 | 3300005345 | Bacteria | 2161 |
| 23 | Ga0070671_100182215 | 3300005355 | Bacteria | 1778 |
| 24 | Ga0070673_100016978 | 3300005364 | Bacteria | 5164 |
| 25 | Ga0070709_10052878 | 3300005434 | Unclassified | 2555 |
| 26 | Ga0070714_100103423 | 3300005435 | Bacteria | 2512 |
| 27 | Ga0070713_100028744 | 3300005436 | Bacteria | 4393 |
| 28 | Ga0070713_100046681 | 3300005436 | Bacteria | 3555 |
| 29 | Ga0070708_100088318 | 3300005445 | Unclassified | 2819 |
| 30 | Ga0070681_10001877 | 3300005458 | Bacteria | 18970 |
| 31 | Ga0070681_10010272 | 3300005458 | Bacteria | 9239 |
| 32 | Ga0070681_10059645 | 3300005458 | Bacteria | 3795 |
| 33 | Ga0070681_10090404 | 3300005458 | Unclassified | 3012 |
| 34 | Ga0068867_100107658 | 3300005459 | Bacteria | 2137 |
| 35 | Ga0070706_100188291 | 3300005467 | Bacteria | 1929 |
| 36 | Ga0070698_100007777 | 3300005471 | Bacteria | 11602 |
| 37 | Ga0070699_100184494 | 3300005518 | Unclassified | 1852 |
| 38 | Ga0070679_100006935 | 3300005530 | Bacteria | 10568 |
| 39 | Ga0070679_100015277 | 3300005530 | Bacteria | 7377 |
| 40 | Ga0070684_100000386 | 3300005535 | Bacteria | 30619 |
| 41 | Ga0070684_100031792 | 3300005535 | Unclassified | 4495 |
| 42 | Ga0070684_100043688 | 3300005535 | Unclassified | 3872 |
| 43 | Ga0070684_100222112 | 3300005535 | Bacteria | 1723 |
| 44 | Ga0070697_100160799 | 3300005536 | Bacteria | 1897 |
| 45 | Ga0068853_100200490 | 3300005539 | Bacteria | 1816 |
| 46 | Ga0070665_100018594 | 3300005548 | Bacteria | 6964 |
| 47 | Ga0070704_100095437 | 3300005549 | Bacteria | 2227 |
| 48 | Ga0068855_100006699 | 3300005563 | Bacteria | 13980 |
| 49 | Ga0068855_100007262 | 3300005563 | Bacteria | 13434 |
| 50 | Ga0068855_100012755 | 3300005563 | Bacteria | 10134 |
| 51 | Ga0068855_100067402 | 3300005563 | Bacteria | 4170 |
| 52 | Ga0068855_100227196 | 3300005563 | Bacteria | 2091 |
| 53 | Ga0068855_100268892 | 3300005563 | Unclassified | 1896 |
| 54 | Ga0068857_100001338 | 3300005577 | Bacteria | 19407 |
| 55 | Ga0068857_100057389 | 3300005577 | Bacteria | 3455 |
| 56 | Ga0068857_100075168 | 3300005577 | Bacteria | 3012 |
| 57 | Ga0068854_100062172 | 3300005578 | Bacteria | 2706 |
| 58 | Ga0068856_100001575 | 3300005614 | Bacteria | 23874 |
| 59 | Ga0068856_100033052 | 3300005614 | Bacteria | 5065 |
| 60 | Ga0068856_100079280 | 3300005614 | Bacteria | 3256 |
| 61 | Ga0068856_100117350 | 3300005614 | Unclassified | 2662 |
| 62 | Ga0068856_100191099 | 3300005614 | Bacteria | 2061 |
| 63 | Ga0068856_100246430 | 3300005614 | Bacteria | 1802 |
| 64 | Ga0068852_100003894 | 3300005616 | Bacteria | 10488 |
| 65 | Ga0068852_100053427 | 3300005616 | Bacteria | 3477 |
| 66 | Ga0068859_100010046 | 3300005617 | Bacteria | 9547 |
| 67 | Ga0068859_100035411 | 3300005617 | Bacteria | 5009 |
| 68 | Ga0068864_100028992 | 3300005618 | Unclassified | 4682 |
| 69 | Ga0068851_10097946 | 3300005834 | Unclassified | 1552 |
| 70 | Ga0068858_100070452 | 3300005842 | Unclassified | 3241 |
| 71 | Ga0068858_100119511 | 3300005842 | Bacteria | 2464 |
| 72 | Ga0068860_100200660 | 3300005843 | Unclassified | 1933 |
| 73 | Ga0070717_10020841 | 3300006028 | Bacteria | 5160 |
| 74 | Ga0070712_100076499 | 3300006175 | Bacteria | 2410 |
| 75 | Ga0097621_100013642 | 3300006237 | Bacteria | 6065 |
| 76 | Ga0097621_100060637 | 3300006237 | Bacteria | 3101 |
| 77 | Ga0097621_100282854 | 3300006237 | Bacteria | 1460 |
| 78 | Ga0068871_100007567 | 3300006358 | Bacteria | 7771 |
| 79 | Ga0068871_100044267 | 3300006358 | Unclassified | 3579 |
| 80 | Ga0068871_100070732 | 3300006358 | Bacteria | 2868 |
| 81 | Ga0068871_100282063 | 3300006358 | Bacteria | 1453 |
| 82 | Ga0075430_100104142 | 3300006846 | Bacteria | 2369 |
| 83 | Ga0075431_100044966 | 3300006847 | Bacteria | 4552 |
| 84 | Ga0075433_10089819 | 3300006852 | Unclassified | 2715 |
| 85 | Ga0075433_10215500 | 3300006852 | Unclassified | 1706 |
| 86 | Ga0075434_100130398 | 3300006871 | Unclassified | 2533 |
| 87 | Ga0068865_100009187 | 3300006881 | Bacteria | 6119 |
| 88 | Ga0068865_100037720 | 3300006881 | Unclassified | 3265 |
| 89 | Ga0097620_100010046 | 3300006931 | Bacteria | 9547 |
| 90 | Ga0097620_100035411 | 3300006931 | Bacteria | 5009 |
| 91 | Ga0105240_10000429 | 3300009093 | Bacteria | 77882 |
| 92 | Ga0105240_10000476 | 3300009093 | Bacteria | 74156 |
| 93 | Ga0105240_10005652 | 3300009093 | Bacteria | 18562 |
| 94 | Ga0105240_10006790 | 3300009093 | Bacteria | 16739 |
| 95 | Ga0105240_10114711 | 3300009093 | Unclassified | 3254 |
| 96 | Ga0105240_10126558 | 3300009093 | Bacteria | 3070 |
| 97 | Ga0105240_10132506 | 3300009093 | Bacteria | 2988 |
| 98 | Ga0111539_10033382 | 3300009094 | Bacteria | 6247 |
| 99 | Ga0105245_10000396 | 3300009098 | Bacteria | 40404 |
| 100 | Ga0105245_10082224 | 3300009098 | Unclassified | 2946 |
| 101 | Ga0105245_10167526 | 3300009098 | Unclassified | 2090 |
| 102 | Ga0105245_10199929 | 3300009098 | Bacteria | 1919 |
| 103 | Ga0105247_10097355 | 3300009101 | Unclassified | 1877 |
| 104 | Ga0114129_10025395 | 3300009147 | Bacteria | 8395 |
| 105 | Ga0114129_10439486 | 3300009147 | Bacteria | 1713 |
| 106 | Ga0105243_10008715 | 3300009148 | Bacteria | 7777 |
| 107 | Ga0105241_10002480 | 3300009174 | Bacteria | 13867 |
| 108 | Ga0105241_10012535 | 3300009174 | Bacteria | 6217 |
| 109 | Ga0105241_10026845 | 3300009174 | Bacteria | 4286 |
| 110 | Ga0105241_10046408 | 3300009174 | Bacteria | 3299 |
| 111 | Ga0105241_10046960 | 3300009174 | Unclassified | 3281 |
| 112 | Ga0105241_10104309 | 3300009174 | Bacteria | 2259 |
| 113 | Ga0105241_10154050 | 3300009174 | Bacteria | 1883 |
| 114 | Ga0105242_10005848 | 3300009176 | Bacteria | 9477 |
| 115 | Ga0105242_10014751 | 3300009176 | Bacteria | 6052 |
| 116 | Ga0105242_10016853 | 3300009176 | Bacteria | 5688 |
| 117 | Ga0105248_10029459 | 3300009177 | Bacteria | 6123 |
| 118 | Ga0105248_10144722 | 3300009177 | Bacteria | 2682 |
| 119 | Ga0105248_10432216 | 3300009177 | Unclassified | 1483 |
| 120 | Ga0105237_10002956 | 3300009545 | Bacteria | 20568 |
| 121 | Ga0105237_10006497 | 3300009545 | Bacteria | 12956 |
| 122 | Ga0105237_10008102 | 3300009545 | Bacteria | 11416 |
| 123 | Ga0105237_10058142 | 3300009545 | Bacteria | 3870 |
| 124 | Ga0105237_10069085 | 3300009545 | Unclassified | 3527 |
| 125 | Ga0105237_10116022 | 3300009545 | Bacteria | 2671 |
| 126 | Ga0105237_10329922 | 3300009545 | Bacteria | 1530 |
| 127 | Ga0105238_10000444 | 3300009551 | Bacteria | 43442 |
| 128 | Ga0105238_10001327 | 3300009551 | Bacteria | 24815 |
| 129 | Ga0105238_10004104 | 3300009551 | Bacteria | 14450 |
| 130 | Ga0105238_10028318 | 3300009551 | Bacteria | 5709 |
| 131 | Ga0105238_10029192 | 3300009551 | Bacteria | 5620 |
| 132 | Ga0105238_10031337 | 3300009551 | Bacteria | 5412 |
| 133 | Ga0105249_10213454 | 3300009553 | Unclassified | 1895 |
| 134 | Ga0105239_10001243 | 3300010375 | Bacteria | 34669 |
| 135 | Ga0105239_10004799 | 3300010375 | Bacteria | 16045 |
| 136 | Ga0105239_10006349 | 3300010375 | Bacteria | 13743 |
| 137 | Ga0105239_10015800 | 3300010375 | Bacteria | 8355 |
| 138 | Ga0105239_10054957 | 3300010375 | Bacteria | 4367 |
| 139 | Ga0105246_10027790 | 3300011119 | Bacteria | 3711 |
| 140 | Ga0105246_10029133 | 3300011119 | Bacteria | 3633 |
| 141 | Ga0105246_10264573 | 3300011119 | Unclassified | 1372 |
| 142 | Ga0157373_10223584 | 3300013100 | Unclassified | 1328 |
| 143 | Ga0157370_10007329 | 3300013104 | Bacteria | 12040 |
| 144 | Ga0157370_10008486 | 3300013104 | Bacteria | 11083 |
| 145 | Ga0157370_10050928 | 3300013104 | Bacteria | 3956 |
| 146 | Ga0157369_10000695 | 3300013105 | Bacteria | 43410 |
| 147 | Ga0157369_10011842 | 3300013105 | Bacteria | 9909 |
| 148 | Ga0157369_10092862 | 3300013105 | Bacteria | 3222 |
| 149 | Ga0157369_10107604 | 3300013105 | Bacteria | 2966 |
| 150 | Ga0157374_10013025 | 3300013296 | Bacteria | 7252 |
| 151 | Ga0157374_10065024 | 3300013296 | Bacteria | 3424 |
| 152 | Ga0157374_10112156 | 3300013296 | Bacteria | 2624 |
| 153 | Ga0157374_10116315 | 3300013296 | Unclassified | 2576 |
| 154 | Ga0157378_10001760 | 3300013297 | Bacteria | 19438 |
| 155 | Ga0157372_10009180 | 3300013307 | Bacteria | 10511 |
| 156 | Ga0157372_10036130 | 3300013307 | Bacteria | 5445 |
| 157 | Ga0157372_10038963 | 3300013307 | Bacteria | 5246 |
| 158 | Ga0157375_10005389 | 3300013308 | Bacteria | 11118 |
| 159 | Ga0157375_10384153 | 3300013308 | Unclassified | 1571 |
| 160 | Ga0163163_10012194 | 3300014325 | Bacteria | 7823 |
| 161 | Ga0163163_10046201 | 3300014325 | Bacteria | 4277 |
| 162 | Ga0163163_10088321 | 3300014325 | Bacteria | 3111 |
| 163 | Ga0157379_10054910 | 3300014968 | Unclassified | 3559 |
| 164 | Ga0224712_10021084 | 3300022467 | Unclassified | 2224 |
| 165 | Ga0228598_1000060 | 3300024227 | Bacteria | 15974 |
| 166 | Ga0207692_10032655 | 3300025898 | Bacteria | 2503 |
| 167 | Ga0207654_10004899 | 3300025911 | Bacteria | 6775 |
| 168 | Ga0207654_10016510 | 3300025911 | Bacteria | 3846 |
| 169 | Ga0207654_10047818 | 3300025911 | Bacteria | 2445 |
| 170 | Ga0207654_10088294 | 3300025911 | Bacteria | 1884 |
| 171 | Ga0207707_10003820 | 3300025912 | Bacteria | 13341 |
| 172 | Ga0207707_10011569 | 3300025912 | Bacteria | 7683 |
| 173 | Ga0207707_10019217 | 3300025912 | Bacteria | 5963 |
| 174 | Ga0207707_10042420 | 3300025912 | Bacteria | 3970 |
| 175 | Ga0207695_10001123 | 3300025913 | Bacteria | 46509 |
| 176 | Ga0207695_10009817 | 3300025913 | Bacteria | 11763 |
| 177 | Ga0207695_10017849 | 3300025913 | Bacteria | 8226 |
| 178 | Ga0207695_10031712 | 3300025913 | Bacteria | 5791 |
| 179 | Ga0207695_10082555 | 3300025913 | Unclassified | 3248 |
| 180 | Ga0207695_10130554 | 3300025913 | Bacteria | 2471 |
| 181 | Ga0207695_10167751 | 3300025913 | Unclassified | 2123 |
| 182 | Ga0207671_10006089 | 3300025914 | Bacteria | 10861 |
| 183 | Ga0207671_10011092 | 3300025914 | Bacteria | 7371 |
| 184 | Ga0207671_10011436 | 3300025914 | Bacteria | 7227 |
| 185 | Ga0207693_10005034 | 3300025915 | Bacteria | 11094 |
| 186 | Ga0207663_10091193 | 3300025916 | Bacteria | 2023 |
| 187 | Ga0207663_10164621 | 3300025916 | Bacteria | 1569 |
| 188 | Ga0207660_10081047 | 3300025917 | Bacteria | 2384 |
| 189 | Ga0207660_10164813 | 3300025917 | Unclassified | 1712 |
| 190 | Ga0207657_10014858 | 3300025919 | Bacteria | 7577 |
| 191 | Ga0207657_10024702 | 3300025919 | Bacteria | 5556 |
| 192 | Ga0207657_10056105 | 3300025919 | Bacteria | 3400 |
| 193 | Ga0207652_10012831 | 3300025921 | Bacteria | 6775 |
| 194 | Ga0207652_10014997 | 3300025921 | Bacteria | 6287 |
| 195 | Ga0207694_10000170 | 3300025924 | Bacteria | 67254 |
| 196 | Ga0207694_10010269 | 3300025924 | Bacteria | 7058 |
| 197 | Ga0207694_10026394 | 3300025924 | Bacteria | 4418 |
| 198 | Ga0207694_10027878 | 3300025924 | Unclassified | 4304 |
| 199 | Ga0207694_10186664 | 3300025924 | Bacteria | 1683 |
| 200 | Ga0207650_10015936 | 3300025925 | Bacteria | 5245 |
| 201 | Ga0207687_10000292 | 3300025927 | Bacteria | 34405 |
| 202 | Ga0207687_10000500 | 3300025927 | Bacteria | 26443 |
| 203 | Ga0207687_10060531 | 3300025927 | Bacteria | 2671 |
| 204 | Ga0207687_10113408 | 3300025927 | Bacteria | 2016 |
| 205 | Ga0207700_10009685 | 3300025928 | Bacteria | 6034 |
| 206 | Ga0207700_10036863 | 3300025928 | Bacteria | 3536 |
| 207 | Ga0207700_10066330 | 3300025928 | Unclassified | 2759 |
| 208 | Ga0207664_10024313 | 3300025929 | Bacteria | 4552 |
| 209 | Ga0207690_10034745 | 3300025932 | Bacteria | 3250 |
| 210 | Ga0207706_10012116 | 3300025933 | Bacteria | 7853 |
| 211 | Ga0207686_10089117 | 3300025934 | Bacteria | 2033 |
| 212 | Ga0207686_10139261 | 3300025934 | Bacteria | 1675 |
| 213 | Ga0207709_10147543 | 3300025935 | Unclassified | 1625 |
| 214 | Ga0207704_10041933 | 3300025938 | Unclassified | 2689 |
| 215 | Ga0207704_10103875 | 3300025938 | Bacteria | 1902 |
| 216 | Ga0207711_10301506 | 3300025941 | Unclassified | 1478 |
| 217 | Ga0207689_10010186 | 3300025942 | Bacteria | 8100 |
| 218 | Ga0207689_10115234 | 3300025942 | Bacteria | 2209 |
| 219 | Ga0207661_10006618 | 3300025944 | Bacteria | 8187 |
| 220 | Ga0207661_10019708 | 3300025944 | Bacteria | 5034 |
| 221 | Ga0207679_10029259 | 3300025945 | Bacteria | 3834 |
| 222 | Ga0207667_10000369 | 3300025949 | Bacteria | 60858 |
| 223 | Ga0207667_10000650 | 3300025949 | Bacteria | 45011 |
| 224 | Ga0207667_10010997 | 3300025949 | Bacteria | 10545 |
| 225 | Ga0207667_10185542 | 3300025949 | Unclassified | 2135 |
| 226 | Ga0207667_10221246 | 3300025949 | Unclassified | 1940 |
| 227 | Ga0207651_10026969 | 3300025960 | Bacteria | 3600 |
| 228 | Ga0207712_10005922 | 3300025961 | Bacteria | 7708 |
| 229 | Ga0207658_10034575 | 3300025986 | Bacteria | 3613 |
| 230 | Ga0207677_10030140 | 3300026023 | Unclassified | 3458 |
| 231 | Ga0207639_10042488 | 3300026041 | Unclassified | 3407 |
| 232 | Ga0207702_10053810 | 3300026078 | Unclassified | 3409 |
| 233 | Ga0207702_10149097 | 3300026078 | Bacteria | 2126 |
| 234 | Ga0207648_10010508 | 3300026089 | Bacteria | 8767 |
| 235 | Ga0207648_10071049 | 3300026089 | Bacteria | 3034 |
| 236 | Ga0207648_10130785 | 3300026089 | Bacteria | 2209 |
| 237 | Ga0207648_10182459 | 3300026089 | Unclassified | 1858 |
| 238 | Ga0207676_10010046 | 3300026095 | Bacteria | 6734 |
| 239 | Ga0207674_10000484 | 3300026116 | Bacteria | 52530 |
| 240 | Ga0207674_10017242 | 3300026116 | Bacteria | 7878 |
| 241 | Ga0207674_10029935 | 3300026116 | Bacteria | 5728 |
| 242 | Ga0207698_10016099 | 3300026142 | Bacteria | 5031 |
| 243 | Ga0207428_10047275 | 3300027907 | Bacteria | 3455 |
| 244 | Ga0268266_10010860 | 3300028379 | Bacteria | 7932 |
| 245 | Ga0265338_10001894 | 3300028800 | Bacteria | 32749 |
| 246 | Ga0265338_10028714 | 3300028800 | Bacteria | 5540 |
| 247 | Ga0265770_1003769 | 3300030878 | Bacteria | 2061 |
| 248 | Ga0265760_10001673 | 3300031090 | Bacteria | 6511 |
| 249 | Ga0265325_10039004 | 3300031241 | Bacteria | 2504 |
| 250 | Ga0265313_10007385 | 3300031595 | Bacteria | 7527 |
| 251 | Ga0265314_10003911 | 3300031711 | Bacteria | 14153 |
| 252 | Ga0265314_10012023 | 3300031711 | Bacteria | 7096 |
| 253 | Ga0373934_0001839 | 3300035086 | Bacteria | 7803 |
| 254 | Ga0373934_0020891 | 3300035086 | Unclassified | 2519 |
| 255 | Ga0373953_0002652 | 3300035117 | Bacteria | 5423 |
| 256 | Ga0373954_0001075 | 3300035118 | Bacteria | 10911 |
| 257 | Ga0373954_0011397 | 3300035118 | Bacteria | 3940 |
| 258 | Ga0373946_0017914 | 3300035171 | Unclassified | 2713 |
| 259 | Ga0373927_0004508 | 3300035695 | Bacteria | 9741 |
| 260 | Ga0373927_0056518 | 3300035695 | Bacteria | 2537 |
| 261 | Ga0373927_0230100 | 3300035695 | Unclassified | 1218 |
| 262 | Ga0373933_0004323 | 3300035724 | Bacteria | 7799 |
| 263 | Ga0373933_0047862 | 3300035724 | Bacteria | 2544 |
| 264 | Ga0373933_0052047 | 3300035724 | Unclassified | 2449 |
| 265 | Ga0373947_0000290 | 3300035725 | Bacteria | 28281 |
| 266 | Ga0373937_0006278 | 3300036401 | Bacteria | 10249 |
| 267 | Ga0373937_0015160 | 3300036401 | Bacteria | 6810 |
| 268 | Ga0373937_0025989 | 3300036401 | Bacteria | 5289 |
| 269 | Ga0373937_0035885 | 3300036401 | Bacteria | 4516 |
| 270 | Ga0373937_0075022 | 3300036401 | Unclassified | 3122 |
| 271 | Ga0373937_0078293 | 3300036401 | Bacteria | 3055 |
| 272 | Ga0373937_0101867 | 3300036401 | Unclassified | 2665 |
| 273 | Ga0373925_0000289 | 3300037068 | Bacteria | 52497 |
| 274 | Ga0373925_0010571 | 3300037068 | Bacteria | 6693 |
| 275 | Ga0373925_0014683 | 3300037068 | Bacteria | 5658 |
| 276 | Ga0436364_1370809 | 3300037853 | Bacteria | 5342 |
| 277 | Ga0436365_0783990 | 3300039437 | Bacteria | 2268 |
| 278 | Ga0495592_0085164 | 3300046454 | Unclassified | 2279 |
| 279 | Ga0495651_0093787 | 3300046462 | Unclassified | 2247 |
| 280 | Ga0495653_0070237 | 3300046463 | Bacteria | 2622 |
| 281 | Ga0495580_0002288 | 3300046472 | Bacteria | 16711 |
| 282 | Ga0495582_0008917 | 3300046473 | Bacteria | 5535 |
| 283 | Ga0495639_0023807 | 3300046475 | Bacteria | 2693 |
| 284 | Ga0495594_0022843 | 3300046499 | Bacteria | 3349 |
| 285 | Ga0495665_0155398 | 3300046531 | Unclassified | 1193 |
| 286 | Ga0495586_0068348 | 3300046535 | Bacteria | 1938 |
| 287 | Ga0495587_0002147 | 3300046536 | Bacteria | 13187 |
| 288 | Ga0495645_0123247 | 3300046543 | Unclassified | 1823 |
| 289 | Ga0495634_0041408 | 3300046642 | Bacteria | 3128 |
| 290 | Ga0495613_0024577 | 3300046689 | Unclassified | 4489 |
| 291 | Ga0495613_0172370 | 3300046689 | Unclassified | 1535 |
| 292 | Ga0495674_0036345 | 3300047319 | Bacteria | 4434 |
| 293 | Ga0495684_0014429 | 3300047471 | Bacteria | 6079 |
| 294 | Ga0495684_0117063 | 3300047471 | Unclassified | 2009 |
| 295 | Ga0495602_0100728 | 3300048088 | Unclassified | 2371 |
| 296 | Ga0496109_0173279 | 3300048912 | Unclassified | 2025 |
| 297 | Ga0496112_0072808 | 3300048915 | Bacteria | 3397 |
| 298 | nmdc:mga05p37_218992_c1 | 3300050507 | Bacteria | 2298 |
| 299 | nmdc:mga0qj67_224127_c1 | 3300050509 | Bacteria | 1526 |
| 300 | nmdc:mga06r32_22490_c1 | 3300050510 | Bacteria | 5829 |
| 301 | nmdc:mga08y16_19213_c1 | 3300050511 | Bacteria | 7200 |
| 302 | nmdc:mga0n895_102901_c1 | 3300050512 | Unclassified | 2867 |
| 303 | nmdc:mga0a205_230774_c1 | 3300050515 | Bacteria | 1734 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0230100 | Ga0373927_0230100_124_1200 | 320 |
| 2 | 3300009174 | Ga0105241_10154050 | Ga0105241_101540502 | 330 |
| 3 | 3300006852 | Ga0075433_10215500 | Ga0075433_102155001 | 340 |
| 4 | 3300035171 | Ga0373946_0017914 | Ga0373946_0017914_1126_2391 | 340 |
| 5 | 3300035695 | Ga0373927_0056518 | Ga0373927_0056518_93_1358 | 340 |
| 6 | 3300035725 | Ga0373947_0000290 | Ga0373947_0000290_6705_7970 | 340 |
| 7 | 3300037068 | Ga0373925_0000289 | Ga0373925_0000289_39786_41051 | 340 |
| 8 | 3300005334 | Ga0068869_100043812 | Ga0068869_1000438122 | 342 |
| 9 | 3300005614 | Ga0068856_100117350 | Ga0068856_1001173502 | 342 |
| 10 | 3300009098 | Ga0105245_10082224 | Ga0105245_100822243 | 342 |
| 11 | 3300009101 | Ga0105247_10097355 | Ga0105247_100973552 | 342 |
| 12 | 3300009553 | Ga0105249_10213454 | Ga0105249_102134543 | 342 |
| 13 | 3300014325 | Ga0163163_10046201 | Ga0163163_100462015 | 342 |
| 14 | 3300025924 | Ga0207694_10027878 | Ga0207694_100278785 | 342 |
| 15 | 3300025927 | Ga0207687_10113408 | Ga0207687_101134082 | 342 |
| 16 | 3300025935 | Ga0207709_10147543 | Ga0207709_101475432 | 342 |
| 17 | 3300025942 | Ga0207689_10115234 | Ga0207689_101152343 | 342 |
| 18 | 3300026078 | Ga0207702_10053810 | Ga0207702_100538103 | 342 |
| 19 | 3300005445 | Ga0070708_100088318 | Ga0070708_1000883182 | 344 |
| 20 | 3300025898 | Ga0207692_10032655 | Ga0207692_100326553 | 347 |
| 21 | 3300006175 | Ga0070712_100076499 | Ga0070712_1000764992 | 354 |
| 22 | 3300025915 | Ga0207693_10005034 | Ga0207693_100050345 | 354 |
| 23 | 3300031241 | Ga0265325_10039004 | Ga0265325_100390042 | 355 |
| 24 | 3300025924 | Ga0207694_10186664 | Ga0207694_101866642 | 356 |
| 25 | 3300005535 | Ga0070684_100043688 | Ga0070684_1000436884 | 358 |
| 26 | 3300009545 | Ga0105237_10002956 | Ga0105237_100029567 | 358 |
| 27 | 3300010375 | Ga0105239_10006349 | Ga0105239_100063497 | 358 |
| 28 | 3300013105 | Ga0157369_10011842 | Ga0157369_100118426 | 358 |
| 29 | 3300013296 | Ga0157374_10013025 | Ga0157374_100130257 | 358 |
| 30 | 3300013307 | Ga0157372_10036130 | Ga0157372_100361302 | 358 |
| 31 | 3300025914 | Ga0207671_10011436 | Ga0207671_100114364 | 358 |
| 32 | 3300037853 | Ga0436364_1370809 | Ga0436364_1370809_1399_2736 | 358 |
| 33 | 3300039437 | Ga0436365_0783990 | Ga0436365_0783990_132_1391 | 358 |
| 34 | 3300047471 | Ga0495684_0117063 | Ga0495684_0117063_801_1994 | 358 |
| 35 | 3300009177 | Ga0105248_10432216 | Ga0105248_104322161 | 360 |
| 36 | 3300025941 | Ga0207711_10301506 | Ga0207711_103015061 | 360 |
| 37 | 3300005435 | Ga0070714_100103423 | Ga0070714_1001034233 | 361 |
| 38 | 3300010375 | Ga0105239_10054957 | Ga0105239_100549574 | 361 |
| 39 | 3300025916 | Ga0207663_10091193 | Ga0207663_100911933 | 361 |
| 40 | 3300025929 | Ga0207664_10024313 | Ga0207664_100243133 | 361 |
| 41 | 3300025925 | Ga0207650_10015936 | Ga0207650_100159362 | 364 |
| 42 | 3300005563 | Ga0068855_100007262 | Ga0068855_1000072622 | 366 |
| 43 | 3300006852 | Ga0075433_10089819 | Ga0075433_100898193 | 366 |
| 44 | 3300006871 | Ga0075434_100130398 | Ga0075434_1001303982 | 366 |
| 45 | 3300009093 | Ga0105240_10000476 | Ga0105240_1000047660 | 366 |
| 46 | 3300009147 | Ga0114129_10025395 | Ga0114129_100253952 | 366 |
| 47 | 3300013104 | Ga0157370_10007329 | Ga0157370_100073297 | 366 |
| 48 | 3300025913 | Ga0207695_10167751 | Ga0207695_101677512 | 366 |
| 49 | 3300025949 | Ga0207667_10185542 | Ga0207667_101855421 | 366 |
| 50 | 3300050507 | nmdc:mga05p37_218992_c1 | nmdc:mga05p37_218992_c1_1083_2252 | 366 |
| 51 | 3300050512 | nmdc:mga0n895_102901_c1 | nmdc:mga0n895_102901_c1_1292_2461 | 366 |
| 52 | 3300050515 | nmdc:mga0a205_230774_c1 | nmdc:mga0a205_230774_c1_479_1636 | 366 |
| 53 | 3300035086 | Ga0373934_0001839 | Ga0373934_0001839_5356_6645 | 367 |
| 54 | 3300036401 | Ga0373937_0075022 | Ga0373937_0075022_320_1609 | 367 |
| 55 | 3300005328 | Ga0070676_10021379 | Ga0070676_100213792 | 368 |
| 56 | 3300005330 | Ga0070690_100065401 | Ga0070690_1000654014 | 368 |
| 57 | 3300005335 | Ga0070666_10040296 | Ga0070666_100402966 | 368 |
| 58 | 3300005336 | Ga0070680_100059713 | Ga0070680_1000597132 | 368 |
| 59 | 3300005337 | Ga0070682_100049426 | Ga0070682_1000494262 | 368 |
| 60 | 3300005339 | Ga0070660_100047400 | Ga0070660_1000474003 | 368 |
| 61 | 3300005339 | Ga0070660_100079121 | Ga0070660_1000791213 | 368 |
| 62 | 3300005345 | Ga0070692_10050435 | Ga0070692_100504353 | 368 |
| 63 | 3300005355 | Ga0070671_100182215 | Ga0070671_1001822151 | 368 |
| 64 | 3300005364 | Ga0070673_100016978 | Ga0070673_1000169786 | 368 |
| 65 | 3300005434 | Ga0070709_10052878 | Ga0070709_100528782 | 368 |
| 66 | 3300005436 | Ga0070713_100028744 | Ga0070713_1000287442 | 368 |
| 67 | 3300005458 | Ga0070681_10001877 | Ga0070681_100018774 | 368 |
| 68 | 3300005530 | Ga0070679_100006935 | Ga0070679_1000069352 | 368 |
| 69 | 3300005563 | Ga0068855_100006699 | Ga0068855_1000066998 | 368 |
| 70 | 3300005563 | Ga0068855_100268892 | Ga0068855_1002688921 | 368 |
| 71 | 3300005614 | Ga0068856_100191099 | Ga0068856_1001910993 | 368 |
| 72 | 3300005616 | Ga0068852_100053427 | Ga0068852_1000534274 | 368 |
| 73 | 3300005842 | Ga0068858_100119511 | Ga0068858_1001195112 | 368 |
| 74 | 3300005843 | Ga0068860_100200660 | Ga0068860_1002006601 | 368 |
| 75 | 3300006237 | Ga0097621_100060637 | Ga0097621_1000606373 | 368 |
| 76 | 3300006358 | Ga0068871_100044267 | Ga0068871_1000442673 | 368 |
| 77 | 3300006358 | Ga0068871_100282063 | Ga0068871_1002820631 | 368 |
| 78 | 3300006881 | Ga0068865_100037720 | Ga0068865_1000377205 | 368 |
| 79 | 3300009093 | Ga0105240_10114711 | Ga0105240_101147113 | 368 |
| 80 | 3300009098 | Ga0105245_10000396 | Ga0105245_1000039618 | 368 |
| 81 | 3300009174 | Ga0105241_10012535 | Ga0105241_100125353 | 368 |
| 82 | 3300009174 | Ga0105241_10046408 | Ga0105241_100464084 | 368 |
| 83 | 3300009174 | Ga0105241_10046960 | Ga0105241_100469603 | 368 |
| 84 | 3300009176 | Ga0105242_10014751 | Ga0105242_100147515 | 368 |
| 85 | 3300009177 | Ga0105248_10029459 | Ga0105248_100294595 | 368 |
| 86 | 3300009551 | Ga0105238_10028318 | Ga0105238_100283183 | 368 |
| 87 | 3300010375 | Ga0105239_10015800 | Ga0105239_100158004 | 368 |
| 88 | 3300013100 | Ga0157373_10223584 | Ga0157373_102235841 | 368 |
| 89 | 3300013297 | Ga0157378_10001760 | Ga0157378_1000176012 | 368 |
| 90 | 3300013307 | Ga0157372_10009180 | Ga0157372_100091806 | 368 |
| 91 | 3300014325 | Ga0163163_10088321 | Ga0163163_100883214 | 368 |
| 92 | 3300025911 | Ga0207654_10016510 | Ga0207654_100165102 | 368 |
| 93 | 3300025911 | Ga0207654_10088294 | Ga0207654_100882941 | 368 |
| 94 | 3300025912 | Ga0207707_10019217 | Ga0207707_100192174 | 368 |
| 95 | 3300025913 | Ga0207695_10082555 | Ga0207695_100825553 | 368 |
| 96 | 3300025917 | Ga0207660_10081047 | Ga0207660_100810472 | 368 |
| 97 | 3300025919 | Ga0207657_10056105 | Ga0207657_100561053 | 368 |
| 98 | 3300025921 | Ga0207652_10014997 | Ga0207652_100149971 | 368 |
| 99 | 3300025924 | Ga0207694_10010269 | Ga0207694_100102696 | 368 |
| 100 | 3300025927 | Ga0207687_10000292 | Ga0207687_100002922 | 368 |
| 101 | 3300025928 | Ga0207700_10066330 | Ga0207700_100663303 | 368 |
| 102 | 3300025933 | Ga0207706_10012116 | Ga0207706_100121165 | 368 |
| 103 | 3300025934 | Ga0207686_10089117 | Ga0207686_100891173 | 368 |
| 104 | 3300025938 | Ga0207704_10041933 | Ga0207704_100419332 | 368 |
| 105 | 3300025942 | Ga0207689_10010186 | Ga0207689_100101863 | 368 |
| 106 | 3300025945 | Ga0207679_10029259 | Ga0207679_100292594 | 368 |
| 107 | 3300025949 | Ga0207667_10010997 | Ga0207667_100109976 | 368 |
| 108 | 3300025949 | Ga0207667_10221246 | Ga0207667_102212461 | 368 |
| 109 | 3300025960 | Ga0207651_10026969 | Ga0207651_100269693 | 368 |
| 110 | 3300026078 | Ga0207702_10149097 | Ga0207702_101490972 | 368 |
| 111 | 3300026089 | Ga0207648_10071049 | Ga0207648_100710494 | 368 |
| 112 | 3300035118 | Ga0373954_0011397 | Ga0373954_0011397_1438_2709 | 368 |
| 113 | 3300035695 | Ga0373927_0004508 | Ga0373927_0004508_7807_9078 | 368 |
| 114 | 3300036401 | Ga0373937_0006278 | Ga0373937_0006278_5494_6765 | 368 |
| 115 | 3300037068 | Ga0373925_0014683 | Ga0373925_0014683_1843_3081 | 368 |
| 116 | 3300046472 | Ga0495580_0002288 | Ga0495580_0002288_4930_6201 | 368 |
| 117 | 3300047319 | Ga0495674_0036345 | Ga0495674_0036345_652_1923 | 368 |
| 118 | 3300048912 | Ga0496109_0173279 | Ga0496109_0173279_23_1252 | 368 |
| 119 | 3300048915 | Ga0496112_0072808 | Ga0496112_0072808_420_1649 | 368 |
| 120 | 3300002459 | JGI24751J29686_10002808 | JGI24751J29686_100028083 | 369 |
| 121 | 3300005331 | Ga0070670_100007431 | Ga0070670_1000074317 | 369 |
| 122 | 3300005467 | Ga0070706_100188291 | Ga0070706_1001882911 | 369 |
| 123 | 3300005471 | Ga0070698_100007777 | Ga0070698_1000077771 | 369 |
| 124 | 3300005549 | Ga0070704_100095437 | Ga0070704_1000954372 | 369 |
| 125 | 3300005577 | Ga0068857_100075168 | Ga0068857_1000751682 | 369 |
| 126 | 3300005617 | Ga0068859_100010046 | Ga0068859_1000100463 | 369 |
| 127 | 3300005618 | Ga0068864_100028992 | Ga0068864_1000289923 | 369 |
| 128 | 3300006931 | Ga0097620_100010046 | Ga0097620_1000100463 | 369 |
| 129 | 3300009094 | Ga0111539_10033382 | Ga0111539_100333823 | 369 |
| 130 | 3300011119 | Ga0105246_10264573 | Ga0105246_102645731 | 369 |
| 131 | 3300014325 | Ga0163163_10012194 | Ga0163163_100121942 | 369 |
| 132 | 3300026095 | Ga0207676_10010046 | Ga0207676_100100464 | 369 |
| 133 | 3300026116 | Ga0207674_10029935 | Ga0207674_100299352 | 369 |
| 134 | 3300027907 | Ga0207428_10047275 | Ga0207428_100472753 | 369 |
| 135 | 3300028800 | Ga0265338_10028714 | Ga0265338_100287142 | 369 |
| 136 | 3300050511 | nmdc:mga08y16_19213_c1 | nmdc:mga08y16_19213_c1_3943_5217 | 369 |
| 137 | 3300005329 | Ga0070683_100000668 | Ga0070683_10000066823 | 370 |
| 138 | 3300005336 | Ga0070680_100028982 | Ga0070680_1000289823 | 370 |
| 139 | 3300005339 | Ga0070660_100015293 | Ga0070660_1000152933 | 370 |
| 140 | 3300005341 | Ga0070691_10002000 | Ga0070691_100020005 | 370 |
| 141 | 3300005458 | Ga0070681_10010272 | Ga0070681_100102729 | 370 |
| 142 | 3300005518 | Ga0070699_100184494 | Ga0070699_1001844941 | 370 |
| 143 | 3300005530 | Ga0070679_100015277 | Ga0070679_1000152773 | 370 |
| 144 | 3300005535 | Ga0070684_100000386 | Ga0070684_1000003869 | 370 |
| 145 | 3300005563 | Ga0068855_100012755 | Ga0068855_1000127555 | 370 |
| 146 | 3300005577 | Ga0068857_100001338 | Ga0068857_1000013381 | 370 |
| 147 | 3300005614 | Ga0068856_100001575 | Ga0068856_10000157517 | 370 |
| 148 | 3300005616 | Ga0068852_100003894 | Ga0068852_1000038944 | 370 |
| 149 | 3300009093 | Ga0105240_10005652 | Ga0105240_1000565216 | 370 |
| 150 | 3300009174 | Ga0105241_10002480 | Ga0105241_100024803 | 370 |
| 151 | 3300009545 | Ga0105237_10006497 | Ga0105237_100064978 | 370 |
| 152 | 3300009551 | Ga0105238_10000444 | Ga0105238_1000044419 | 370 |
| 153 | 3300010375 | Ga0105239_10001243 | Ga0105239_1000124324 | 370 |
| 154 | 3300013104 | Ga0157370_10008486 | Ga0157370_100084862 | 370 |
| 155 | 3300013105 | Ga0157369_10000695 | Ga0157369_1000069531 | 370 |
| 156 | 3300022467 | Ga0224712_10021084 | Ga0224712_100210841 | 370 |
| 157 | 3300024227 | Ga0228598_1000060 | Ga0228598_100006013 | 370 |
| 158 | 3300025911 | Ga0207654_10004899 | Ga0207654_100048997 | 370 |
| 159 | 3300025912 | Ga0207707_10003820 | Ga0207707_1000382015 | 370 |
| 160 | 3300025913 | Ga0207695_10001123 | Ga0207695_1000112326 | 370 |
| 161 | 3300025914 | Ga0207671_10011092 | Ga0207671_100110923 | 370 |
| 162 | 3300025917 | Ga0207660_10164813 | Ga0207660_101648132 | 370 |
| 163 | 3300025919 | Ga0207657_10024702 | Ga0207657_100247023 | 370 |
| 164 | 3300025921 | Ga0207652_10012831 | Ga0207652_100128312 | 370 |
| 165 | 3300025924 | Ga0207694_10000170 | Ga0207694_1000017056 | 370 |
| 166 | 3300025944 | Ga0207661_10006618 | Ga0207661_100066188 | 370 |
| 167 | 3300025949 | Ga0207667_10000369 | Ga0207667_1000036923 | 370 |
| 168 | 3300025949 | Ga0207667_10000650 | Ga0207667_1000065022 | 370 |
| 169 | 3300026116 | Ga0207674_10000484 | Ga0207674_1000048424 | 370 |
| 170 | 3300028800 | Ga0265338_10001894 | Ga0265338_100018943 | 370 |
| 171 | 3300030878 | Ga0265770_1003769 | Ga0265770_10037692 | 370 |
| 172 | 3300031090 | Ga0265760_10001673 | Ga0265760_100016732 | 370 |
| 173 | 3300035117 | Ga0373953_0002652 | Ga0373953_0002652_336_1634 | 370 |
| 174 | 3300046689 | Ga0495613_0172370 | Ga0495613_0172370_287_1498 | 370 |
| 175 | 2162886011 | MRS1b_contig_3469666 | MRS1b_0344.00003230 | 371 |
| 176 | 3300005290 | Ga0065712_10076546 | Ga0065712_100765462 | 371 |
| 177 | 3300005293 | Ga0065715_10010671 | Ga0065715_100106712 | 371 |
| 178 | 3300005329 | Ga0070683_100132639 | Ga0070683_1001326393 | 371 |
| 179 | 3300005338 | Ga0068868_100079752 | Ga0068868_1000797524 | 371 |
| 180 | 3300005340 | Ga0070689_100097290 | Ga0070689_1000972902 | 371 |
| 181 | 3300005344 | Ga0070661_100026511 | Ga0070661_1000265114 | 371 |
| 182 | 3300005436 | Ga0070713_100046681 | Ga0070713_1000466814 | 371 |
| 183 | 3300005458 | Ga0070681_10059645 | Ga0070681_100596452 | 371 |
| 184 | 3300005458 | Ga0070681_10090404 | Ga0070681_100904042 | 371 |
| 185 | 3300005459 | Ga0068867_100107658 | Ga0068867_1001076582 | 371 |
| 186 | 3300005535 | Ga0070684_100031792 | Ga0070684_1000317924 | 371 |
| 187 | 3300005535 | Ga0070684_100222112 | Ga0070684_1002221122 | 371 |
| 188 | 3300005536 | Ga0070697_100160799 | Ga0070697_1001607992 | 371 |
| 189 | 3300005539 | Ga0068853_100200490 | Ga0068853_1002004902 | 371 |
| 190 | 3300005548 | Ga0070665_100018594 | Ga0070665_1000185942 | 371 |
| 191 | 3300005563 | Ga0068855_100067402 | Ga0068855_1000674025 | 371 |
| 192 | 3300005563 | Ga0068855_100227196 | Ga0068855_1002271962 | 371 |
| 193 | 3300005577 | Ga0068857_100057389 | Ga0068857_1000573894 | 371 |
| 194 | 3300005578 | Ga0068854_100062172 | Ga0068854_1000621723 | 371 |
| 195 | 3300005614 | Ga0068856_100033052 | Ga0068856_1000330525 | 371 |
| 196 | 3300005614 | Ga0068856_100079280 | Ga0068856_1000792803 | 371 |
| 197 | 3300005614 | Ga0068856_100246430 | Ga0068856_1002464302 | 371 |
| 198 | 3300005617 | Ga0068859_100035411 | Ga0068859_1000354112 | 371 |
| 199 | 3300005834 | Ga0068851_10097946 | Ga0068851_100979461 | 371 |
| 200 | 3300005842 | Ga0068858_100070452 | Ga0068858_1000704522 | 371 |
| 201 | 3300006028 | Ga0070717_10020841 | Ga0070717_100208413 | 371 |
| 202 | 3300006237 | Ga0097621_100013642 | Ga0097621_1000136424 | 371 |
| 203 | 3300006237 | Ga0097621_100282854 | Ga0097621_1002828542 | 371 |
| 204 | 3300006358 | Ga0068871_100007567 | Ga0068871_1000075672 | 371 |
| 205 | 3300006358 | Ga0068871_100070732 | Ga0068871_1000707323 | 371 |
| 206 | 3300006846 | Ga0075430_100104142 | Ga0075430_1001041422 | 371 |
| 207 | 3300006847 | Ga0075431_100044966 | Ga0075431_1000449663 | 371 |
| 208 | 3300006881 | Ga0068865_100009187 | Ga0068865_1000091874 | 371 |
| 209 | 3300006931 | Ga0097620_100035411 | Ga0097620_1000354112 | 371 |
| 210 | 3300009093 | Ga0105240_10000429 | Ga0105240_1000042942 | 371 |
| 211 | 3300009093 | Ga0105240_10006790 | Ga0105240_100067905 | 371 |
| 212 | 3300009093 | Ga0105240_10126558 | Ga0105240_101265584 | 371 |
| 213 | 3300009093 | Ga0105240_10132506 | Ga0105240_101325063 | 371 |
| 214 | 3300009098 | Ga0105245_10167526 | Ga0105245_101675262 | 371 |
| 215 | 3300009098 | Ga0105245_10199929 | Ga0105245_101999291 | 371 |
| 216 | 3300009147 | Ga0114129_10439486 | Ga0114129_104394862 | 371 |
| 217 | 3300009148 | Ga0105243_10008715 | Ga0105243_100087154 | 371 |
| 218 | 3300009174 | Ga0105241_10026845 | Ga0105241_100268456 | 371 |
| 219 | 3300009174 | Ga0105241_10104309 | Ga0105241_101043092 | 371 |
| 220 | 3300009176 | Ga0105242_10005848 | Ga0105242_100058485 | 371 |
| 221 | 3300009176 | Ga0105242_10016853 | Ga0105242_100168534 | 371 |
| 222 | 3300009177 | Ga0105248_10144722 | Ga0105248_101447222 | 371 |
| 223 | 3300009545 | Ga0105237_10008102 | Ga0105237_100081027 | 371 |
| 224 | 3300009545 | Ga0105237_10058142 | Ga0105237_100581422 | 371 |
| 225 | 3300009545 | Ga0105237_10069085 | Ga0105237_100690852 | 371 |
| 226 | 3300009545 | Ga0105237_10116022 | Ga0105237_101160223 | 371 |
| 227 | 3300009545 | Ga0105237_10329922 | Ga0105237_103299222 | 371 |
| 228 | 3300009551 | Ga0105238_10001327 | Ga0105238_100013277 | 371 |
| 229 | 3300009551 | Ga0105238_10004104 | Ga0105238_100041047 | 371 |
| 230 | 3300009551 | Ga0105238_10029192 | Ga0105238_100291924 | 371 |
| 231 | 3300009551 | Ga0105238_10031337 | Ga0105238_100313375 | 371 |
| 232 | 3300010375 | Ga0105239_10004799 | Ga0105239_100047994 | 371 |
| 233 | 3300011119 | Ga0105246_10027790 | Ga0105246_100277902 | 371 |
| 234 | 3300011119 | Ga0105246_10029133 | Ga0105246_100291335 | 371 |
| 235 | 3300013104 | Ga0157370_10050928 | Ga0157370_100509282 | 371 |
| 236 | 3300013105 | Ga0157369_10092862 | Ga0157369_100928622 | 371 |
| 237 | 3300013105 | Ga0157369_10107604 | Ga0157369_101076044 | 371 |
| 238 | 3300013296 | Ga0157374_10065024 | Ga0157374_100650241 | 371 |
| 239 | 3300013296 | Ga0157374_10112156 | Ga0157374_101121563 | 371 |
| 240 | 3300013296 | Ga0157374_10116315 | Ga0157374_101163152 | 371 |
| 241 | 3300013307 | Ga0157372_10038963 | Ga0157372_100389633 | 371 |
| 242 | 3300013308 | Ga0157375_10005389 | Ga0157375_100053893 | 371 |
| 243 | 3300013308 | Ga0157375_10384153 | Ga0157375_103841531 | 371 |
| 244 | 3300014968 | Ga0157379_10054910 | Ga0157379_100549102 | 371 |
| 245 | 3300025911 | Ga0207654_10047818 | Ga0207654_100478182 | 371 |
| 246 | 3300025912 | Ga0207707_10011569 | Ga0207707_100115694 | 371 |
| 247 | 3300025912 | Ga0207707_10042420 | Ga0207707_100424203 | 371 |
| 248 | 3300025913 | Ga0207695_10009817 | Ga0207695_100098178 | 371 |
| 249 | 3300025913 | Ga0207695_10017849 | Ga0207695_100178496 | 371 |
| 250 | 3300025913 | Ga0207695_10031712 | Ga0207695_100317121 | 371 |
| 251 | 3300025913 | Ga0207695_10130554 | Ga0207695_101305542 | 371 |
| 252 | 3300025914 | Ga0207671_10006089 | Ga0207671_100060899 | 371 |
| 253 | 3300025916 | Ga0207663_10164621 | Ga0207663_101646212 | 371 |
| 254 | 3300025919 | Ga0207657_10014858 | Ga0207657_100148584 | 371 |
| 255 | 3300025924 | Ga0207694_10026394 | Ga0207694_100263942 | 371 |
| 256 | 3300025927 | Ga0207687_10000500 | Ga0207687_1000050020 | 371 |
| 257 | 3300025927 | Ga0207687_10060531 | Ga0207687_100605312 | 371 |
| 258 | 3300025928 | Ga0207700_10009685 | Ga0207700_100096856 | 371 |
| 259 | 3300025928 | Ga0207700_10036863 | Ga0207700_100368634 | 371 |
| 260 | 3300025932 | Ga0207690_10034745 | Ga0207690_100347452 | 371 |
| 261 | 3300025934 | Ga0207686_10139261 | Ga0207686_101392612 | 371 |
| 262 | 3300025938 | Ga0207704_10103875 | Ga0207704_101038752 | 371 |
| 263 | 3300025944 | Ga0207661_10019708 | Ga0207661_100197082 | 371 |
| 264 | 3300025961 | Ga0207712_10005922 | Ga0207712_100059223 | 371 |
| 265 | 3300025986 | Ga0207658_10034575 | Ga0207658_100345752 | 371 |
| 266 | 3300026023 | Ga0207677_10030140 | Ga0207677_100301402 | 371 |
| 267 | 3300026041 | Ga0207639_10042488 | Ga0207639_100424882 | 371 |
| 268 | 3300026089 | Ga0207648_10010508 | Ga0207648_100105089 | 371 |
| 269 | 3300026089 | Ga0207648_10130785 | Ga0207648_101307851 | 371 |
| 270 | 3300026089 | Ga0207648_10182459 | Ga0207648_101824592 | 371 |
| 271 | 3300026116 | Ga0207674_10017242 | Ga0207674_100172425 | 371 |
| 272 | 3300026142 | Ga0207698_10016099 | Ga0207698_100160994 | 371 |
| 273 | 3300028379 | Ga0268266_10010860 | Ga0268266_100108603 | 371 |
| 274 | 3300031595 | Ga0265313_10007385 | Ga0265313_100073856 | 371 |
| 275 | 3300031711 | Ga0265314_10003911 | Ga0265314_100039118 | 371 |
| 276 | 3300031711 | Ga0265314_10012023 | Ga0265314_100120237 | 371 |
| 277 | 3300035086 | Ga0373934_0020891 | Ga0373934_0020891_612_1883 | 371 |
| 278 | 3300035118 | Ga0373954_0001075 | Ga0373954_0001075_2782_4047 | 371 |
| 279 | 3300035724 | Ga0373933_0004323 | Ga0373933_0004323_3565_4866 | 371 |
| 280 | 3300035724 | Ga0373933_0047862 | Ga0373933_0047862_273_1535 | 371 |
| 281 | 3300035724 | Ga0373933_0052047 | Ga0373933_0052047_688_1962 | 371 |
| 282 | 3300036401 | Ga0373937_0015160 | Ga0373937_0015160_3784_5085 | 371 |
| 283 | 3300036401 | Ga0373937_0025989 | Ga0373937_0025989_3608_4879 | 371 |
| 284 | 3300036401 | Ga0373937_0035885 | Ga0373937_0035885_2246_3511 | 371 |
| 285 | 3300036401 | Ga0373937_0078293 | Ga0373937_0078293_194_1456 | 371 |
| 286 | 3300036401 | Ga0373937_0101867 | Ga0373937_0101867_1001_2275 | 371 |
| 287 | 3300037068 | Ga0373925_0010571 | Ga0373925_0010571_4313_5638 | 371 |
| 288 | 3300046454 | Ga0495592_0085164 | Ga0495592_0085164_18_1253 | 371 |
| 289 | 3300046462 | Ga0495651_0093787 | Ga0495651_0093787_617_1888 | 371 |
| 290 | 3300046463 | Ga0495653_0070237 | Ga0495653_0070237_415_1677 | 371 |
| 291 | 3300046473 | Ga0495582_0008917 | Ga0495582_0008917_782_2155 | 371 |
| 292 | 3300046475 | Ga0495639_0023807 | Ga0495639_0023807_993_2366 | 371 |
| 293 | 3300046499 | Ga0495594_0022843 | Ga0495594_0022843_1775_3148 | 371 |
| 294 | 3300046531 | Ga0495665_0155398 | Ga0495665_0155398_13_1182 | 371 |
| 295 | 3300046535 | Ga0495586_0068348 | Ga0495586_0068348_451_1725 | 371 |
| 296 | 3300046536 | Ga0495587_0002147 | Ga0495587_0002147_5834_7108 | 371 |
| 297 | 3300046543 | Ga0495645_0123247 | Ga0495645_0123247_274_1548 | 371 |
| 298 | 3300046642 | Ga0495634_0041408 | Ga0495634_0041408_838_2211 | 371 |
| 299 | 3300046689 | Ga0495613_0024577 | Ga0495613_0024577_3116_4387 | 371 |
| 300 | 3300047471 | Ga0495684_0014429 | Ga0495684_0014429_4689_5954 | 371 |
| 301 | 3300048088 | Ga0495602_0100728 | Ga0495602_0100728_873_2147 | 371 |
| 302 | 3300050509 | nmdc:mga0qj67_224127_c1 | nmdc:mga0qj67_224127_c1_349_1485 | 371 |
| 303 | 3300050510 | nmdc:mga06r32_22490_c1 | nmdc:mga06r32_22490_c1_3874_5097 | 371 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gou-assembly1.cif.gz_N | structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign | 0.3726 | 271 | 370 |
| 2za8-assembly1.cif.gz_A | recombinant horse l-chain apoferritin n-terminal deletion mutant (residues 1-8) | 0.3288 | 271 | 367 |
| 4v6b-assembly6.cif.gz_Cl | crystal structure of human ferritin phe167serfsx26 mutant. | 0.3261 | 271 | 368 |
| 4v6b-assembly3.cif.gz_BC | crystal structure of human ferritin phe167serfsx26 mutant. | 0.3257 | 271 | 368 |
| 5hi7-assembly1.cif.gz_A | co-crystal structure of human smyd3 with an aza-sah compound | 0.2638 | 159 | 367 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5gouJ00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.3654 | 271 | 370 | 1.20.1260.10 |
| af_D4A7Q9_149_349_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.3002 | 127 | 370 | 1.25.40.10 |
| af_Q9BZJ0_633_812_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.2941 | 226 | 364 | 1.25.40.10 |
| af_Q9HDV4_110_214_1.10.150.60 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;ARID DNA-binding domain | 0.2755 | 283 | 367 | 1.10.150.60 |
| af_D4A7Q9_149_349_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.2691 | 127 | 370 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838TRU8-F1-model_v4 | Zinc dependent phospholipase C family protein | 0.9771 | 2 | 177 |
|
| AF-A0A4Q5Y914-F1-model_v4 | deleted | 0.9617 | 2 | 200 |
|
| AF-A0A2V9H952-F1-model_v4 | Phospholipase C/D domain-containing protein | 0.9463 | 2 | 165 |
|
| AF-A0A2V8USC5-F1-model_v4 | Phospholipase C/D domain-containing protein | 0.946 | 2 | 162 |
|
| AF-A0A2V8U9G8-F1-model_v4 | Phospholipase C/D domain-containing protein | 0.9453 | 2 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar