F397142

General Info

Members Datasets Scaffolds Average Seq Length
303 168 303 694

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0002358|Ga0395899_0002358_9515_11806
Length 763
Sequence LVRLAALYILGSLLVAGAWLRLESGGIPWEKVALMIALGLLPTVAVTVGRRWSAAGIGVAALLAATAEAFAVPVTDARLGGEHDFFGPVLGSFKEGFLNFYDTNLPFRPDDFPLMHSVVLIAIFVFCAAMGVLLAADRPVAAAVALVFAVGWPATLVPGGRPLAVGVLALVGVLAVLFLFRAGARPTRGLLQGAAVAIVLVXXXSLASTSNAVAKGAFLSWQGWDPYDRPDEPVGVRYVWNSHYLGIQFPKKKTTVFRVRIPGPQRNLYWRATTLDDYTGSGWQEDLDLSEAAQREQLDVPGLNARARDQSNWVRQDITVEALRDNHLMASAQPVRWRPPSDAEVQDENGDIVVLPRALHQGQRFTVWSFVPRAKPSDLAKAGTDYPRSIDRYLQVIQGDGEVPAFGTPDREALMRGFFDATWKDDFLMQANKPLYDRARPIVRGAKTPYEATVALVTWFRRDGGFRYDQQPPPPGPNEPALAAFVTRTKRGYCQHYAGAMALMLRFLGVPARVAAGFTSGSYDADKHEWKVTDHEAHDWVEVYFPGWGWMPFDPTPGRGLLNAAYDPSSPAFDNRDTSFLRGTTNDTLGSILREAERSQGRPGLESVSGAGNTGSGSGGSTVVRDKGPSIVGLAFLVLAAAVVLVVGLKAVLRALRFAGRDPRALASACRKDLVGFLADQGHELPPSATLPEVARALDRFYAVDAKSFARWAAIARFARPDEAEDAVARARRELKRVRRDLRHQLSAISRFKGAISLRSLTV

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
85 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 12.54
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100029576 3300005329 Bacteria 4961
2 Ga0070680_100031846 3300005336 Bacteria 4240
3 Ga0068868_100051385 3300005338 Unclassified 3242
4 Ga0070660_100053754 3300005339 Unclassified 3107
5 Ga0070661_100053606 3300005344 Bacteria 2953
6 Ga0070709_10003184 3300005434 Bacteria 8803
7 Ga0070709_10013230 3300005434 Bacteria 4632
8 Ga0070714_100015222 3300005435 Bacteria 6187
9 Ga0070714_100021822 3300005435 Bacteria 5242
10 Ga0070714_100041922 3300005435 Bacteria 3864
11 Ga0070713_100005933 3300005436 Bacteria 8398
12 Ga0070713_100019288 3300005436 Bacteria 5203
13 Ga0070713_100020617 3300005436 Bacteria 5057
14 Ga0070713_100033831 3300005436 Bacteria 4099
15 Ga0070710_10008830 3300005437 Bacteria 4915
16 Ga0070663_100044515 3300005455 Bacteria 3130
17 Ga0070681_10021802 3300005458 Bacteria 6423
18 Ga0070681_10061639 3300005458 Bacteria 3724
19 Ga0070681_10111171 3300005458 Bacteria 2679
20 Ga0070707_100018998 3300005468 Bacteria 6472
21 Ga0070698_100010868 3300005471 Bacteria 9685
22 Ga0070698_100025914 3300005471 Bacteria 6108
23 Ga0070698_100027034 3300005471 Bacteria 5967
24 Ga0070699_100082263 3300005518 Bacteria 2806
25 Ga0070684_100002170 3300005535 Bacteria 14480
26 Ga0070686_100040663 3300005544 Bacteria 2901
27 Ga0070695_100012956 3300005545 Bacteria 5006
28 Ga0070695_100036995 3300005545 Bacteria 3074
29 Ga0070696_100038424 3300005546 Bacteria 3303
30 Ga0070704_100012359 3300005549 Bacteria 5272
31 Ga0068855_100016388 3300005563 Bacteria 8909
32 Ga0068855_100036908 3300005563 Bacteria 5814
33 Ga0068857_100010450 3300005577 Bacteria 8069
34 Ga0068856_100006515 3300005614 Bacteria 11449
35 Ga0068861_100003224 3300005719 Bacteria 10792
36 Ga0068861_100083983 3300005719 Bacteria 2499
37 Ga0068858_100065919 3300005842 Bacteria 3351
38 Ga0081455_10004258 3300005937 Bacteria 16131
39 Ga0081455_10007410 3300005937 Bacteria 11557
40 Ga0081455_10008732 3300005937 Bacteria 10492
41 Ga0081455_10017206 3300005937 Bacteria 6939
42 Ga0081538_10000057 3300005981 Bacteria 102521
43 Ga0081538_10001522 3300005981 Bacteria 23789
44 Ga0081538_10014935 3300005981 Bacteria 6046
45 Ga0081538_10021533 3300005981 Bacteria 4701
46 Ga0081538_10026144 3300005981 Bacteria 4091
47 Ga0081540_1001396 3300005983 Bacteria 20924
48 Ga0081540_1011085 3300005983 Bacteria 6052
49 Ga0081540_1013265 3300005983 Bacteria 5368
50 Ga0081539_10005546 3300005985 Bacteria 12791
51 Ga0081539_10015440 3300005985 Bacteria 5549
52 Ga0070717_10016162 3300006028 Bacteria 5782
53 Ga0070717_10028303 3300006028 Bacteria 4484
54 Ga0070717_10038509 3300006028 Bacteria 3887
55 Ga0070716_100040150 3300006173 Bacteria 2602
56 Ga0070712_100005466 3300006175 Bacteria 7868
57 Ga0068871_100018185 3300006358 Bacteria 5337
58 Ga0075428_100000374 3300006844 Bacteria 44299
59 Ga0075428_100127625 3300006844 Unclassified 2767
60 Ga0075428_100157700 3300006844 Bacteria 2464
61 Ga0075433_10026150 3300006852 Bacteria 4938
62 Ga0075434_100006545 3300006871 Bacteria 10683
63 Ga0075434_100041379 3300006871 Bacteria 4566
64 Ga0075436_100020052 3300006914 Bacteria 4588
65 Ga0075436_100026414 3300006914 Bacteria 3998
66 Ga0075435_100005410 3300007076 Bacteria 8907
67 Ga0075435_100007426 3300007076 Bacteria 7807
68 Ga0111539_10003521 3300009094 Bacteria 20636
69 Ga0111539_10009951 3300009094 Bacteria 11990
70 Ga0105245_10012378 3300009098 Bacteria 7424
71 Ga0105245_10024631 3300009098 Bacteria 5286
72 Ga0105245_10045847 3300009098 Bacteria 3906
73 Ga0114129_10014549 3300009147 Bacteria 11213
74 Ga0114129_10054005 3300009147 Bacteria 5634
75 Ga0105241_10052450 3300009174 Bacteria 3114
76 Ga0105242_10097365 3300009176 Bacteria 2487
77 Ga0105249_10017488 3300009553 Bacteria 6366
78 Ga0157370_10022819 3300013104 Bacteria 6223
79 Ga0157369_10009528 3300013105 Bacteria 11104
80 Ga0163162_10090059 3300013306 Bacteria 3149
81 Ga0157372_10135790 3300013307 Bacteria 2832
82 Ga0182008_10003934 3300014497 Bacteria 8793
83 Ga0157377_10014843 3300014745 Unclassified 3973
84 Ga0157376_10004722 3300014969 Bacteria 9493
85 Ga0182007_10011868 3300015262 Bacteria 3372
86 Ga0163161_10015833 3300017792 Bacteria 5259
87 Ga0206356_10456611 3300020070 Bacteria 2639
88 Ga0207653_10011108 3300025885 Unclassified 2812
89 Ga0207685_10001983 3300025905 Bacteria 4543
90 Ga0207699_10041518 3300025906 Bacteria 2658
91 Ga0207643_10012009 3300025908 Bacteria 4677
92 Ga0207693_10000417 3300025915 Bacteria 38685
93 Ga0207693_10008441 3300025915 Bacteria 8429
94 Ga0207693_10010088 3300025915 Bacteria 7673
95 Ga0207693_10010248 3300025915 Bacteria 7609
96 Ga0207693_10015003 3300025915 Bacteria 6220
97 Ga0207663_10036596 3300025916 Bacteria 2954
98 Ga0207657_10010546 3300025919 Bacteria 9214
99 Ga0207657_10017685 3300025919 Bacteria 6829
100 Ga0207646_10051716 3300025922 Bacteria 3675
101 Ga0207700_10000006 3300025928 Bacteria 348187
102 Ga0207664_10003007 3300025929 Bacteria 11203
103 Ga0207664_10011573 3300025929 Bacteria 6281
104 Ga0207664_10057112 3300025929 Bacteria 3102
105 Ga0207664_10114280 3300025929 Bacteria 2249
106 Ga0207706_10006862 3300025933 Bacteria 10527
107 Ga0207706_10024807 3300025933 Bacteria 5374
108 Ga0207706_10046832 3300025933 Bacteria 3828
109 Ga0207665_10001319 3300025939 Bacteria 16733
110 Ga0207665_10004275 3300025939 Bacteria 9492
111 Ga0207665_10004558 3300025939 Bacteria 9195
112 Ga0207665_10010515 3300025939 Bacteria 6079
113 Ga0207689_10053837 3300025942 Bacteria 3315
114 Ga0207677_10010513 3300026023 Bacteria 5241
115 Ga0207677_10023274 3300026023 Bacteria 3823
116 Ga0207703_10046200 3300026035 Bacteria 3507
117 Ga0207678_10010343 3300026067 Bacteria 8189
118 Ga0207708_10016596 3300026075 Bacteria 5539
119 Ga0207708_10025060 3300026075 Bacteria 4511
120 Ga0207708_10081345 3300026075 Unclassified 2490
121 Ga0207648_10016194 3300026089 Bacteria 6823
122 Ga0207674_10004135 3300026116 Bacteria 17554
123 Ga0207675_100002156 3300026118 Bacteria 19554
124 Ga0207675_100011844 3300026118 Bacteria 8150
125 Ga0207683_10039149 3300026121 Bacteria 4135
126 Ga0207698_10092688 3300026142 Bacteria 2477
127 Ga0207428_10051499 3300027907 Unclassified 3291
128 Ga0307405_10022723 3300031731 Bacteria 3551
129 Ga0307413_10001651 3300031824 Bacteria 8655
130 Ga0307406_10003782 3300031901 Bacteria 8236
131 Ga0307412_10002177 3300031911 Bacteria 10877
132 Ga0307409_100002133 3300031995 Bacteria 10192
133 Ga0307409_100029860 3300031995 Bacteria 3908
134 Ga0307416_100002165 3300032002 Bacteria 11126
135 Ga0307416_100005708 3300032002 Bacteria 7696
136 Ga0307415_100013517 3300032126 Bacteria 4768
137 Ga0373949_0001938 3300035090 Bacteria 5578
138 Ga0373939_0003511 3300035114 Bacteria 3682
139 Ga0373943_0011501 3300035170 Bacteria 3983
140 Ga0373947_0029070 3300035725 Bacteria 3241
141 Ga0395899_0002358 3300037312 Bacteria 15375
142 Ga0395899_0004794 3300037312 Bacteria 10539
143 Ga0395899_0009876 3300037312 Bacteria 7318
144 Ga0395899_0018013 3300037312 Bacteria 5374
145 Ga0395899_0030455 3300037312 Bacteria 4059
146 Ga0395899_0032146 3300037312 Bacteria 3942
147 Ga0395899_0064502 3300037312 Unclassified 2693
148 Ga0395900_0003631 3300037418 Bacteria 16591
149 Ga0395900_0006420 3300037418 Bacteria 12254
150 Ga0395900_0007753 3300037418 Bacteria 11072
151 Ga0395900_0012678 3300037418 Bacteria 8618
152 Ga0395900_0037304 3300037418 Bacteria 5012
153 Ga0395900_0048839 3300037418 Bacteria 4358
154 Ga0395900_0054115 3300037418 Bacteria 4132
155 Ga0395900_0134535 3300037418 Unclassified 2532
156 Ga0395898_0001851 3300037466 Bacteria 27144
157 Ga0395898_0004517 3300037466 Bacteria 15202
158 Ga0395898_0005363 3300037466 Bacteria 13852
159 Ga0395898_0007080 3300037466 Bacteria 11915
160 Ga0395898_0011341 3300037466 Bacteria 9261
161 Ga0395898_0014409 3300037466 Bacteria 8123
162 Ga0395905_0004039 3300037471 Bacteria 15402
163 Ga0395905_0011109 3300037471 Bacteria 8710
164 Ga0395901_0001425 3300038443 Bacteria 24931
165 Ga0395901_0005245 3300038443 Bacteria 13085
166 Ga0395901_0007447 3300038443 Bacteria 11045
167 Ga0395901_0019853 3300038443 Bacteria 6874
168 Ga0395901_0024740 3300038443 Bacteria 6165
169 Ga0395901_0041831 3300038443 Bacteria 4750
170 Ga0395901_0043161 3300038443 Bacteria 4678
171 Ga0395901_0082464 3300038443 Bacteria 3360
172 Ga0395901_0124701 3300038443 Bacteria 2706
173 Ga0439439_0002455 3300041406 Bacteria 3944
174 Ga0439448_0007575 3300042005 Bacteria 3151
175 Ga0450920_002547 3300042122 Bacteria 3110
176 Ga0466961_0001130 3300044693 Bacteria 16358
177 Ga0466963_0012009 3300044694 Bacteria 5290
178 Ga0466963_0060346 3300044694 Bacteria 2532
179 Ga0466964_0001028 3300044706 Bacteria 9291
180 Ga0466957_0005496 3300044842 Bacteria 7112
181 Ga0466957_0060047 3300044842 Bacteria 2331
182 Ga0466959_0000579 3300045049 Bacteria 21316
183 Ga0466959_0042974 3300045049 Bacteria 3333
184 Ga0451576_0009765 3300045051 Bacteria 11093
185 Ga0466958_0009304 3300045836 Bacteria 5473
186 Ga0466967_0004940 3300045976 Bacteria 9119
187 Ga0466967_0015502 3300045976 Bacteria 5975
188 Ga0466967_0019549 3300045976 Bacteria 5449
189 Ga0466967_0025016 3300045976 Bacteria 4916
190 Ga0466967_0030354 3300045976 Bacteria 4535
191 Ga0495603_0002966 3300046455 Bacteria 10037
192 Ga0495641_0005756 3300046461 Bacteria 8237
193 Ga0495641_0007685 3300046461 Bacteria 6690
194 Ga0495582_0015210 3300046473 Bacteria 4231
195 Ga0495639_0009477 3300046475 Bacteria 4176
196 Ga0495594_0036658 3300046499 Bacteria 2674
197 Ga0495608_0038080 3300046511 Bacteria 3232
198 Ga0495630_0007394 3300046517 Bacteria 7848
199 Ga0495640_0014354 3300046533 Bacteria 5998
200 Ga0495667_0045118 3300046559 Bacteria 2919
201 Ga0495588_0023512 3300046674 Bacteria 3052
202 Ga0495647_0009274 3300046681 Unclassified 3328
203 Ga0495613_0008070 3300046689 Bacteria 7828
204 Ga0495624_0015216 3300046690 Bacteria 5203
205 Ga0495671_0049780 3300046692 Bacteria 2088
206 Ga0495604_0027114 3300047317 Bacteria 4558
207 Ga0495674_0010972 3300047319 Bacteria 8560
208 Ga0495674_0036793 3300047319 Unclassified 4402
209 Ga0495680_0024955 3300047322 Bacteria 4951
210 Ga0496100_0024288 3300048903 Bacteria 3696
211 Ga0496101_0062188 3300048904 Bacteria 2714
212 Ga0496101_0078002 3300048904 Bacteria 2442
213 Ga0496102_0082950 3300048905 Bacteria 2957
214 Ga0496104_0001575 3300048907 Bacteria 19621
215 Ga0496104_0009467 3300048907 Bacteria 8667
216 Ga0496104_0016981 3300048907 Bacteria 6621
217 Ga0496105_0000705 3300048908 Bacteria 22625
218 Ga0496105_0001189 3300048908 Bacteria 18104
219 Ga0496106_0010212 3300048909 Bacteria 6938
220 Ga0496106_0021406 3300048909 Bacteria 4802
221 Ga0496107_0002732 3300048910 Bacteria 11587
222 Ga0496107_0038969 3300048910 Bacteria 3409
223 Ga0496107_0054765 3300048910 Bacteria 2880
224 Ga0496108_0006577 3300048911 Bacteria 9429
225 Ga0496108_0010896 3300048911 Bacteria 7380
226 Ga0496108_0029455 3300048911 Bacteria 4546
227 Ga0496109_0007519 3300048912 Bacteria 9229
228 Ga0496109_0078603 3300048912 Bacteria 3038
229 Ga0496109_0087038 3300048912 Bacteria 2885
230 Ga0496110_0000833 3300048913 Bacteria 21672
231 Ga0496110_0005683 3300048913 Bacteria 9793
232 Ga0496110_0032787 3300048913 Bacteria 4490
233 Ga0496111_0000238 3300048914 Bacteria 26361
234 Ga0496111_0000437 3300048914 Bacteria 21122
235 Ga0496111_0002075 3300048914 Bacteria 11944
236 Ga0496111_0016612 3300048914 Bacteria 5075
237 Ga0496111_0029268 3300048914 Unclassified 3911
238 Ga0496111_0049274 3300048914 Unclassified 3037
239 Ga0496112_0001299 3300048915 Bacteria 18983
240 Ga0496112_0001552 3300048915 Bacteria 17758
241 Ga0496112_0014630 3300048915 Bacteria 7291
242 Ga0496112_0030423 3300048915 Bacteria 5225
243 Ga0496113_0000174 3300048916 Bacteria 28582
244 Ga0496113_0001819 3300048916 Bacteria 12122
245 Ga0496113_0031544 3300048916 Bacteria 3846
246 Ga0496115_0005373 3300048918 Bacteria 9322
247 Ga0496115_0010212 3300048918 Bacteria 7005
248 Ga0501031_0002104 3300049568 Bacteria 12555
249 Ga0501031_0002166 3300049568 Bacteria 12396
250 Ga0501031_0010671 3300049568 Bacteria 5984
251 Ga0501033_0001810 3300049570 Bacteria 18675
252 Ga0501034_0070291 3300049571 Bacteria 3512
253 Ga0501036_0032247 3300049572 Bacteria 4426
254 Ga0501037_0010542 3300049573 Bacteria 6789
255 Ga0501038_0001738 3300049574 Bacteria 20249
256 Ga0501038_0034228 3300049574 Bacteria 4469
257 Ga0501038_0046089 3300049574 Bacteria 3781
258 Ga0501038_0053924 3300049574 Bacteria 3459
259 Ga0501039_0028199 3300049575 Bacteria 4320
260 Ga0501040_0002160 3300049576 Bacteria 12700
261 Ga0501040_0018718 3300049576 Bacteria 4599
262 Ga0501040_0055406 3300049576 Bacteria 2718
263 Ga0501042_0005142 3300049578 Bacteria 8397
264 Ga0501043_0003871 3300049579 Bacteria 12297
265 Ga0501048_0036146 3300049582 Bacteria 3551
266 Ga0501067_0003649 3300049583 Bacteria 8482
267 Ga0501068_0002625 3300049584 Bacteria 9515
268 Ga0501068_0009076 3300049584 Bacteria 5550
269 Ga0501068_0013383 3300049584 Bacteria 4667
270 Ga0501070_0010797 3300049586 Bacteria 7715
271 Ga0501071_0002739 3300049587 Bacteria 10807
272 Ga0501072_0013343 3300049588 Bacteria 6290
273 Ga0501072_0042855 3300049588 Bacteria 3555
274 Ga0501072_0073064 3300049588 Bacteria 2711
275 Ga0501072_0107084 3300049588 Unclassified 2223
276 Ga0501073_0009024 3300049589 Bacteria 7361
277 Ga0501074_0006380 3300049590 Bacteria 8515
278 Ga0501074_0037179 3300049590 Bacteria 3529
279 Ga0501075_0005898 3300049591 Bacteria 8379
280 Ga0501075_0016535 3300049591 Bacteria 5316
281 Ga0501076_0018749 3300049592 Bacteria 5281
282 Ga0501077_0000973 3300049593 Bacteria 17237
283 Ga0501077_0018563 3300049593 Bacteria 4398
284 Ga0501079_0016912 3300049741 Bacteria 5570
285 Ga0501079_0040189 3300049741 Bacteria 3608
286 Ga0501080_0069332 3300049742 Bacteria 3279
287 Ga0501044_0023145 3300049823 Bacteria 6612
288 Ga0501044_0047735 3300049823 Bacteria 4428
289 Ga0501045_0001798 3300049824 Bacteria 14481
290 nmdc:mga00v17_38829_c1 3300050491 Bacteria 2849
291 nmdc:mga05p37_10213_c1 3300050507 Bacteria 11149
292 nmdc:mga05p37_155420_c1 3300050507 Unclassified 2796
293 nmdc:mga0n895_106661_c1 3300050512 Unclassified 2814
294 nmdc:mga0n895_38763_c1 3300050512 Bacteria 4618
295 nmdc:mga08x19_21855_c1 3300050514 Bacteria 3955
296 nmdc:mga0a205_31665_c1 3300050515 Bacteria 5069
297 nmdc:mga0a205_4173_c1 3300050515 Bacteria 12947
298 Ga0495619_0011342 3300053085 Bacteria 5611
299 Ga0501084_0011448 3300054114 Bacteria 7346
300 Ga0501084_0016626 3300054114 Bacteria 6109
301 Ga0501084_0017787 3300054114 Bacteria 5915
302 Ga0501082_0024391 3300060353 Bacteria 5214
303 Ga0530510_0004573 3300061734 Bacteria 9571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0009024 Ga0501073_0009024_4986_6872 531
2 3300025929 Ga0207664_10057112 Ga0207664_100571122 554
3 3300005435 Ga0070714_100041922 Ga0070714_1000419223 555
4 3300025908 Ga0207643_10012009 Ga0207643_100120092 556
5 3300049588 Ga0501072_0107084 Ga0501072_0107084_19_1980 556
6 3300025929 Ga0207664_10114280 Ga0207664_101142802 558
7 3300045976 Ga0466967_0019549 Ga0466967_0019549_2511_4559 562
8 3300025942 Ga0207689_10053837 Ga0207689_100538372 563
9 3300046692 Ga0495671_0049780 Ga0495671_0049780_53_2008 563
10 3300044694 Ga0466963_0060346 Ga0466963_0060346_85_2217 575
11 3300044842 Ga0466957_0060047 Ga0466957_0060047_107_2239 577
12 3300014497 Ga0182008_10003934 Ga0182008_100039345 578
13 3300015262 Ga0182007_10011868 Ga0182007_100118682 578
14 3300045976 Ga0466967_0004940 Ga0466967_0004940_1175_3316 586
15 3300013105 Ga0157369_10009528 Ga0157369_100095285 587
16 3300013104 Ga0157370_10022819 Ga0157370_100228198 588
17 3300049588 Ga0501072_0073064 Ga0501072_0073064_502_2685 594
18 3300049741 Ga0501079_0040189 Ga0501079_0040189_508_2691 594
19 3300054114 Ga0501084_0011448 Ga0501084_0011448_4614_6797 594
20 3300044842 Ga0466957_0005496 Ga0466957_0005496_4685_7000 600
21 3300045049 Ga0466959_0042974 Ga0466959_0042974_786_3101 600
22 3300049741 Ga0501079_0016912 Ga0501079_0016912_1064_3265 600
23 3300032002 Ga0307416_100002165 Ga0307416_10000216510 601
24 3300032126 Ga0307415_100013517 Ga0307415_1000135173 601
25 3300045976 Ga0466967_0025016 Ga0466967_0025016_1967_4276 601
26 3300048909 Ga0496106_0010212 Ga0496106_0010212_4465_6657 602
27 3300048910 Ga0496107_0002732 Ga0496107_0002732_7456_9648 602
28 3300037466 Ga0395898_0011341 Ga0395898_0011341_4260_6398 603
29 3300048905 Ga0496102_0082950 Ga0496102_0082950_913_2940 603
30 3300046511 Ga0495608_0038080 Ga0495608_0038080_18_2318 605
31 3300049574 Ga0501038_0053924 Ga0501038_0053924_469_2661 605
32 3300047319 Ga0495674_0010972 Ga0495674_0010972_3486_5678 607
33 3300048915 Ga0496112_0001552 Ga0496112_0001552_4718_6952 607
34 3300053085 Ga0495619_0011342 Ga0495619_0011342_845_3037 607
35 3300049742 Ga0501080_0069332 Ga0501080_0069332_1109_3262 608
36 3300046517 Ga0495630_0007394 Ga0495630_0007394_1106_3391 609
37 3300046533 Ga0495640_0014354 Ga0495640_0014354_1940_4225 609
38 3300046681 Ga0495647_0009274 Ga0495647_0009274_894_3179 609
39 3300046689 Ga0495613_0008070 Ga0495613_0008070_2697_4982 609
40 3300047319 Ga0495674_0036793 Ga0495674_0036793_1941_4226 609
41 3300047322 Ga0495680_0024955 Ga0495680_0024955_72_2357 609
42 3300048914 Ga0496111_0049274 Ga0496111_0049274_571_2730 609
43 3300005458 Ga0070681_10111171 Ga0070681_101111712 610
44 3300049576 Ga0501040_0018718 Ga0501040_0018718_1809_4022 611
45 3300049582 Ga0501048_0036146 Ga0501048_0036146_1194_3407 611
46 3300049587 Ga0501071_0002739 Ga0501071_0002739_3713_5926 611
47 3300049591 Ga0501075_0016535 Ga0501075_0016535_2055_4268 611
48 3300049592 Ga0501076_0018749 Ga0501076_0018749_1179_3392 611
49 3300049593 Ga0501077_0018563 Ga0501077_0018563_257_2470 611
50 3300054114 Ga0501084_0016626 Ga0501084_0016626_2114_4327 611
51 3300060353 Ga0501082_0024391 Ga0501082_0024391_447_2660 611
52 3300049572 Ga0501036_0032247 Ga0501036_0032247_2080_4293 612
53 3300049573 Ga0501037_0010542 Ga0501037_0010542_1548_3758 612
54 3300049574 Ga0501038_0034228 Ga0501038_0034228_1145_3355 612
55 3300049575 Ga0501039_0028199 Ga0501039_0028199_1218_3428 612
56 3300049576 Ga0501040_0002160 Ga0501040_0002160_9682_11892 612
57 3300049578 Ga0501042_0005142 Ga0501042_0005142_2285_4495 612
58 3300049588 Ga0501072_0013343 Ga0501072_0013343_3028_5238 612
59 3300049590 Ga0501074_0006380 Ga0501074_0006380_3002_5212 612
60 3300049593 Ga0501077_0000973 Ga0501077_0000973_2392_4602 612
61 3300049824 Ga0501045_0001798 Ga0501045_0001798_9715_11925 612
62 3300054114 Ga0501084_0017787 Ga0501084_0017787_3642_5852 612
63 3300061734 Ga0530510_0004573 Ga0530510_0004573_5874_8084 612
64 3300005435 Ga0070714_100015222 Ga0070714_1000152226 615
65 3300006028 Ga0070717_10016162 Ga0070717_100161623 615
66 3300046690 Ga0495624_0015216 Ga0495624_0015216_1256_3565 617
67 3300005985 Ga0081539_10015440 Ga0081539_100154402 619
68 3300049568 Ga0501031_0010671 Ga0501031_0010671_1074_3287 619
69 3300005719 Ga0068861_100083983 Ga0068861_1000839832 623
70 3300009098 Ga0105245_10012378 Ga0105245_100123786 623
71 3300013307 Ga0157372_10135790 Ga0157372_101357902 623
72 3300025933 Ga0207706_10024807 Ga0207706_100248074 623
73 3300026023 Ga0207677_10023274 Ga0207677_100232744 623
74 3300045836 Ga0466958_0009304 Ga0466958_0009304_1706_4012 623
75 3300048907 Ga0496104_0009467 Ga0496104_0009467_1160_3418 623
76 3300048908 Ga0496105_0000705 Ga0496105_0000705_8926_11184 623
77 3300048911 Ga0496108_0029455 Ga0496108_0029455_1579_3837 623
78 3300048914 Ga0496111_0016612 Ga0496111_0016612_1697_3955 623
79 3300048915 Ga0496112_0030423 Ga0496112_0030423_1624_3882 623
80 3300005563 Ga0068855_100036908 Ga0068855_1000369082 624
81 3300005344 Ga0070661_100053606 Ga0070661_1000536062 625
82 3300020070 Ga0206356_10456611 Ga0206356_104566112 625
83 3300025919 Ga0207657_10010546 Ga0207657_100105463 625
84 3300026142 Ga0207698_10092688 Ga0207698_100926882 625
85 3300038443 Ga0395901_0043161 Ga0395901_0043161_1956_4223 627
86 3300005981 Ga0081538_10026144 Ga0081538_100261443 628
87 3300006852 Ga0075433_10026150 Ga0075433_100261502 628
88 3300006871 Ga0075434_100006545 Ga0075434_1000065456 628
89 3300037312 Ga0395899_0018013 Ga0395899_0018013_45_2312 628
90 3300050515 nmdc:mga0a205_4173_c1 nmdc:mga0a205_4173_c1_6806_9052 628
91 3300037418 Ga0395900_0007753 Ga0395900_0007753_3801_6068 629
92 3300037466 Ga0395898_0014409 Ga0395898_0014409_5005_7272 629
93 3300048918 Ga0496115_0005373 Ga0496115_0005373_3777_6020 629
94 3300005437 Ga0070710_10008830 Ga0070710_100088302 631
95 3300005614 Ga0068856_100006515 Ga0068856_10000651511 631
96 3300006914 Ga0075436_100026414 Ga0075436_1000264142 631
97 3300025915 Ga0207693_10010248 Ga0207693_100102483 631
98 3300050512 nmdc:mga0n895_38763_c1 nmdc:mga0n895_38763_c1_634_2841 631
99 3300044693 Ga0466961_0001130 Ga0466961_0001130_882_3185 632
100 3300045049 Ga0466959_0000579 Ga0466959_0000579_5500_7803 632
101 3300048910 Ga0496107_0054765 Ga0496107_0054765_70_2337 632
102 3300049568 Ga0501031_0002166 Ga0501031_0002166_841_3132 632
103 3300049570 Ga0501033_0001810 Ga0501033_0001810_924_3215 632
104 3300049574 Ga0501038_0046089 Ga0501038_0046089_129_2420 632
105 3300049579 Ga0501043_0003871 Ga0501043_0003871_561_2852 632
106 3300049584 Ga0501068_0002625 Ga0501068_0002625_6385_8676 632
107 3300049823 Ga0501044_0047735 Ga0501044_0047735_862_3153 632
108 3300005981 Ga0081538_10014935 Ga0081538_100149355 634
109 3300044694 Ga0466963_0012009 Ga0466963_0012009_587_2890 634
110 3300045976 Ga0466967_0030354 Ga0466967_0030354_1712_4009 634
111 3300047317 Ga0495604_0027114 Ga0495604_0027114_1380_3680 635
112 3300005468 Ga0070707_100018998 Ga0070707_1000189982 636
113 3300026067 Ga0207678_10010343 Ga0207678_100103435 636
114 3300005455 Ga0070663_100044515 Ga0070663_1000445152 637
115 3300005471 Ga0070698_100010868 Ga0070698_1000108685 637
116 3300006173 Ga0070716_100040150 Ga0070716_1000401501 637
117 3300025906 Ga0207699_10041518 Ga0207699_100415182 637
118 3300044706 Ga0466964_0001028 Ga0466964_0001028_1957_4200 637
119 3300045976 Ga0466967_0015502 Ga0466967_0015502_1914_4157 637
120 3300049568 Ga0501031_0002104 Ga0501031_0002104_4699_6846 637
121 3300049571 Ga0501034_0070291 Ga0501034_0070291_1133_3280 637
122 3300049574 Ga0501038_0001738 Ga0501038_0001738_5679_7826 637
123 3300049576 Ga0501040_0055406 Ga0501040_0055406_282_2429 637
124 3300049584 Ga0501068_0013383 Ga0501068_0013383_276_2423 637
125 3300049586 Ga0501070_0010797 Ga0501070_0010797_149_2296 637
126 3300049588 Ga0501072_0042855 Ga0501072_0042855_139_2286 637
127 3300049590 Ga0501074_0037179 Ga0501074_0037179_140_2287 637
128 3300049591 Ga0501075_0005898 Ga0501075_0005898_1046_3193 637
129 3300049823 Ga0501044_0023145 Ga0501044_0023145_501_2648 637
130 3300025915 Ga0207693_10015003 Ga0207693_100150039 638
131 3300005336 Ga0070680_100031846 Ga0070680_1000318462 639
132 3300005434 Ga0070709_10013230 Ga0070709_100132302 639
133 3300005436 Ga0070713_100005933 Ga0070713_1000059332 639
134 3300025919 Ga0207657_10017685 Ga0207657_100176854 639
135 3300025928 Ga0207700_10000006 Ga0207700_10000006238 639
136 3300025939 Ga0207665_10004558 Ga0207665_100045589 639
137 3300007076 Ga0075435_100007426 Ga0075435_1000074263 641
138 3300025939 Ga0207665_10004275 Ga0207665_100042758 641
139 3300031995 Ga0307409_100029860 Ga0307409_1000298602 641
140 3300050512 nmdc:mga0n895_106661_c1 nmdc:mga0n895_106661_c1_86_2344 641
141 3300005458 Ga0070681_10061639 Ga0070681_100616392 642
142 3300005518 Ga0070699_100082263 Ga0070699_1000822632 642
143 3300009094 Ga0111539_10009951 Ga0111539_100099513 643
144 3300005471 Ga0070698_100027034 Ga0070698_1000270343 644
145 3300005563 Ga0068855_100016388 Ga0068855_1000163886 644
146 3300037312 Ga0395899_0032146 Ga0395899_0032146_194_2452 645
147 3300037418 Ga0395900_0003631 Ga0395900_0003631_7563_9821 645
148 3300037466 Ga0395898_0001851 Ga0395898_0001851_22051_24309 645
149 3300037471 Ga0395905_0004039 Ga0395905_0004039_7663_9921 645
150 3300038443 Ga0395901_0001425 Ga0395901_0001425_15819_18077 645
151 3300048912 Ga0496109_0078603 Ga0496109_0078603_530_2806 645
152 3300005937 Ga0081455_10004258 Ga0081455_100042589 646
153 3300041406 Ga0439439_0002455 Ga0439439_0002455_1585_3747 646
154 3300045051 Ga0451576_0009765 Ga0451576_0009765_31_2286 646
155 3300046559 Ga0495667_0045118 Ga0495667_0045118_208_2511 646
156 3300050515 nmdc:mga0a205_31665_c1 nmdc:mga0a205_31665_c1_1769_4006 646
157 3300048916 Ga0496113_0031544 Ga0496113_0031544_551_2788 647
158 3300042122 Ga0450920_002547 Ga0450920_002547_276_2483 649
159 3300005434 Ga0070709_10003184 Ga0070709_100031843 650
160 3300005436 Ga0070713_100020617 Ga0070713_1000206173 650
161 3300006028 Ga0070717_10028303 Ga0070717_100283033 650
162 3300006358 Ga0068871_100018185 Ga0068871_1000181853 650
163 3300006871 Ga0075434_100041379 Ga0075434_1000413793 650
164 3300014969 Ga0157376_10004722 Ga0157376_100047227 650
165 3300025905 Ga0207685_10001983 Ga0207685_100019833 650
166 3300025915 Ga0207693_10010088 Ga0207693_100100883 650
167 3300025916 Ga0207663_10036596 Ga0207663_100365962 650
168 3300025929 Ga0207664_10011573 Ga0207664_100115733 650
169 3300025939 Ga0207665_10001319 Ga0207665_100013192 650
170 3300048912 Ga0496109_0087038 Ga0496109_0087038_551_2788 650
171 3300005435 Ga0070714_100021822 Ga0070714_1000218224 652
172 3300005549 Ga0070704_100012359 Ga0070704_1000123593 652
173 3300025929 Ga0207664_10003007 Ga0207664_100030078 652
174 3300048904 Ga0496101_0062188 Ga0496101_0062188_478_2679 652
175 3300005981 Ga0081538_10001522 Ga0081538_100015223 653
176 3300005983 Ga0081540_1011085 Ga0081540_10110853 653
177 3300035090 Ga0373949_0001938 Ga0373949_0001938_2496_4733 653
178 3300035114 Ga0373939_0003511 Ga0373939_0003511_1145_3382 653
179 3300009094 Ga0111539_10003521 Ga0111539_1000352118 654
180 3300048914 Ga0496111_0000238 Ga0496111_0000238_23295_25574 654
181 3300006175 Ga0070712_100005466 Ga0070712_1000054667 655
182 3300025915 Ga0207693_10000417 Ga0207693_1000041735 656
183 3300005545 Ga0070695_100036995 Ga0070695_1000369952 657
184 3300005937 Ga0081455_10007410 Ga0081455_100074106 657
185 3300005981 Ga0081538_10000057 Ga0081538_1000005772 657
186 3300006844 Ga0075428_100000374 Ga0075428_10000037432 657
187 3300009147 Ga0114129_10014549 Ga0114129_100145492 657
188 3300048903 Ga0496100_0024288 Ga0496100_0024288_103_2361 658
189 3300031731 Ga0307405_10022723 Ga0307405_100227232 659
190 3300031824 Ga0307413_10001651 Ga0307413_100016517 659
191 3300031901 Ga0307406_10003782 Ga0307406_100037824 659
192 3300031911 Ga0307412_10002177 Ga0307412_1000217710 659
193 3300031995 Ga0307409_100002133 Ga0307409_1000021335 659
194 3300032002 Ga0307416_100005708 Ga0307416_1000057088 659
195 3300037312 Ga0395899_0004794 Ga0395899_0004794_7077_9314 659
196 3300038443 Ga0395901_0007447 Ga0395901_0007447_2345_4582 659
197 3300050507 nmdc:mga05p37_10213_c1 nmdc:mga05p37_10213_c1_750_2915 659
198 3300037466 Ga0395898_0005363 Ga0395898_0005363_3185_5500 660
199 3300038443 Ga0395901_0024740 Ga0395901_0024740_2436_4751 660
200 3300049583 Ga0501067_0003649 Ga0501067_0003649_838_3120 660
201 3300049584 Ga0501068_0009076 Ga0501068_0009076_943_3225 660
202 3300005842 Ga0068858_100065919 Ga0068858_1000659192 661
203 3300025922 Ga0207646_10051716 Ga0207646_100517163 661
204 3300026035 Ga0207703_10046200 Ga0207703_100462002 661
205 3300038443 Ga0395901_0082464 Ga0395901_0082464_593_2878 662
206 3300042005 Ga0439448_0007575 Ga0439448_0007575_447_2711 662
207 3300005436 Ga0070713_100019288 Ga0070713_1000192884 663
208 3300005983 Ga0081540_1001396 Ga0081540_100139623 664
209 3300025939 Ga0207665_10010515 Ga0207665_100105155 664
210 3300026121 Ga0207683_10039149 Ga0207683_100391492 664
211 3300005338 Ga0068868_100051385 Ga0068868_1000513852 665
212 3300014745 Ga0157377_10014843 Ga0157377_100148432 665
213 3300005545 Ga0070695_100012956 Ga0070695_1000129563 666
214 3300006914 Ga0075436_100020052 Ga0075436_1000200522 666
215 3300009147 Ga0114129_10054005 Ga0114129_100540055 666
216 3300050507 nmdc:mga05p37_155420_c1 nmdc:mga05p37_155420_c1_132_2447 666
217 3300050514 nmdc:mga08x19_21855_c1 nmdc:mga08x19_21855_c1_1618_3933 666
218 3300027907 Ga0207428_10051499 Ga0207428_100514992 667
219 3300048914 Ga0496111_0029268 Ga0496111_0029268_1191_3452 668
220 3300007076 Ga0075435_100005410 Ga0075435_1000054109 669
221 3300048904 Ga0496101_0078002 Ga0496101_0078002_127_2385 669
222 3300048907 Ga0496104_0016981 Ga0496104_0016981_540_2798 669
223 3300048909 Ga0496106_0021406 Ga0496106_0021406_348_2606 669
224 3300048910 Ga0496107_0038969 Ga0496107_0038969_464_2722 669
225 3300048911 Ga0496108_0010896 Ga0496108_0010896_1297_3555 669
226 3300048913 Ga0496110_0005683 Ga0496110_0005683_127_2385 669
227 3300048914 Ga0496111_0002075 Ga0496111_0002075_1598_3856 669
228 3300048915 Ga0496112_0014630 Ga0496112_0014630_2257_4515 669
229 3300048916 Ga0496113_0001819 Ga0496113_0001819_1793_4051 669
230 3300005544 Ga0070686_100040663 Ga0070686_1000406632 670
231 3300005981 Ga0081538_10021533 Ga0081538_100215332 670
232 3300005985 Ga0081539_10005546 Ga0081539_100055462 670
233 3300009098 Ga0105245_10045847 Ga0105245_100458472 670
234 3300009553 Ga0105249_10017488 Ga0105249_100174884 670
235 3300013306 Ga0163162_10090059 Ga0163162_100900592 670
236 3300025885 Ga0207653_10011108 Ga0207653_100111082 670
237 3300025933 Ga0207706_10046832 Ga0207706_100468324 670
238 3300026075 Ga0207708_10025060 Ga0207708_100250605 670
239 3300005339 Ga0070660_100053754 Ga0070660_1000537542 671
240 3300005458 Ga0070681_10021802 Ga0070681_100218023 671
241 3300006844 Ga0075428_100157700 Ga0075428_1001577001 671
242 3300009174 Ga0105241_10052450 Ga0105241_100524503 671
243 3300025915 Ga0207693_10008441 Ga0207693_100084417 671
244 3300050491 nmdc:mga00v17_38829_c1 nmdc:mga00v17_38829_c1_488_2785 671
245 3300005937 Ga0081455_10008732 Ga0081455_100087323 672
246 3300035170 Ga0373943_0011501 Ga0373943_0011501_1335_3593 672
247 3300035725 Ga0373947_0029070 Ga0373947_0029070_544_2802 672
248 3300037312 Ga0395899_0064502 Ga0395899_0064502_171_2411 672
249 3300037418 Ga0395900_0048839 Ga0395900_0048839_1821_4061 672
250 3300046455 Ga0495603_0002966 Ga0495603_0002966_7054_9312 672
251 3300046461 Ga0495641_0007685 Ga0495641_0007685_2152_4410 672
252 3300046473 Ga0495582_0015210 Ga0495582_0015210_204_2462 672
253 3300046499 Ga0495594_0036658 Ga0495594_0036658_397_2655 672
254 3300046674 Ga0495588_0023512 Ga0495588_0023512_329_2587 672
255 3300005937 Ga0081455_10017206 Ga0081455_100172064 673
256 3300026118 Ga0207675_100011844 Ga0207675_1000118445 673
257 3300048913 Ga0496110_0032787 Ga0496110_0032787_2171_4435 673
258 3300005546 Ga0070696_100038424 Ga0070696_1000384241 675
259 3300025933 Ga0207706_10006862 Ga0207706_100068629 675
260 3300026023 Ga0207677_10010513 Ga0207677_100105133 675
261 3300026075 Ga0207708_10016596 Ga0207708_100165963 675
262 3300026089 Ga0207648_10016194 Ga0207648_100161943 675
263 3300038443 Ga0395901_0124701 Ga0395901_0124701_295_2577 676
264 3300006844 Ga0075428_100127625 Ga0075428_1001276252 677
265 3300046461 Ga0495641_0005756 Ga0495641_0005756_57_2213 677
266 3300005983 Ga0081540_1013265 Ga0081540_10132652 678
267 3300009176 Ga0105242_10097365 Ga0105242_100973652 680
268 3300017792 Ga0163161_10015833 Ga0163161_100158332 682
269 3300037418 Ga0395900_0054115 Ga0395900_0054115_465_2705 683
270 3300038443 Ga0395901_0041831 Ga0395901_0041831_674_2914 683
271 3300005471 Ga0070698_100025914 Ga0070698_1000259143 684
272 3300005719 Ga0068861_100003224 Ga0068861_10000322410 684
273 3300026118 Ga0207675_100002156 Ga0207675_10000215611 684
274 3300005436 Ga0070713_100033831 Ga0070713_1000338312 686
275 3300006028 Ga0070717_10038509 Ga0070717_100385093 686
276 3300048907 Ga0496104_0001575 Ga0496104_0001575_7191_9452 686
277 3300048908 Ga0496105_0001189 Ga0496105_0001189_7092_9353 686
278 3300048911 Ga0496108_0006577 Ga0496108_0006577_5710_7971 686
279 3300048912 Ga0496109_0007519 Ga0496109_0007519_5382_7643 686
280 3300048913 Ga0496110_0000833 Ga0496110_0000833_12051_14312 686
281 3300048914 Ga0496111_0000437 Ga0496111_0000437_2524_4785 686
282 3300048915 Ga0496112_0001299 Ga0496112_0001299_14198_16459 686
283 3300048916 Ga0496113_0000174 Ga0496113_0000174_17936_20197 686
284 3300048918 Ga0496115_0010212 Ga0496115_0010212_343_2604 686
285 3300037312 Ga0395899_0002358 Ga0395899_0002358_9515_11806 687
286 3300037418 Ga0395900_0012678 Ga0395900_0012678_3855_6146 687
287 3300037466 Ga0395898_0007080 Ga0395898_0007080_8215_10506 687
288 3300037471 Ga0395905_0011109 Ga0395905_0011109_6374_8665 687
289 3300038443 Ga0395901_0005245 Ga0395901_0005245_6940_9231 687
290 3300009098 Ga0105245_10024631 Ga0105245_100246313 690
291 3300026075 Ga0207708_10081345 Ga0207708_100813451 690
292 3300037418 Ga0395900_0006420 Ga0395900_0006420_2847_5087 693
293 3300037418 Ga0395900_0134535 Ga0395900_0134535_92_2347 693
294 3300037466 Ga0395898_0004517 Ga0395898_0004517_2565_4805 693
295 3300038443 Ga0395901_0019853 Ga0395901_0019853_2173_4413 693
296 3300037312 Ga0395899_0030455 Ga0395899_0030455_139_2382 698
297 3300037418 Ga0395900_0037304 Ga0395900_0037304_1285_3528 698
298 3300046475 Ga0495639_0009477 Ga0495639_0009477_196_2451 703
299 3300037312 Ga0395899_0009876 Ga0395899_0009876_4846_7101 711
300 3300005535 Ga0070684_100002170 Ga0070684_1000021709 714
301 3300005329 Ga0070683_100029576 Ga0070683_1000295763 717
302 3300005577 Ga0068857_100010450 Ga0068857_1000104506 717
303 3300026116 Ga0207674_10004135 Ga0207674_100041354 717

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01841

Transglut_core

Transglutaminase-like superfamily

436

555

0.88

PF11992

TgpA_N

TgpA N-terminal domain

250

376

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g49-assembly1.cif.gz_A crystal structure of the periplasmic domain of tgpa from pseudomonas aeruginosa 0.7878 238 545
6g4h-assembly1.cif.gz_A crystal structure of the periplasmic domain of tgpa from pseudomonas aeruginosa bound to ethylmercury 0.7109 234 545
6g49-assembly1.cif.gz_A crystal structure of the periplasmic domain of tgpa from pseudomonas aeruginosa 0.7009 238 545
6g4h-assembly1.cif.gz_A crystal structure of the periplasmic domain of tgpa from pseudomonas aeruginosa bound to ethylmercury 0.6837 234 545
1kv3-assembly3.cif.gz_E human tissue transglutaminase in gdp bound form 0.6744 443 547
ID Description Score Start End Superfamily
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8108 426 546 3.10.620.30
af_Q54IX2_591_772_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7792 441 546 3.10.620.30
af_Q54IX2_1026_1205_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6952 415 546 3.10.620.30
af_Q556I6_323_487_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6795 415 546 3.10.620.30
af_Q54U55_1_62_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.6158 10 61 3.30.160.60
ID Description Score Start End GO Terms
AF-A0A3D1ZB82-F1-model_v4 Transglutaminase-like domain-containing protein 0.9069 446 547
AF-A0A7C4KJP7-F1-model_v4 DUF4129 domain-containing protein 0.8589 252 548 GO:0016020
AF-A0A1Q7UUV3-F1-model_v4 Transglutaminase-like domain-containing protein 0.8403 286 547
AF-A0A3B9YEJ0-F1-model_v4 Transglutaminase-like domain-containing protein 0.8349 228 548
AF-A0A1Q7UUV3-F1-model_v4 Transglutaminase-like domain-containing protein 0.7504 286 547

Feature Viewer

pLDDT pTM Quality
78.47 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map