F397116

General Info

Members Datasets Scaffolds Average Seq Length
303 166 606 180

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10673479|Ga0307410_106734791
Length 193
Sequence MGSYAVFLRGINVGGINIKMADLREALKAAGFADARTLLASGNVVLTSTLDAAAVKRECEKCLRAAFGYDAWVVVLEAARVAELVAACPYPDDDKTTHTYITLSSDKAMLDELDTAGAALEGIQQTRLGPEALAWLAPAGGTLDSPFSKISAKPRFKATTTTRNLRTLIKVRDAAAELAAAGGNPGADSARKD

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
30 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
64 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
65 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
66 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
67 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
68 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
69 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
70 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
71 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
72 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
73 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
74 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
75 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
76 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
77 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
78 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
79 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
80 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
132 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
133 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
134 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
135 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
136 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
137 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
138 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
139 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
140 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
141 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
142 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
143 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
144 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
145 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
146 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
147 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
148 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
149 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
150 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
151 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
152 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
153 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
154 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
155 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
156 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
157 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
158 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
159 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
160 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
161 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
162 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
163 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
164 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
165 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
166 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.12
Metatranscriptomes 0
Isolates 11.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 10.23
Rhizosphere 83.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10673479 3300031852 Bacteria 870
2 rootL2_10050208 3300003322 Bacteria 6832
3 Ga0065714_10009239 3300005288 Bacteria 3996
4 Ga0065712_10189573 3300005290 Bacteria 1154
5 Ga0070676_10013868 3300005328 Bacteria 4421
6 Ga0070670_100434080 3300005331 Bacteria 1162
7 Ga0070677_10016519 3300005333 Bacteria 2630
8 Ga0070666_10346874 3300005335 Bacteria 1062
9 Ga0070675_100139025 3300005354 Bacteria 2075
10 Ga0070671_100051009 3300005355 Bacteria 3441
11 Ga0070674_100106389 3300005356 Bacteria 2053
12 Ga0070667_100137806 3300005367 Bacteria 2134
13 Ga0070678_100018531 3300005456 Bacteria 4513
14 Ga0070672_100023553 3300005543 Bacteria 4540
15 Ga0075432_10005921 3300006058 Bacteria 4159
16 Ga0075362_10335470 3300006177 Bacteria 755
17 Ga0105251_10013879 3300009011 Bacteria 4481
18 Ga0105244_10004695 3300009036 Bacteria 9311
19 Ga0105244_10011687 3300009036 Bacteria 5241
20 Ga0105243_10004365 3300009148 Bacteria 11202
21 Ga0105243_10155206 3300009148 Bacteria 1968
22 Ga0105242_10321140 3300009176 Bacteria 1420
23 Ga0105248_10058233 3300009177 Bacteria 4338
24 Ga0105238_11887470 3300009551 Bacteria 630
25 Ga0105246_10001313 3300011119 Bacteria 14635
26 Ga0105246_10025131 3300011119 Bacteria 3881
27 Ga0105246_10055877 3300011119 Bacteria 2726
28 Ga0157371_10262375 3300013102 Bacteria 1245
29 Ga0157371_10557519 3300013102 Bacteria 850
30 Ga0157369_10367643 3300013105 Bacteria 1493
31 Ga0157369_11549992 3300013105 Bacteria 674
32 Ga0163162_10375794 3300013306 Bacteria 1554
33 Ga0157372_11709440 3300013307 Bacteria 724
34 Ga0209148_1011188 3300025254 Bacteria 1675
35 Ga0209759_1018905 3300025256 Bacteria 1653
36 Ga0209051_1022187 3300025303 Bacteria 2678
37 Ga0207697_10002620 3300025315 Bacteria 9253
38 Ga0207697_10034852 3300025315 Bacteria 2060
39 Ga0207655_1011356 3300025728 Bacteria 5308
40 Ga0207655_1056622 3300025728 Bacteria 1545
41 Ga0207713_1081667 3300025735 Bacteria 1161
42 Ga0207682_10022229 3300025893 Bacteria 2498
43 Ga0207645_10015972 3300025907 Bacteria 4974
44 Ga0207681_10021594 3300025923 Bacteria 4095
45 Ga0207650_10317067 3300025925 Bacteria 1276
46 Ga0207659_10086520 3300025926 Bacteria 2331
47 Ga0207644_10121355 3300025931 Bacteria 1990
48 Ga0207686_10266658 3300025934 Bacteria 1258
49 Ga0207709_10098400 3300025935 Bacteria 1929
50 Ga0207709_10126454 3300025935 Bacteria 1735
51 Ga0207669_10020093 3300025937 Bacteria 3494
52 Ga0207691_10000233 3300025940 Bacteria 54222
53 Ga0207711_10329720 3300025941 Bacteria 1411
54 Ga0207651_10284628 3300025960 Bacteria 1368
55 Ga0207658_10021498 3300025986 Bacteria 4481
56 Ga0207683_10009097 3300026121 Bacteria 8465
57 Ga0207428_10000930 3300027907 Bacteria 32598
58 Ga0207428_10174250 3300027907 Bacteria 1628
59 Ga0307408_100010991 3300031548 Bacteria 5973
60 Ga0307408_100021303 3300031548 Bacteria 4386
61 Ga0307408_100028450 3300031548 Bacteria 3862
62 Ga0307408_100047316 3300031548 Bacteria 3080
63 Ga0307408_100066511 3300031548 Bacteria 2647
64 Ga0307408_100080164 3300031548 Bacteria 2438
65 Ga0307408_100160234 3300031548 Bacteria 1786
66 Ga0307408_100260462 3300031548 Bacteria 1435
67 Ga0307408_100276921 3300031548 Bacteria 1395
68 Ga0307408_100290756 3300031548 Bacteria 1364
69 Ga0307408_100681877 3300031548 Bacteria 922
70 Ga0307408_100780474 3300031548 Bacteria 865
71 Ga0307405_10002212 3300031731 Bacteria 8494
72 Ga0307405_10005056 3300031731 Bacteria 6311
73 Ga0307405_10012356 3300031731 Bacteria 4516
74 Ga0307405_10122228 3300031731 Bacteria 1783
75 Ga0307405_10182164 3300031731 Bacteria 1509
76 Ga0307405_10456428 3300031731 Bacteria 1014
77 Ga0307405_10500057 3300031731 Bacteria 974
78 Ga0307405_10769770 3300031731 Bacteria 804
79 Ga0307413_10038806 3300031824 Bacteria 2763
80 Ga0307413_10118949 3300031824 Bacteria 1785
81 Ga0307413_10133336 3300031824 Bacteria 1704
82 Ga0307413_10233523 3300031824 Bacteria 1352
83 Ga0307413_10266743 3300031824 Bacteria 1279
84 Ga0307413_10279060 3300031824 Bacteria 1256
85 Ga0307413_10550932 3300031824 Bacteria 935
86 Ga0307410_10018224 3300031852 Bacteria 4238
87 Ga0307410_10053691 3300031852 Bacteria 2728
88 Ga0307410_10201246 3300031852 Bacteria 1520
89 Ga0307410_10255759 3300031852 Bacteria 1364
90 Ga0307410_10376844 3300031852 Bacteria 1141
91 Ga0307410_10389380 3300031852 Bacteria 1123
92 Ga0307410_10484443 3300031852 Bacteria 1015
93 Ga0307410_10633082 3300031852 Bacteria 895
94 Ga0307406_10055089 3300031901 Bacteria 2541
95 Ga0307406_10247042 3300031901 Bacteria 1342
96 Ga0307406_11165984 3300031901 Bacteria 668
97 Ga0307406_11423242 3300031901 Bacteria 608
98 Ga0307407_10029763 3300031903 Bacteria 2938
99 Ga0307407_10079077 3300031903 Bacteria 1983
100 Ga0307407_10264655 3300031903 Bacteria 1184
101 Ga0307407_10533642 3300031903 Bacteria 865
102 Ga0307412_10007885 3300031911 Bacteria 6064
103 Ga0307412_10009780 3300031911 Bacteria 5504
104 Ga0307412_10034535 3300031911 Bacteria 3223
105 Ga0307412_10040812 3300031911 Bacteria 3004
106 Ga0307412_10047692 3300031911 Bacteria 2814
107 Ga0307412_10079888 3300031911 Bacteria 2257
108 Ga0307412_10151362 3300031911 Bacteria 1712
109 Ga0307412_10152075 3300031911 Bacteria 1709
110 Ga0307412_10205580 3300031911 Bacteria 1498
111 Ga0307412_10239058 3300031911 Bacteria 1403
112 Ga0307412_10826134 3300031911 Bacteria 806
113 Ga0307409_100015438 3300031995 Bacteria 5014
114 Ga0307409_100065335 3300031995 Bacteria 2862
115 Ga0307409_100136169 3300031995 Bacteria 2108
116 Ga0307416_100051905 3300032002 Bacteria 3279
117 Ga0307416_100110309 3300032002 Bacteria 2422
118 Ga0307416_100226590 3300032002 Bacteria 1798
119 Ga0307416_100253583 3300032002 Bacteria 1714
120 Ga0307416_100259617 3300032002 Bacteria 1697
121 Ga0307416_100401957 3300032002 Bacteria 1408
122 Ga0307416_100661763 3300032002 Bacteria 1130
123 Ga0307416_100842748 3300032002 Bacteria 1014
124 Ga0307414_10148477 3300032004 Bacteria 1846
125 Ga0307414_10152911 3300032004 Bacteria 1823
126 Ga0307414_10680171 3300032004 Bacteria 930
127 Ga0307415_100314148 3300032126 Bacteria 1304
128 Ga0307415_100392824 3300032126 Bacteria 1182
129 Ga0395899_0035658 3300037312 Bacteria 3733
130 Ga0395899_0078169 3300037312 Bacteria 2412
131 Ga0395899_0116946 3300037312 Bacteria 1912
132 Ga0395899_0125543 3300037312 Bacteria 1835
133 Ga0395900_0031105 3300037418 Bacteria 5483
134 Ga0395900_0043297 3300037418 Bacteria 4640
135 Ga0395900_0071504 3300037418 Bacteria 3566
136 Ga0395900_0274963 3300037418 Bacteria 1678
137 Ga0395898_0041184 3300037466 Bacteria 4563
138 Ga0395898_0057219 3300037466 Bacteria 3800
139 Ga0395898_0110862 3300037466 Bacteria 2630
140 Ga0395901_0021029 3300038443 Bacteria 6684
141 Ga0395901_0025258 3300038443 Bacteria 6099
142 Ga0395901_0054805 3300038443 Bacteria 4145
143 Ga0439436_0002874 3300041404 Bacteria 5229
144 Ga0439436_0013114 3300041404 Bacteria 2509
145 Ga0439438_005823 3300041405 Bacteria 4469
146 Ga0439439_0000210 3300041406 Bacteria 9030
147 Ga0439439_0007810 3300041406 Bacteria 2512
148 Ga0439439_0028912 3300041406 Bacteria 1406
149 Ga0439461_0000735 3300041410 Bacteria 4764
150 Ga0439466_0016408 3300041411 Bacteria 2676
151 Ga0439466_0017136 3300041411 Bacteria 2612
152 Ga0439466_0101583 3300041411 Bacteria 896
153 Ga0439431_0078223 3300041997 Bacteria 889
154 Ga0439433_0000454 3300041999 Bacteria 7545
155 Ga0439433_0001333 3300041999 Bacteria 5078
156 Ga0439433_0002686 3300041999 Bacteria 3782
157 Ga0439442_000210 3300042002 Bacteria 14549
158 Ga0439442_000520 3300042002 Bacteria 8571
159 Ga0439442_001050 3300042002 Bacteria 5563
160 Ga0439442_001087 3300042002 Bacteria 5464
161 Ga0439442_047606 3300042002 Bacteria 904
162 Ga0439432_002241 3300042006 Bacteria 7293
163 Ga0439432_080994 3300042006 Bacteria 983
164 Ga0439449_0001056 3300042007 Bacteria 10862
165 Ga0439449_0002498 3300042007 Bacteria 7190
166 Ga0439449_0020074 3300042007 Bacteria 2504
167 Ga0439449_0232808 3300042007 Bacteria 691
168 Ga0439457_010611 3300042014 Bacteria 2115
169 Ga0439462_0009323 3300042015 Bacteria 2482
170 Ga0439462_0022966 3300042015 Bacteria 1634
171 Ga0450919_000308 3300042121 Bacteria 5786
172 Ga0450920_000561 3300042122 Bacteria 5900
173 Ga0450920_003342 3300042122 Bacteria 2770
174 Ga0450920_006126 3300042122 Bacteria 2154
175 Ga0450907_000065 3300042146 Bacteria 40682
176 Ga0450907_004941 3300042146 Bacteria 2266
177 Ga0450908_001199 3300042184 Bacteria 5016
178 Ga0450909_007045 3300042185 Bacteria 1623
179 Ga0439434_0000100 3300042435 Bacteria 22043
180 Ga0439434_0003973 3300042435 Bacteria 4316
181 Ga0495603_0262900 3300046455 Bacteria 993
182 Ga0495580_0002953 3300046472 Bacteria 14598
183 Ga0495580_0045078 3300046472 Bacteria 3133
184 Ga0495582_0069433 3300046473 Bacteria 1948
185 Ga0495639_0005090 3300046475 Bacteria 5648
186 Ga0495664_0109640 3300046477 Bacteria 1666
187 Ga0495594_0113585 3300046499 Bacteria 1528
188 Ga0495606_0184175 3300046507 Bacteria 1202
189 Ga0495643_0080674 3300046522 Bacteria 1693
190 Ga0495665_0054660 3300046531 Bacteria 2109
191 Ga0495586_0004103 3300046535 Bacteria 7806
192 Ga0495586_0007883 3300046535 Bacteria 5677
193 Ga0495587_0043252 3300046536 Bacteria 2682
194 Ga0495587_0117893 3300046536 Bacteria 1521
195 Ga0495645_0085226 3300046543 Bacteria 2262
196 Ga0495667_0022330 3300046559 Bacteria 4263
197 Ga0495656_0124601 3300046615 Bacteria 1220
198 Ga0495668_0044017 3300046616 Bacteria 2481
199 Ga0495659_0334578 3300046664 Bacteria 645
200 Ga0495588_0005497 3300046674 Bacteria 5643
201 Ga0495588_0016106 3300046674 Bacteria 3608
202 Ga0495588_0132654 3300046674 Bacteria 1314
203 Ga0495670_0035333 3300046691 Bacteria 2491
204 Ga0495670_0106330 3300046691 Bacteria 1449
205 Ga0495670_0538660 3300046691 Bacteria 635
206 Ga0495600_0021040 3300046809 Bacteria 4174
207 Ga0495581_0011540 3300047315 Bacteria 5110
208 Ga0495581_0014339 3300047315 Bacteria 4596
209 Ga0495581_0038824 3300047315 Bacteria 2756
210 Ga0495581_0171841 3300047315 Bacteria 1267
211 Ga0495604_0415539 3300047317 Bacteria 884
212 Ga0495680_0313598 3300047322 Bacteria 1099
213 Ga0495675_0011607 3300047444 Bacteria 5531
214 Ga0495675_0065823 3300047444 Bacteria 2291
215 Ga0495677_0161750 3300047445 Bacteria 864
216 Ga0495593_0090406 3300047673 Bacteria 1577
217 Ga0496100_0064851 3300048903 Bacteria 2418
218 Ga0496100_0340598 3300048903 Bacteria 1130
219 Ga0496101_0240538 3300048904 Bacteria 1408
220 Ga0496101_0393944 3300048904 Bacteria 1090
221 Ga0496101_0829061 3300048904 Bacteria 729
222 Ga0496102_0049476 3300048905 Bacteria 3824
223 Ga0496102_0428375 3300048905 Bacteria 1242
224 Ga0496102_0769376 3300048905 Bacteria 885
225 Ga0496103_0027346 3300048906 Bacteria 3455
226 Ga0496103_0072176 3300048906 Bacteria 2162
227 Ga0496105_0280177 3300048908 Bacteria 1344
228 Ga0496106_0045234 3300048909 Bacteria 3306
229 Ga0496106_0247923 3300048909 Bacteria 1423
230 Ga0496107_0050977 3300048910 Bacteria 2984
231 Ga0496107_0196932 3300048910 Bacteria 1497
232 Ga0496107_0240331 3300048910 Bacteria 1347
233 Ga0496108_0273791 3300048911 Bacteria 1469
234 Ga0496109_0083121 3300048912 Bacteria 2952
235 Ga0496109_0406396 3300048912 Bacteria 1286
236 Ga0496110_0104083 3300048913 Bacteria 2546
237 Ga0496110_0176409 3300048913 Bacteria 1939
238 Ga0496111_0089647 3300048914 Bacteria 2252
239 Ga0496111_0339763 3300048914 Bacteria 1111
240 Ga0496112_0055103 3300048915 Bacteria 3908
241 Ga0496112_0058551 3300048915 Bacteria 3794
242 Ga0496112_0544155 3300048915 Bacteria 1095
243 Ga0496113_0272841 3300048916 Bacteria 1352
244 Ga0496113_0286861 3300048916 Bacteria 1316
245 Ga0496113_1157703 3300048916 Bacteria 605
246 Ga0496114_0169264 3300048917 Bacteria 1903
247 Ga0496115_0273902 3300048918 Bacteria 1386
248 Ga0501032_0001739 3300049569 Bacteria 17222
249 Ga0501032_0023324 3300049569 Bacteria 4278
250 Ga0501034_0000123 3300049571 Bacteria 143688
251 Ga0501036_0187634 3300049572 Bacteria 1740
252 Ga0501037_0000863 3300049573 Bacteria 22612
253 Ga0501037_0001957 3300049573 Bacteria 14880
254 Ga0501038_0046118 3300049574 Bacteria 3779
255 Ga0501038_0088979 3300049574 Bacteria 2591
256 Ga0501038_0231751 3300049574 Bacteria 1469
257 Ga0501038_0308320 3300049574 Bacteria 1241
258 Ga0501039_0010556 3300049575 Bacteria 7039
259 Ga0501039_0017134 3300049575 Bacteria 5556
260 Ga0501039_0850082 3300049575 Bacteria 711
261 Ga0501043_0186768 3300049579 Bacteria 1613
262 Ga0501043_0391755 3300049579 Bacteria 1050
263 Ga0501043_0466844 3300049579 Bacteria 946
264 Ga0501043_0557520 3300049579 Bacteria 850
265 Ga0501279_057423 3300049775 Bacteria 630
266 Ga0501044_0201163 3300049823 Bacteria 1950
267 nmdc:mga00v17_625558_c1 3300050491 Bacteria 693
268 2691514390 2690315906 Bacteria 4517044
269 2739238310 2738543011 Bacteria 5731169
270 2775655282 2775506735 Bacteria 4556596
271 2808827474 2808606357 Bacteria 4466944
272 2808852840 2808606360 Bacteria 4404006
273 2808878711 2808606366 Bacteria 4415912
274 2808891709 2808606370 Bacteria 4942454
275 2808896839 2808606371 Bacteria 4251511
276 2812320741 2811994871 Bacteria 4497550
277 2857741548 2857740372 Bacteria 4782044
278 2889302270 2889300758 Bacteria 5690814
279 2904500080 2904497146 Bacteria 4731781
280 2904776407 2904776348 Bacteria 4658726
281 2910813209 2910809715 Bacteria 4982797
282 2919037536 2919034639 Bacteria 4763403
283 2919063290 2919059106 Bacteria 4991624
284 2919391206 2919391150 Bacteria 4884741
285 2919541923 2919538618 Bacteria 4677069
286 2932429024 2932426870 Bacteria 4547726
287 2933421232 2933418574 Bacteria 4476724
288 2939598443 2939598168 Bacteria 4687164
289 2939649089 2939647034 Bacteria 4681660
290 2939676283 2939674588 Bacteria 4844420
291 2939748303 2939743619 Bacteria 5762299
292 2945918501 2945916053 Bacteria 4555517
293 2945921216 2945920336 Bacteria 4501603
294 2945942622 2945941187 Bacteria 4682474
295 2945959621 2945956166 Bacteria 5110334
296 2946026210 2946024296 Bacteria 3508095
297 2946038541 2946037020 Bacteria 4900426
298 2946062359 2946059875 Bacteria 4386623
299 2953999814 2953998280 Bacteria 4812144
300 2974306532 2974302888 Bacteria 4369871
301 8004021858 8004021418 Bacteria 4313954
302 8004027686 8004025490 Bacteria 4327753
303 8054107883 8054107350 Bacteria 5022511
304 Ga0307410_10673479
305 rootL2_10050208
306 Ga0065714_10009239
307 Ga0065712_10189573
308 Ga0070676_10013868
309 Ga0070670_100434080
310 Ga0070677_10016519
311 Ga0070666_10346874
312 Ga0070675_100139025
313 Ga0070671_100051009
314 Ga0070674_100106389
315 Ga0070667_100137806
316 Ga0070678_100018531
317 Ga0070672_100023553
318 Ga0075432_10005921
319 Ga0075362_10335470
320 Ga0105251_10013879
321 Ga0105244_10004695
322 Ga0105244_10011687
323 Ga0105243_10004365
324 Ga0105243_10155206
325 Ga0105242_10321140
326 Ga0105248_10058233
327 Ga0105238_11887470
328 Ga0105246_10001313
329 Ga0105246_10025131
330 Ga0105246_10055877
331 Ga0157371_10262375
332 Ga0157371_10557519
333 Ga0157369_10367643
334 Ga0157369_11549992
335 Ga0163162_10375794
336 Ga0157372_11709440
337 Ga0209148_1011188
338 Ga0209759_1018905
339 Ga0209051_1022187
340 Ga0207697_10002620
341 Ga0207697_10034852
342 Ga0207655_1011356
343 Ga0207655_1056622
344 Ga0207713_1081667
345 Ga0207682_10022229
346 Ga0207645_10015972
347 Ga0207681_10021594
348 Ga0207650_10317067
349 Ga0207659_10086520
350 Ga0207644_10121355
351 Ga0207686_10266658
352 Ga0207709_10098400
353 Ga0207709_10126454
354 Ga0207669_10020093
355 Ga0207691_10000233
356 Ga0207711_10329720
357 Ga0207651_10284628
358 Ga0207658_10021498
359 Ga0207683_10009097
360 Ga0207428_10000930
361 Ga0207428_10174250
362 Ga0307408_100010991
363 Ga0307408_100021303
364 Ga0307408_100028450
365 Ga0307408_100047316
366 Ga0307408_100066511
367 Ga0307408_100080164
368 Ga0307408_100160234
369 Ga0307408_100260462
370 Ga0307408_100276921
371 Ga0307408_100290756
372 Ga0307408_100681877
373 Ga0307408_100780474
374 Ga0307405_10002212
375 Ga0307405_10005056
376 Ga0307405_10012356
377 Ga0307405_10122228
378 Ga0307405_10182164
379 Ga0307405_10456428
380 Ga0307405_10500057
381 Ga0307405_10769770
382 Ga0307413_10038806
383 Ga0307413_10118949
384 Ga0307413_10133336
385 Ga0307413_10233523
386 Ga0307413_10266743
387 Ga0307413_10279060
388 Ga0307413_10550932
389 Ga0307410_10018224
390 Ga0307410_10053691
391 Ga0307410_10201246
392 Ga0307410_10255759
393 Ga0307410_10376844
394 Ga0307410_10389380
395 Ga0307410_10484443
396 Ga0307410_10633082
397 Ga0307406_10055089
398 Ga0307406_10247042
399 Ga0307406_11165984
400 Ga0307406_11423242
401 Ga0307407_10029763
402 Ga0307407_10079077
403 Ga0307407_10264655
404 Ga0307407_10533642
405 Ga0307412_10007885
406 Ga0307412_10009780
407 Ga0307412_10034535
408 Ga0307412_10040812
409 Ga0307412_10047692
410 Ga0307412_10079888
411 Ga0307412_10151362
412 Ga0307412_10152075
413 Ga0307412_10205580
414 Ga0307412_10239058
415 Ga0307412_10826134
416 Ga0307409_100015438
417 Ga0307409_100065335
418 Ga0307409_100136169
419 Ga0307416_100051905
420 Ga0307416_100110309
421 Ga0307416_100226590
422 Ga0307416_100253583
423 Ga0307416_100259617
424 Ga0307416_100401957
425 Ga0307416_100661763
426 Ga0307416_100842748
427 Ga0307414_10148477
428 Ga0307414_10152911
429 Ga0307414_10680171
430 Ga0307415_100314148
431 Ga0307415_100392824
432 Ga0395899_0035658
433 Ga0395899_0078169
434 Ga0395899_0116946
435 Ga0395899_0125543
436 Ga0395900_0031105
437 Ga0395900_0043297
438 Ga0395900_0071504
439 Ga0395900_0274963
440 Ga0395898_0041184
441 Ga0395898_0057219
442 Ga0395898_0110862
443 Ga0395901_0021029
444 Ga0395901_0025258
445 Ga0395901_0054805
446 Ga0439436_0002874
447 Ga0439436_0013114
448 Ga0439438_005823
449 Ga0439439_0000210
450 Ga0439439_0007810
451 Ga0439439_0028912
452 Ga0439461_0000735
453 Ga0439466_0016408
454 Ga0439466_0017136
455 Ga0439466_0101583
456 Ga0439431_0078223
457 Ga0439433_0000454
458 Ga0439433_0001333
459 Ga0439433_0002686
460 Ga0439442_000210
461 Ga0439442_000520
462 Ga0439442_001050
463 Ga0439442_001087
464 Ga0439442_047606
465 Ga0439432_002241
466 Ga0439432_080994
467 Ga0439449_0001056
468 Ga0439449_0002498
469 Ga0439449_0020074
470 Ga0439449_0232808
471 Ga0439457_010611
472 Ga0439462_0009323
473 Ga0439462_0022966
474 Ga0450919_000308
475 Ga0450920_000561
476 Ga0450920_003342
477 Ga0450920_006126
478 Ga0450907_000065
479 Ga0450907_004941
480 Ga0450908_001199
481 Ga0450909_007045
482 Ga0439434_0000100
483 Ga0439434_0003973
484 Ga0495603_0262900
485 Ga0495580_0002953
486 Ga0495580_0045078
487 Ga0495582_0069433
488 Ga0495639_0005090
489 Ga0495664_0109640
490 Ga0495594_0113585
491 Ga0495606_0184175
492 Ga0495643_0080674
493 Ga0495665_0054660
494 Ga0495586_0004103
495 Ga0495586_0007883
496 Ga0495587_0043252
497 Ga0495587_0117893
498 Ga0495645_0085226
499 Ga0495667_0022330
500 Ga0495656_0124601
501 Ga0495668_0044017
502 Ga0495659_0334578
503 Ga0495588_0005497
504 Ga0495588_0016106
505 Ga0495588_0132654
506 Ga0495670_0035333
507 Ga0495670_0106330
508 Ga0495670_0538660
509 Ga0495600_0021040
510 Ga0495581_0011540
511 Ga0495581_0014339
512 Ga0495581_0038824
513 Ga0495581_0171841
514 Ga0495604_0415539
515 Ga0495680_0313598
516 Ga0495675_0011607
517 Ga0495675_0065823
518 Ga0495677_0161750
519 Ga0495593_0090406
520 Ga0496100_0064851
521 Ga0496100_0340598
522 Ga0496101_0240538
523 Ga0496101_0393944
524 Ga0496101_0829061
525 Ga0496102_0049476
526 Ga0496102_0428375
527 Ga0496102_0769376
528 Ga0496103_0027346
529 Ga0496103_0072176
530 Ga0496105_0280177
531 Ga0496106_0045234
532 Ga0496106_0247923
533 Ga0496107_0050977
534 Ga0496107_0196932
535 Ga0496107_0240331
536 Ga0496108_0273791
537 Ga0496109_0083121
538 Ga0496109_0406396
539 Ga0496110_0104083
540 Ga0496110_0176409
541 Ga0496111_0089647
542 Ga0496111_0339763
543 Ga0496112_0055103
544 Ga0496112_0058551
545 Ga0496112_0544155
546 Ga0496113_0272841
547 Ga0496113_0286861
548 Ga0496113_1157703
549 Ga0496114_0169264
550 Ga0496115_0273902
551 Ga0501032_0001739
552 Ga0501032_0023324
553 Ga0501034_0000123
554 Ga0501036_0187634
555 Ga0501037_0000863
556 Ga0501037_0001957
557 Ga0501038_0046118
558 Ga0501038_0088979
559 Ga0501038_0231751
560 Ga0501038_0308320
561 Ga0501039_0010556
562 Ga0501039_0017134
563 Ga0501039_0850082
564 Ga0501043_0186768
565 Ga0501043_0391755
566 Ga0501043_0466844
567 Ga0501043_0557520
568 Ga0501279_057423
569 Ga0501044_0201163
570 nmdc:mga00v17_625558_c1
571 2691514390
572 2739238310
573 2775655282
574 2808827474
575 2808852840
576 2808878711
577 2808891709
578 2808896839
579 2812320741
580 2857741548
581 2889302270
582 2904500080
583 2904776407
584 2910813209
585 2919037536
586 2919063290
587 2919391206
588 2919541923
589 2932429024
590 2933421232
591 2939598443
592 2939649089
593 2939676283
594 2939748303
595 2945918501
596 2945921216
597 2945942622
598 2945959621
599 2946026210
600 2946038541
601 2946062359
602 2953999814
603 2974306532
604 8004021858
605 8004027686
606 8054107883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08002

DUF1697

Protein of unknown function (DUF1697)

1

133

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7831 4 178
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7735 4 179
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7641 4 178
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.7585 4 179
2rsq-assembly1.cif.gz_A copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs 0.7378 4 80
ID Description Score Start End Superfamily
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9495 2 88 3.30.70.1280
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9289 2 88 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9036 6 89 3.30.70.1280
af_Q54D49_1_88_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.876 4 88 3.30.70.1280
af_Q54D49_1_88_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.839 4 88 3.30.70.1280
ID Description Score Start End GO Terms
AF-A0A0B2AA88-F1-model_v4 Pyridoxamine 5-phosphate oxidase 0.9449 5 178
AF-A0A3Q9WFT6-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.935 4 179
AF-A0A2S5XZM9-F1-model_v4 Pyridoxamine 5-phosphate oxidase 0.9262 5 176
AF-A0A4U2ZYR9-F1-model_v4 deleted 0.9248 6 88
AF-A0A6N0YG07-F1-model_v4 deleted 0.9243 6 77

Map