F397164
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 197 | 606 | 428 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0196619|Ga0436361_0196619_11049_12365 |
| Length | 438 |
| Sequence | MTGQPLAFIGARLVDPETGYDGPGSLLTADGCIARVSRGDTLPGLPGDARVIDAVGALLCPGLIDLRVKTGEPGSEPKETLKSASRAAXXXGVTSIVVMPDTDPPVDEPSVVDFVLRRARDIELVHVYPAGAATRGLEGKALAEIGLMREAGCVFVTDADRPIVDSRVMRRLLAYAGGLGVLVAHRPADPWLTAGAAASEGEFAGRMGLPSEPPAAETIMLERDLALLELTAPTGARLMVDQVSAEGALETLRKSKDRGLPVIATASINHLTFNELDIGDYRTFWKLTPPLRGEADRAALVDAVASGLIDIIVSAHAPAPAEDKRLPFEEATPGSVGLETLLPALLTLWHEGQAPLLRLLETVTLAPARAIGSEAGRLAVGAPADLILCDIDAPRIIDANLLLSKSKNSAFDGRRLQGRVLMTVVDGRIVWEASAGAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 23 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 27 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 30 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 31 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 33 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 38 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 40 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 41 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 42 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 43 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 45 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 46 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 47 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 50 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 78 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 79 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 80 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 81 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 83 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 84 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 85 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 87 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 88 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 89 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 90 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 91 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 92 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 93 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 94 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 95 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 96 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 97 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 98 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 99 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 100 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 101 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 102 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 103 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 104 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 105 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 106 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 107 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 108 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 109 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 140 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 142 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 143 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 144 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 145 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 146 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 147 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 148 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 155 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 156 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 157 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 158 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 159 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 160 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 161 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 162 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 163 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 164 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 165 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 166 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 167 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 168 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 169 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 170 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 171 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 172 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 173 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 174 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 175 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 176 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 177 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 178 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 179 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 180 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 181 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 182 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 183 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 184 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 185 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 186 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 187 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 188 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 189 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 190 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 191 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 192 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 193 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 194 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 195 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 196 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 197 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.72 |
| Metatranscriptomes | 0 |
| Isolates | 5.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.09 |
| Nodule | 0.33 |
| Rhizoplane | 2.64 |
| Rhizosphere | 63.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436361_0196619 | 3300039447 | Bacteria | 31824 |
| 2 | rootH1_10134748 | 3300003316 | Bacteria | 1502 |
| 3 | Ga0055537_1002099 | 3300003773 | Bacteria | 7002 |
| 4 | Ga0055524_1003351 | 3300003775 | Bacteria | 7805 |
| 5 | Ga0055536_1003932 | 3300003781 | Bacteria | 7790 |
| 6 | Ga0055531_10005501 | 3300003794 | Bacteria | 7406 |
| 7 | Ga0055543_1010772 | 3300004625 | Bacteria | 1903 |
| 8 | Ga0065165_1000210 | 3300005262 | Bacteria | 101721 |
| 9 | Ga0065165_1001578 | 3300005262 | Bacteria | 23475 |
| 10 | Ga0065165_1038780 | 3300005262 | Bacteria | 1433 |
| 11 | Ga0070658_10072886 | 3300005327 | Bacteria | 2815 |
| 12 | Ga0070670_100000062 | 3300005331 | Bacteria | 112560 |
| 13 | Ga0070666_10167414 | 3300005335 | Bacteria | 1538 |
| 14 | Ga0070680_100015686 | 3300005336 | Bacteria | 5946 |
| 15 | Ga0070680_100084231 | 3300005336 | Bacteria | 2626 |
| 16 | Ga0070691_10035892 | 3300005341 | Bacteria | 2335 |
| 17 | Ga0070661_100105569 | 3300005344 | Bacteria | 2100 |
| 18 | Ga0070668_100000121 | 3300005347 | Bacteria | 48221 |
| 19 | Ga0070668_100006461 | 3300005347 | Bacteria | 8690 |
| 20 | Ga0070673_100062229 | 3300005364 | Bacteria | 2964 |
| 21 | Ga0070667_100000178 | 3300005367 | Bacteria | 77450 |
| 22 | Ga0070667_100100897 | 3300005367 | Bacteria | 2493 |
| 23 | Ga0070681_10053310 | 3300005458 | Bacteria | 4030 |
| 24 | Ga0070681_10060097 | 3300005458 | Bacteria | 3779 |
| 25 | Ga0068853_100050026 | 3300005539 | Bacteria | 3594 |
| 26 | Ga0068853_100053747 | 3300005539 | Bacteria | 3469 |
| 27 | Ga0068853_100053988 | 3300005539 | Bacteria | 3462 |
| 28 | Ga0070665_100000121 | 3300005548 | Bacteria | 147683 |
| 29 | Ga0070665_100002101 | 3300005548 | Bacteria | 22316 |
| 30 | Ga0070665_100218839 | 3300005548 | Bacteria | 1905 |
| 31 | Ga0068855_100037268 | 3300005563 | Bacteria | 5784 |
| 32 | Ga0068855_100037862 | 3300005563 | Bacteria | 5732 |
| 33 | Ga0068855_100225383 | 3300005563 | Bacteria | 2101 |
| 34 | Ga0068859_100218600 | 3300005617 | Bacteria | 1993 |
| 35 | Ga0068864_100000126 | 3300005618 | Bacteria | 74385 |
| 36 | Ga0068864_100002537 | 3300005618 | Bacteria | 15079 |
| 37 | Ga0068864_100080982 | 3300005618 | Bacteria | 2846 |
| 38 | Ga0068863_100000247 | 3300005841 | Bacteria | 57319 |
| 39 | Ga0068863_100000367 | 3300005841 | Bacteria | 45948 |
| 40 | Ga0068863_100075443 | 3300005841 | Bacteria | 3190 |
| 41 | Ga0068858_100000219 | 3300005842 | Bacteria | 61717 |
| 42 | Ga0068858_100069117 | 3300005842 | Bacteria | 3274 |
| 43 | Ga0068860_100000616 | 3300005843 | Bacteria | 42070 |
| 44 | Ga0068862_100000527 | 3300005844 | Bacteria | 40316 |
| 45 | Ga0068862_100016816 | 3300005844 | Bacteria | 6090 |
| 46 | Ga0068862_100174016 | 3300005844 | Bacteria | 1928 |
| 47 | Ga0075364_10003747 | 3300006051 | Bacteria | 8683 |
| 48 | Ga0075369_10005653 | 3300006186 | Bacteria | 4684 |
| 49 | Ga0075369_10012460 | 3300006186 | Bacteria | 3360 |
| 50 | Ga0075366_10031955 | 3300006195 | Bacteria | 3098 |
| 51 | Ga0097620_100218601 | 3300006931 | Bacteria | 1993 |
| 52 | Ga0079104_1023886 | 3300006946 | Bacteria | 1619 |
| 53 | Ga0099795_10028261 | 3300007788 | Bacteria | 1905 |
| 54 | Ga0105240_10000798 | 3300009093 | Bacteria | 57073 |
| 55 | Ga0105240_10191821 | 3300009093 | Bacteria | 2402 |
| 56 | Ga0105248_10026494 | 3300009177 | Bacteria | 6450 |
| 57 | Ga0105248_10102090 | 3300009177 | Bacteria | 3233 |
| 58 | Ga0157373_10001230 | 3300013100 | Bacteria | 19573 |
| 59 | Ga0157373_10001673 | 3300013100 | Bacteria | 16931 |
| 60 | Ga0182008_10118296 | 3300014497 | Bacteria | 1316 |
| 61 | Ga0157379_10178166 | 3300014968 | Bacteria | 1920 |
| 62 | Ga0183365_10005 | 3300015684 | Bacteria | 249619 |
| 63 | Ga0213876_10000414 | 3300021384 | Bacteria | 35795 |
| 64 | Ga0213876_10052716 | 3300021384 | Bacteria | 2150 |
| 65 | Ga0209026_1001009 | 3300025250 | Bacteria | 13901 |
| 66 | Ga0209565_1000469 | 3300025263 | Bacteria | 30315 |
| 67 | Ga0209673_1002952 | 3300025273 | Bacteria | 10658 |
| 68 | Ga0209675_1014545 | 3300025291 | Bacteria | 2390 |
| 69 | Ga0209676_1000691 | 3300025292 | Bacteria | 47509 |
| 70 | Ga0209676_1001269 | 3300025292 | Bacteria | 26245 |
| 71 | Ga0209676_1001404 | 3300025292 | Bacteria | 23284 |
| 72 | Ga0209564_1017573 | 3300025295 | Bacteria | 2779 |
| 73 | Ga0209564_1024340 | 3300025295 | Bacteria | 2072 |
| 74 | Ga0209564_1031379 | 3300025295 | Bacteria | 1624 |
| 75 | Ga0209758_1001228 | 3300025297 | Bacteria | 32082 |
| 76 | Ga0209758_1001292 | 3300025297 | Bacteria | 30782 |
| 77 | Ga0209050_1000101 | 3300025298 | Bacteria | 230076 |
| 78 | Ga0209050_1001227 | 3300025298 | Bacteria | 29766 |
| 79 | Ga0209050_1001896 | 3300025298 | Bacteria | 20030 |
| 80 | Ga0209256_1001791 | 3300025299 | Bacteria | 20307 |
| 81 | Ga0209256_1001906 | 3300025299 | Bacteria | 19078 |
| 82 | Ga0209257_1000187 | 3300025304 | Bacteria | 154077 |
| 83 | Ga0209257_1001165 | 3300025304 | Bacteria | 33428 |
| 84 | Ga0209257_1001622 | 3300025304 | Bacteria | 25777 |
| 85 | Ga0209257_1002808 | 3300025304 | Bacteria | 16367 |
| 86 | Ga0209257_1005810 | 3300025304 | Bacteria | 8381 |
| 87 | Ga0207680_10035696 | 3300025903 | Bacteria | 2857 |
| 88 | Ga0207705_10006230 | 3300025909 | Bacteria | 8861 |
| 89 | Ga0207654_10046911 | 3300025911 | Bacteria | 2466 |
| 90 | Ga0207707_10216038 | 3300025912 | Bacteria | 1669 |
| 91 | Ga0207695_10001328 | 3300025913 | Bacteria | 41985 |
| 92 | Ga0207695_10002756 | 3300025913 | Bacteria | 25626 |
| 93 | Ga0207695_10018744 | 3300025913 | Bacteria | 7990 |
| 94 | Ga0207695_10019731 | 3300025913 | Bacteria | 7750 |
| 95 | Ga0207695_10027497 | 3300025913 | Bacteria | 6332 |
| 96 | Ga0207695_10173085 | 3300025913 | Bacteria | 2083 |
| 97 | Ga0207660_10006120 | 3300025917 | Bacteria | 7810 |
| 98 | Ga0207660_10060319 | 3300025917 | Bacteria | 2726 |
| 99 | Ga0207657_10027394 | 3300025919 | Bacteria | 5220 |
| 100 | Ga0207652_10013308 | 3300025921 | Bacteria | 6662 |
| 101 | Ga0207650_10000084 | 3300025925 | Bacteria | 125773 |
| 102 | Ga0207644_10007416 | 3300025931 | Bacteria | 7150 |
| 103 | Ga0207706_10053115 | 3300025933 | Bacteria | 3577 |
| 104 | Ga0207711_10000482 | 3300025941 | Bacteria | 41192 |
| 105 | Ga0207711_10007977 | 3300025941 | Bacteria | 8857 |
| 106 | Ga0207689_10190810 | 3300025942 | Bacteria | 1690 |
| 107 | Ga0207679_10136527 | 3300025945 | Bacteria | 1976 |
| 108 | Ga0207667_10012364 | 3300025949 | Bacteria | 9840 |
| 109 | Ga0207651_10001555 | 3300025960 | Bacteria | 10492 |
| 110 | Ga0207712_10000554 | 3300025961 | Bacteria | 30188 |
| 111 | Ga0207712_10123776 | 3300025961 | Bacteria | 1960 |
| 112 | Ga0207668_10000032 | 3300025972 | Bacteria | 122020 |
| 113 | Ga0207668_10000036 | 3300025972 | Bacteria | 117190 |
| 114 | Ga0207658_10002743 | 3300025986 | Bacteria | 12715 |
| 115 | Ga0207658_10008046 | 3300025986 | Bacteria | 7184 |
| 116 | Ga0207703_10000675 | 3300026035 | Bacteria | 34030 |
| 117 | Ga0207703_10007777 | 3300026035 | Bacteria | 8484 |
| 118 | Ga0207639_10005882 | 3300026041 | Bacteria | 8314 |
| 119 | Ga0207641_10000070 | 3300026088 | Bacteria | 152598 |
| 120 | Ga0207641_10000913 | 3300026088 | Bacteria | 30529 |
| 121 | Ga0207676_10000102 | 3300026095 | Bacteria | 77065 |
| 122 | Ga0207676_10001282 | 3300026095 | Bacteria | 18690 |
| 123 | Ga0207676_10002766 | 3300026095 | Bacteria | 12477 |
| 124 | Ga0268266_10000106 | 3300028379 | Bacteria | 175109 |
| 125 | Ga0268266_10001096 | 3300028379 | Bacteria | 33990 |
| 126 | Ga0268266_10003600 | 3300028379 | Bacteria | 15326 |
| 127 | Ga0268266_10131664 | 3300028379 | Bacteria | 2237 |
| 128 | Ga0268265_10018789 | 3300028380 | Bacteria | 4795 |
| 129 | Ga0268265_10054113 | 3300028380 | Bacteria | 3043 |
| 130 | Ga0268264_10000284 | 3300028381 | Bacteria | 85451 |
| 131 | Ga0265326_10014705 | 3300028558 | Bacteria | 2279 |
| 132 | Ga0265334_10016031 | 3300028573 | Bacteria | 3103 |
| 133 | Ga0307517_10013329 | 3300028786 | Bacteria | 11177 |
| 134 | Ga0307517_10024176 | 3300028786 | Bacteria | 7507 |
| 135 | Ga0307515_10053259 | 3300028794 | Bacteria | 5976 |
| 136 | Ga0307515_10120350 | 3300028794 | Bacteria | 2979 |
| 137 | Ga0265338_10018992 | 3300028800 | Bacteria | 7324 |
| 138 | Ga0265338_10023212 | 3300028800 | Bacteria | 6387 |
| 139 | Ga0265338_10024385 | 3300028800 | Bacteria | 6180 |
| 140 | Ga0265338_10056378 | 3300028800 | Bacteria | 3485 |
| 141 | Ga0307511_10028566 | 3300030521 | Bacteria | 5059 |
| 142 | Ga0265327_10000166 | 3300031251 | Bacteria | 141539 |
| 143 | Ga0265327_10003056 | 3300031251 | Bacteria | 16539 |
| 144 | Ga0265327_10010420 | 3300031251 | Bacteria | 6545 |
| 145 | Ga0307513_10000162 | 3300031456 | Bacteria | 96000 |
| 146 | Ga0307513_10004143 | 3300031456 | Bacteria | 19418 |
| 147 | Ga0307513_10007176 | 3300031456 | Bacteria | 14472 |
| 148 | Ga0265314_10036652 | 3300031711 | Bacteria | 3561 |
| 149 | Ga0307413_10066496 | 3300031824 | Bacteria | 2249 |
| 150 | Ga0307510_10017415 | 3300033180 | Bacteria | 8474 |
| 151 | Ga0373927_0000368 | 3300035695 | Bacteria | 34930 |
| 152 | Ga0373925_0000507 | 3300037068 | Bacteria | 39351 |
| 153 | Ga0395899_0000105 | 3300037312 | Bacteria | 146163 |
| 154 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 155 | Ga0395898_0003798 | 3300037466 | Bacteria | 16721 |
| 156 | Ga0395905_0000346 | 3300037471 | Bacteria | 65961 |
| 157 | Ga0395905_0009782 | 3300037471 | Bacteria | 9347 |
| 158 | Ga0395905_0099683 | 3300037471 | Bacteria | 2728 |
| 159 | Ga0395901_0011668 | 3300038443 | Bacteria | 8900 |
| 160 | Ga0395901_0378616 | 3300038443 | Bacteria | 1457 |
| 161 | Ga0436365_0800829 | 3300039437 | Bacteria | 5337 |
| 162 | Ga0436365_1830840 | 3300039437 | Bacteria | 45078 |
| 163 | Ga0436360_0037000 | 3300039438 | Bacteria | 6687 |
| 164 | Ga0436361_0536408 | 3300039447 | Bacteria | 2523 |
| 165 | Ga0439431_0016450 | 3300041997 | Bacteria | 1731 |
| 166 | Ga0439435_0006251 | 3300042436 | Bacteria | 2669 |
| 167 | Ga0439459_0003618 | 3300042438 | Bacteria | 2464 |
| 168 | Ga0466969_0007448 | 3300044656 | Bacteria | 5814 |
| 169 | Ga0466966_0000050 | 3300044684 | Bacteria | 88948 |
| 170 | Ga0466961_0008018 | 3300044693 | Bacteria | 6730 |
| 171 | Ga0466971_0048526 | 3300044719 | Bacteria | 1909 |
| 172 | Ga0466970_0005184 | 3300044765 | Bacteria | 6443 |
| 173 | Ga0466957_0021409 | 3300044842 | Bacteria | 3809 |
| 174 | Ga0466959_0000565 | 3300045049 | Bacteria | 21544 |
| 175 | Ga0451576_0000707 | 3300045051 | Bacteria | 67610 |
| 176 | Ga0466958_0000741 | 3300045836 | Bacteria | 14286 |
| 177 | Ga0495627_001069 | 3300046453 | Bacteria | 18121 |
| 178 | Ga0495590_0005140 | 3300046457 | Bacteria | 5207 |
| 179 | Ga0495629_0008724 | 3300046459 | Bacteria | 7455 |
| 180 | Ga0495638_0000421 | 3300046460 | Bacteria | 51251 |
| 181 | Ga0495638_0002399 | 3300046460 | Bacteria | 15336 |
| 182 | Ga0495638_0015624 | 3300046460 | Bacteria | 5094 |
| 183 | Ga0495650_0000030 | 3300046471 | Bacteria | 436318 |
| 184 | Ga0495583_0000002 | 3300046506 | Bacteria | 782521 |
| 185 | Ga0495606_0003344 | 3300046507 | Bacteria | 17106 |
| 186 | Ga0495606_0104512 | 3300046507 | Bacteria | 1719 |
| 187 | Ga0495610_0000091 | 3300046512 | Bacteria | 105916 |
| 188 | Ga0495610_0003154 | 3300046512 | Bacteria | 13078 |
| 189 | Ga0495610_0005962 | 3300046512 | Bacteria | 8531 |
| 190 | Ga0495616_0000206 | 3300046513 | Bacteria | 49005 |
| 191 | Ga0495630_0184424 | 3300046517 | Bacteria | 1592 |
| 192 | Ga0495631_0003397 | 3300046518 | Bacteria | 8718 |
| 193 | Ga0495632_0002830 | 3300046519 | Bacteria | 12839 |
| 194 | Ga0495643_0018594 | 3300046522 | Bacteria | 4035 |
| 195 | Ga0495648_0000154 | 3300046524 | Bacteria | 81679 |
| 196 | Ga0495654_0000048 | 3300046530 | Bacteria | 147348 |
| 197 | Ga0495654_0020490 | 3300046530 | Bacteria | 3445 |
| 198 | Ga0495640_0023951 | 3300046533 | Bacteria | 4441 |
| 199 | Ga0495598_0031392 | 3300046537 | Bacteria | 1494 |
| 200 | Ga0495597_0003367 | 3300046542 | Bacteria | 9392 |
| 201 | Ga0495668_0000703 | 3300046616 | Bacteria | 40297 |
| 202 | Ga0495668_0030501 | 3300046616 | Bacteria | 3044 |
| 203 | Ga0495668_0043733 | 3300046616 | Bacteria | 2490 |
| 204 | Ga0495625_0000058 | 3300046660 | Bacteria | 180863 |
| 205 | Ga0495625_0009823 | 3300046660 | Bacteria | 7963 |
| 206 | Ga0495625_0026271 | 3300046660 | Bacteria | 4402 |
| 207 | Ga0495625_0032528 | 3300046660 | Bacteria | 3865 |
| 208 | Ga0495625_0035260 | 3300046660 | Bacteria | 3689 |
| 209 | Ga0495625_0039688 | 3300046660 | Bacteria | 3436 |
| 210 | Ga0495625_0045814 | 3300046660 | Bacteria | 3159 |
| 211 | Ga0495669_0000024 | 3300046684 | Bacteria | 113943 |
| 212 | Ga0495669_0000196 | 3300046684 | Bacteria | 37390 |
| 213 | Ga0495613_0012920 | 3300046689 | Bacteria | 6206 |
| 214 | Ga0495589_0027480 | 3300046794 | Bacteria | 2877 |
| 215 | Ga0495672_0001353 | 3300047320 | Bacteria | 24293 |
| 216 | Ga0495687_032907 | 3300047443 | Bacteria | 2360 |
| 217 | Ga0495677_0006938 | 3300047445 | Bacteria | 4254 |
| 218 | Ga0495673_0000225 | 3300047469 | Bacteria | 83589 |
| 219 | Ga0495673_0001111 | 3300047469 | Bacteria | 23151 |
| 220 | Ga0495673_0016065 | 3300047469 | Bacteria | 3838 |
| 221 | Ga0495686_0000449 | 3300047472 | Bacteria | 62252 |
| 222 | Ga0495686_0006951 | 3300047472 | Bacteria | 8549 |
| 223 | Ga0495686_0027363 | 3300047472 | Bacteria | 3724 |
| 224 | Ga0495686_0081210 | 3300047472 | Bacteria | 1980 |
| 225 | Ga0496102_0020266 | 3300048905 | Bacteria | 5876 |
| 226 | Ga0496102_0029375 | 3300048905 | Bacteria | 4920 |
| 227 | Ga0496106_0032210 | 3300048909 | Bacteria | 3908 |
| 228 | Ga0496107_0000456 | 3300048910 | Bacteria | 22347 |
| 229 | Ga0496109_0011512 | 3300048912 | Bacteria | 7609 |
| 230 | Ga0496110_0132955 | 3300048913 | Bacteria | 2247 |
| 231 | Ga0496115_0002377 | 3300048918 | Bacteria | 13492 |
| 232 | Ga0496115_0003649 | 3300048918 | Bacteria | 11079 |
| 233 | Ga0496117_0009853 | 3300048920 | Bacteria | 8802 |
| 234 | Ga0496118_0005250 | 3300048921 | Bacteria | 14796 |
| 235 | Ga0496121_0010269 | 3300048924 | Bacteria | 10594 |
| 236 | Ga0496121_0014838 | 3300048924 | Bacteria | 8221 |
| 237 | Ga0496124_0029391 | 3300048927 | Bacteria | 4899 |
| 238 | Ga0496126_0018292 | 3300048929 | Bacteria | 6951 |
| 239 | Ga0501033_0011065 | 3300049570 | Bacteria | 6909 |
| 240 | Ga0501034_0084616 | 3300049571 | Bacteria | 3173 |
| 241 | Ga0501034_0281674 | 3300049571 | Bacteria | 1602 |
| 242 | Ga0501034_0337960 | 3300049571 | Bacteria | 1436 |
| 243 | Ga0501037_0031929 | 3300049573 | Bacteria | 3888 |
| 244 | Ga0501047_0030216 | 3300049581 | Bacteria | 5224 |
| 245 | Ga0501035_0065264 | 3300049822 | Bacteria | 3234 |
| 246 | Ga0501044_0006211 | 3300049823 | Bacteria | 13205 |
| 247 | Ga0501044_0097398 | 3300049823 | Bacteria | 2963 |
| 248 | nmdc:mga00v17_2072_c1 | 3300050491 | Bacteria | 10328 |
| 249 | nmdc:mga0k408_33044_c1 | 3300050493 | Bacteria | 2957 |
| 250 | nmdc:mga0k408_56474_c1 | 3300050493 | Bacteria | 2278 |
| 251 | nmdc:mga07m45_46155_c1 | 3300050496 | Bacteria | 2447 |
| 252 | nmdc:mga0sz30_7449_c1 | 3300050516 | Bacteria | 4104 |
| 253 | Ga0500635_0000102 | 3300053080 | Bacteria | 51023 |
| 254 | Ga0500635_0002473 | 3300053080 | Bacteria | 4584 |
| 255 | Ga0500578_0001504 | 3300053086 | Bacteria | 23136 |
| 256 | Ga0500643_000298 | 3300053087 | Bacteria | 41754 |
| 257 | Ga0500643_018639 | 3300053087 | Bacteria | 2299 |
| 258 | Ga0500644_0000340 | 3300053088 | Bacteria | 23717 |
| 259 | Ga0500566_0050357 | 3300053094 | Bacteria | 2385 |
| 260 | Ga0500641_0001060 | 3300053096 | Bacteria | 9810 |
| 261 | Ga0500641_0002309 | 3300053096 | Bacteria | 6758 |
| 262 | Ga0500650_0058249 | 3300053098 | Bacteria | 1802 |
| 263 | Ga0500555_009451 | 3300053103 | Bacteria | 2789 |
| 264 | Ga0500556_0003499 | 3300053104 | Bacteria | 4608 |
| 265 | Ga0500562_000292 | 3300053108 | Bacteria | 12208 |
| 266 | Ga0500562_001375 | 3300053108 | Bacteria | 5990 |
| 267 | Ga0500562_003117 | 3300053108 | Bacteria | 4140 |
| 268 | Ga0500569_001504 | 3300053109 | Bacteria | 4418 |
| 269 | Ga0500572_002159 | 3300053111 | Bacteria | 4843 |
| 270 | Ga0500594_0000137 | 3300053118 | Bacteria | 20341 |
| 271 | Ga0500595_000910 | 3300053119 | Bacteria | 16856 |
| 272 | Ga0500595_005809 | 3300053119 | Bacteria | 5325 |
| 273 | Ga0500608_001112 | 3300053122 | Bacteria | 9584 |
| 274 | Ga0500608_003958 | 3300053122 | Bacteria | 5658 |
| 275 | Ga0500608_006081 | 3300053122 | Bacteria | 4875 |
| 276 | Ga0500559_0000062 | 3300053136 | Bacteria | 87142 |
| 277 | Ga0500559_0004386 | 3300053136 | Bacteria | 6713 |
| 278 | Ga0500559_0041687 | 3300053136 | Bacteria | 2001 |
| 279 | Ga0500577_0000818 | 3300053142 | Bacteria | 8022 |
| 280 | Ga0500590_025817 | 3300053148 | Bacteria | 3051 |
| 281 | Ga0500590_084044 | 3300053148 | Bacteria | 1558 |
| 282 | Ga0500616_0018370 | 3300053153 | Bacteria | 3955 |
| 283 | Ga0500622_0003015 | 3300053156 | Bacteria | 11638 |
| 284 | Ga0500637_0117097 | 3300053178 | Bacteria | 1545 |
| 285 | Ga0500625_002213 | 3300053729 | Bacteria | 7178 |
| 286 | Ga0500645_000851 | 3300053730 | Bacteria | 17875 |
| 287 | Ga0500609_002288 | 3300053731 | Bacteria | 2732 |
| 288 | 2511125030 | 2510917020 | Bacteria | 5657507 |
| 289 | 2585146873 | 2582581279 | Bacteria | 4980720 |
| 290 | 2585151432 | 2582581280 | Bacteria | 5994497 |
| 291 | 2585196146 | 2582581293 | Bacteria | 5907401 |
| 292 | 2587919456 | 2585428106 | Bacteria | 5179711 |
| 293 | 2643749498 | 2643221545 | Bacteria | 5083237 |
| 294 | 2643782285 | 2643221552 | Bacteria | 5708754 |
| 295 | 2643926491 | 2643221583 | Bacteria | 5218014 |
| 296 | 2643928928 | 2643221584 | Bacteria | 5511711 |
| 297 | 2644508454 | 2643221691 | Bacteria | 5093099 |
| 298 | 2739793431 | 2739367756 | Bacteria | 4553612 |
| 299 | 2819536979 | 2818991435 | Bacteria | 5433759 |
| 300 | 2819645391 | 2818991454 | Bacteria | 5563326 |
| 301 | 2884960687 | 2884960567 | Bacteria | 5437054 |
| 302 | 2928534415 | 2928531327 | Bacteria | 5101314 |
| 303 | 3000019850 | 3000017691 | Bacteria | 3772574 |
| 304 | Ga0436361_0196619 | |||
| 305 | rootH1_10134748 | |||
| 306 | Ga0055537_1002099 | |||
| 307 | Ga0055524_1003351 | |||
| 308 | Ga0055536_1003932 | |||
| 309 | Ga0055531_10005501 | |||
| 310 | Ga0055543_1010772 | |||
| 311 | Ga0065165_1000210 | |||
| 312 | Ga0065165_1001578 | |||
| 313 | Ga0065165_1038780 | |||
| 314 | Ga0070658_10072886 | |||
| 315 | Ga0070670_100000062 | |||
| 316 | Ga0070666_10167414 | |||
| 317 | Ga0070680_100015686 | |||
| 318 | Ga0070680_100084231 | |||
| 319 | Ga0070691_10035892 | |||
| 320 | Ga0070661_100105569 | |||
| 321 | Ga0070668_100000121 | |||
| 322 | Ga0070668_100006461 | |||
| 323 | Ga0070673_100062229 | |||
| 324 | Ga0070667_100000178 | |||
| 325 | Ga0070667_100100897 | |||
| 326 | Ga0070681_10053310 | |||
| 327 | Ga0070681_10060097 | |||
| 328 | Ga0068853_100050026 | |||
| 329 | Ga0068853_100053747 | |||
| 330 | Ga0068853_100053988 | |||
| 331 | Ga0070665_100000121 | |||
| 332 | Ga0070665_100002101 | |||
| 333 | Ga0070665_100218839 | |||
| 334 | Ga0068855_100037268 | |||
| 335 | Ga0068855_100037862 | |||
| 336 | Ga0068855_100225383 | |||
| 337 | Ga0068859_100218600 | |||
| 338 | Ga0068864_100000126 | |||
| 339 | Ga0068864_100002537 | |||
| 340 | Ga0068864_100080982 | |||
| 341 | Ga0068863_100000247 | |||
| 342 | Ga0068863_100000367 | |||
| 343 | Ga0068863_100075443 | |||
| 344 | Ga0068858_100000219 | |||
| 345 | Ga0068858_100069117 | |||
| 346 | Ga0068860_100000616 | |||
| 347 | Ga0068862_100000527 | |||
| 348 | Ga0068862_100016816 | |||
| 349 | Ga0068862_100174016 | |||
| 350 | Ga0075364_10003747 | |||
| 351 | Ga0075369_10005653 | |||
| 352 | Ga0075369_10012460 | |||
| 353 | Ga0075366_10031955 | |||
| 354 | Ga0097620_100218601 | |||
| 355 | Ga0079104_1023886 | |||
| 356 | Ga0099795_10028261 | |||
| 357 | Ga0105240_10000798 | |||
| 358 | Ga0105240_10191821 | |||
| 359 | Ga0105248_10026494 | |||
| 360 | Ga0105248_10102090 | |||
| 361 | Ga0157373_10001230 | |||
| 362 | Ga0157373_10001673 | |||
| 363 | Ga0182008_10118296 | |||
| 364 | Ga0157379_10178166 | |||
| 365 | Ga0183365_10005 | |||
| 366 | Ga0213876_10000414 | |||
| 367 | Ga0213876_10052716 | |||
| 368 | Ga0209026_1001009 | |||
| 369 | Ga0209565_1000469 | |||
| 370 | Ga0209673_1002952 | |||
| 371 | Ga0209675_1014545 | |||
| 372 | Ga0209676_1000691 | |||
| 373 | Ga0209676_1001269 | |||
| 374 | Ga0209676_1001404 | |||
| 375 | Ga0209564_1017573 | |||
| 376 | Ga0209564_1024340 | |||
| 377 | Ga0209564_1031379 | |||
| 378 | Ga0209758_1001228 | |||
| 379 | Ga0209758_1001292 | |||
| 380 | Ga0209050_1000101 | |||
| 381 | Ga0209050_1001227 | |||
| 382 | Ga0209050_1001896 | |||
| 383 | Ga0209256_1001791 | |||
| 384 | Ga0209256_1001906 | |||
| 385 | Ga0209257_1000187 | |||
| 386 | Ga0209257_1001165 | |||
| 387 | Ga0209257_1001622 | |||
| 388 | Ga0209257_1002808 | |||
| 389 | Ga0209257_1005810 | |||
| 390 | Ga0207680_10035696 | |||
| 391 | Ga0207705_10006230 | |||
| 392 | Ga0207654_10046911 | |||
| 393 | Ga0207707_10216038 | |||
| 394 | Ga0207695_10001328 | |||
| 395 | Ga0207695_10002756 | |||
| 396 | Ga0207695_10018744 | |||
| 397 | Ga0207695_10019731 | |||
| 398 | Ga0207695_10027497 | |||
| 399 | Ga0207695_10173085 | |||
| 400 | Ga0207660_10006120 | |||
| 401 | Ga0207660_10060319 | |||
| 402 | Ga0207657_10027394 | |||
| 403 | Ga0207652_10013308 | |||
| 404 | Ga0207650_10000084 | |||
| 405 | Ga0207644_10007416 | |||
| 406 | Ga0207706_10053115 | |||
| 407 | Ga0207711_10000482 | |||
| 408 | Ga0207711_10007977 | |||
| 409 | Ga0207689_10190810 | |||
| 410 | Ga0207679_10136527 | |||
| 411 | Ga0207667_10012364 | |||
| 412 | Ga0207651_10001555 | |||
| 413 | Ga0207712_10000554 | |||
| 414 | Ga0207712_10123776 | |||
| 415 | Ga0207668_10000032 | |||
| 416 | Ga0207668_10000036 | |||
| 417 | Ga0207658_10002743 | |||
| 418 | Ga0207658_10008046 | |||
| 419 | Ga0207703_10000675 | |||
| 420 | Ga0207703_10007777 | |||
| 421 | Ga0207639_10005882 | |||
| 422 | Ga0207641_10000070 | |||
| 423 | Ga0207641_10000913 | |||
| 424 | Ga0207676_10000102 | |||
| 425 | Ga0207676_10001282 | |||
| 426 | Ga0207676_10002766 | |||
| 427 | Ga0268266_10000106 | |||
| 428 | Ga0268266_10001096 | |||
| 429 | Ga0268266_10003600 | |||
| 430 | Ga0268266_10131664 | |||
| 431 | Ga0268265_10018789 | |||
| 432 | Ga0268265_10054113 | |||
| 433 | Ga0268264_10000284 | |||
| 434 | Ga0265326_10014705 | |||
| 435 | Ga0265334_10016031 | |||
| 436 | Ga0307517_10013329 | |||
| 437 | Ga0307517_10024176 | |||
| 438 | Ga0307515_10053259 | |||
| 439 | Ga0307515_10120350 | |||
| 440 | Ga0265338_10018992 | |||
| 441 | Ga0265338_10023212 | |||
| 442 | Ga0265338_10024385 | |||
| 443 | Ga0265338_10056378 | |||
| 444 | Ga0307511_10028566 | |||
| 445 | Ga0265327_10000166 | |||
| 446 | Ga0265327_10003056 | |||
| 447 | Ga0265327_10010420 | |||
| 448 | Ga0307513_10000162 | |||
| 449 | Ga0307513_10004143 | |||
| 450 | Ga0307513_10007176 | |||
| 451 | Ga0265314_10036652 | |||
| 452 | Ga0307413_10066496 | |||
| 453 | Ga0307510_10017415 | |||
| 454 | Ga0373927_0000368 | |||
| 455 | Ga0373925_0000507 | |||
| 456 | Ga0395899_0000105 | |||
| 457 | Ga0395900_0000009 | |||
| 458 | Ga0395898_0003798 | |||
| 459 | Ga0395905_0000346 | |||
| 460 | Ga0395905_0009782 | |||
| 461 | Ga0395905_0099683 | |||
| 462 | Ga0395901_0011668 | |||
| 463 | Ga0395901_0378616 | |||
| 464 | Ga0436365_0800829 | |||
| 465 | Ga0436365_1830840 | |||
| 466 | Ga0436360_0037000 | |||
| 467 | Ga0436361_0536408 | |||
| 468 | Ga0439431_0016450 | |||
| 469 | Ga0439435_0006251 | |||
| 470 | Ga0439459_0003618 | |||
| 471 | Ga0466969_0007448 | |||
| 472 | Ga0466966_0000050 | |||
| 473 | Ga0466961_0008018 | |||
| 474 | Ga0466971_0048526 | |||
| 475 | Ga0466970_0005184 | |||
| 476 | Ga0466957_0021409 | |||
| 477 | Ga0466959_0000565 | |||
| 478 | Ga0451576_0000707 | |||
| 479 | Ga0466958_0000741 | |||
| 480 | Ga0495627_001069 | |||
| 481 | Ga0495590_0005140 | |||
| 482 | Ga0495629_0008724 | |||
| 483 | Ga0495638_0000421 | |||
| 484 | Ga0495638_0002399 | |||
| 485 | Ga0495638_0015624 | |||
| 486 | Ga0495650_0000030 | |||
| 487 | Ga0495583_0000002 | |||
| 488 | Ga0495606_0003344 | |||
| 489 | Ga0495606_0104512 | |||
| 490 | Ga0495610_0000091 | |||
| 491 | Ga0495610_0003154 | |||
| 492 | Ga0495610_0005962 | |||
| 493 | Ga0495616_0000206 | |||
| 494 | Ga0495630_0184424 | |||
| 495 | Ga0495631_0003397 | |||
| 496 | Ga0495632_0002830 | |||
| 497 | Ga0495643_0018594 | |||
| 498 | Ga0495648_0000154 | |||
| 499 | Ga0495654_0000048 | |||
| 500 | Ga0495654_0020490 | |||
| 501 | Ga0495640_0023951 | |||
| 502 | Ga0495598_0031392 | |||
| 503 | Ga0495597_0003367 | |||
| 504 | Ga0495668_0000703 | |||
| 505 | Ga0495668_0030501 | |||
| 506 | Ga0495668_0043733 | |||
| 507 | Ga0495625_0000058 | |||
| 508 | Ga0495625_0009823 | |||
| 509 | Ga0495625_0026271 | |||
| 510 | Ga0495625_0032528 | |||
| 511 | Ga0495625_0035260 | |||
| 512 | Ga0495625_0039688 | |||
| 513 | Ga0495625_0045814 | |||
| 514 | Ga0495669_0000024 | |||
| 515 | Ga0495669_0000196 | |||
| 516 | Ga0495613_0012920 | |||
| 517 | Ga0495589_0027480 | |||
| 518 | Ga0495672_0001353 | |||
| 519 | Ga0495687_032907 | |||
| 520 | Ga0495677_0006938 | |||
| 521 | Ga0495673_0000225 | |||
| 522 | Ga0495673_0001111 | |||
| 523 | Ga0495673_0016065 | |||
| 524 | Ga0495686_0000449 | |||
| 525 | Ga0495686_0006951 | |||
| 526 | Ga0495686_0027363 | |||
| 527 | Ga0495686_0081210 | |||
| 528 | Ga0496102_0020266 | |||
| 529 | Ga0496102_0029375 | |||
| 530 | Ga0496106_0032210 | |||
| 531 | Ga0496107_0000456 | |||
| 532 | Ga0496109_0011512 | |||
| 533 | Ga0496110_0132955 | |||
| 534 | Ga0496115_0002377 | |||
| 535 | Ga0496115_0003649 | |||
| 536 | Ga0496117_0009853 | |||
| 537 | Ga0496118_0005250 | |||
| 538 | Ga0496121_0010269 | |||
| 539 | Ga0496121_0014838 | |||
| 540 | Ga0496124_0029391 | |||
| 541 | Ga0496126_0018292 | |||
| 542 | Ga0501033_0011065 | |||
| 543 | Ga0501034_0084616 | |||
| 544 | Ga0501034_0281674 | |||
| 545 | Ga0501034_0337960 | |||
| 546 | Ga0501037_0031929 | |||
| 547 | Ga0501047_0030216 | |||
| 548 | Ga0501035_0065264 | |||
| 549 | Ga0501044_0006211 | |||
| 550 | Ga0501044_0097398 | |||
| 551 | nmdc:mga00v17_2072_c1 | |||
| 552 | nmdc:mga0k408_33044_c1 | |||
| 553 | nmdc:mga0k408_56474_c1 | |||
| 554 | nmdc:mga07m45_46155_c1 | |||
| 555 | nmdc:mga0sz30_7449_c1 | |||
| 556 | Ga0500635_0000102 | |||
| 557 | Ga0500635_0002473 | |||
| 558 | Ga0500578_0001504 | |||
| 559 | Ga0500643_000298 | |||
| 560 | Ga0500643_018639 | |||
| 561 | Ga0500644_0000340 | |||
| 562 | Ga0500566_0050357 | |||
| 563 | Ga0500641_0001060 | |||
| 564 | Ga0500641_0002309 | |||
| 565 | Ga0500650_0058249 | |||
| 566 | Ga0500555_009451 | |||
| 567 | Ga0500556_0003499 | |||
| 568 | Ga0500562_000292 | |||
| 569 | Ga0500562_001375 | |||
| 570 | Ga0500562_003117 | |||
| 571 | Ga0500569_001504 | |||
| 572 | Ga0500572_002159 | |||
| 573 | Ga0500594_0000137 | |||
| 574 | Ga0500595_000910 | |||
| 575 | Ga0500595_005809 | |||
| 576 | Ga0500608_001112 | |||
| 577 | Ga0500608_003958 | |||
| 578 | Ga0500608_006081 | |||
| 579 | Ga0500559_0000062 | |||
| 580 | Ga0500559_0004386 | |||
| 581 | Ga0500559_0041687 | |||
| 582 | Ga0500577_0000818 | |||
| 583 | Ga0500590_025817 | |||
| 584 | Ga0500590_084044 | |||
| 585 | Ga0500616_0018370 | |||
| 586 | Ga0500622_0003015 | |||
| 587 | Ga0500637_0117097 | |||
| 588 | Ga0500625_002213 | |||
| 589 | Ga0500645_000851 | |||
| 590 | Ga0500609_002288 | |||
| 591 | 2511125030 | |||
| 592 | 2585146873 | |||
| 593 | 2585151432 | |||
| 594 | 2585196146 | |||
| 595 | 2587919456 | |||
| 596 | 2643749498 | |||
| 597 | 2643782285 | |||
| 598 | 2643926491 | |||
| 599 | 2643928928 | |||
| 600 | 2644508454 | |||
| 601 | 2739793431 | |||
| 602 | 2819536979 | |||
| 603 | 2819645391 | |||
| 604 | 2884960687 | |||
| 605 | 2928534415 | |||
| 606 | 3000019850 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xrf-assembly1.cif.gz_A | the crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution | 0.9543 | 3 | 428 |
| 4bjh-assembly1.cif.gz_A | crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) | 0.9535 | 1 | 428 |
| 3d6n-assembly1.cif.gz_A | crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase | 0.9534 | 1 | 428 |
| 4bjh-assembly1.cif.gz_A | crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) | 0.9513 | 1 | 428 |
| 3d6n-assembly1.cif.gz_A | crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase | 0.9512 | 1 | 428 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHL3_52_363_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.952 | 60 | 368 | 3.20.20.140 |
| 4bjhA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9518 | 60 | 371 | 3.20.20.140 |
| 1xrfA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9504 | 60 | 371 | 3.20.20.140 |
| 4bjhA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9488 | 60 | 371 | 3.20.20.140 |
| 1xrfA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9467 | 60 | 371 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659YHQ9-F1-model_v4 | deleted | 0.9722 | 58 | 183 |
|
| AF-A0A2N3CFB4-F1-model_v4 | Dihydroorotase (EC 3.5.2.3) | 0.971 | 3 | 428 |
GO:0004038
GO:0004151 GO:0005737 GO:0006145 GO:0006221 GO:0046872 |
| AF-A0A7G5LQI2-F1-model_v4 | Dihydroorotase (EC 3.5.2.3) | 0.9697 | 1 | 428 |
GO:0004038
GO:0004151 GO:0005737 GO:0006145 GO:0006221 GO:0046872 |
| AF-A0A7W2BJR5-F1-model_v4 | Dihydroorotase (EC 3.5.2.3) | 0.9695 | 3 | 428 |
GO:0004038
GO:0004151 GO:0005737 GO:0006145 GO:0006221 GO:0046872 |
| AF-A0A3B8QJC9-F1-model_v4 | Dihydroorotase (EC 3.5.2.3) | 0.9689 | 63 | 428 |
GO:0004038
GO:0004151 GO:0005737 GO:0006145 GO:0006221 GO:0046872 |