F397164

General Info

Members Datasets Scaffolds Average Seq Length
303 197 606 428

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0196619|Ga0436361_0196619_11049_12365
Length 438
Sequence MTGQPLAFIGARLVDPETGYDGPGSLLTADGCIARVSRGDTLPGLPGDARVIDAVGALLCPGLIDLRVKTGEPGSEPKETLKSASRAAXXXGVTSIVVMPDTDPPVDEPSVVDFVLRRARDIELVHVYPAGAATRGLEGKALAEIGLMREAGCVFVTDADRPIVDSRVMRRLLAYAGGLGVLVAHRPADPWLTAGAAASEGEFAGRMGLPSEPPAAETIMLERDLALLELTAPTGARLMVDQVSAEGALETLRKSKDRGLPVIATASINHLTFNELDIGDYRTFWKLTPPLRGEADRAALVDAVASGLIDIIVSAHAPAPAEDKRLPFEEATPGSVGLETLLPALLTLWHEGQAPLLRLLETVTLAPARAIGSEAGRLAVGAPADLILCDIDAPRIIDANLLLSKSKNSAFDGRRLQGRVLMTVVDGRIVWEASAGAP

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
98 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
99 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
100 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
159 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
164 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
165 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
168 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
169 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
170 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
171 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
172 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
175 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
179 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
180 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
181 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
182 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
183 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
184 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
185 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
186 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
187 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
188 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
189 2643221583 Caulobacter sp. Root655 Isolate Unclassified
190 2643221584 Caulobacter sp. Root656 Isolate Unclassified
191 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
192 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
193 2818991435 Caulobacter henricii 536 Isolate Unclassified
194 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
195 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
196 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
197 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 0
Isolates 5.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.09
Nodule 0.33
Rhizoplane 2.64
Rhizosphere 63.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0196619 3300039447 Bacteria 31824
2 rootH1_10134748 3300003316 Bacteria 1502
3 Ga0055537_1002099 3300003773 Bacteria 7002
4 Ga0055524_1003351 3300003775 Bacteria 7805
5 Ga0055536_1003932 3300003781 Bacteria 7790
6 Ga0055531_10005501 3300003794 Bacteria 7406
7 Ga0055543_1010772 3300004625 Bacteria 1903
8 Ga0065165_1000210 3300005262 Bacteria 101721
9 Ga0065165_1001578 3300005262 Bacteria 23475
10 Ga0065165_1038780 3300005262 Bacteria 1433
11 Ga0070658_10072886 3300005327 Bacteria 2815
12 Ga0070670_100000062 3300005331 Bacteria 112560
13 Ga0070666_10167414 3300005335 Bacteria 1538
14 Ga0070680_100015686 3300005336 Bacteria 5946
15 Ga0070680_100084231 3300005336 Bacteria 2626
16 Ga0070691_10035892 3300005341 Bacteria 2335
17 Ga0070661_100105569 3300005344 Bacteria 2100
18 Ga0070668_100000121 3300005347 Bacteria 48221
19 Ga0070668_100006461 3300005347 Bacteria 8690
20 Ga0070673_100062229 3300005364 Bacteria 2964
21 Ga0070667_100000178 3300005367 Bacteria 77450
22 Ga0070667_100100897 3300005367 Bacteria 2493
23 Ga0070681_10053310 3300005458 Bacteria 4030
24 Ga0070681_10060097 3300005458 Bacteria 3779
25 Ga0068853_100050026 3300005539 Bacteria 3594
26 Ga0068853_100053747 3300005539 Bacteria 3469
27 Ga0068853_100053988 3300005539 Bacteria 3462
28 Ga0070665_100000121 3300005548 Bacteria 147683
29 Ga0070665_100002101 3300005548 Bacteria 22316
30 Ga0070665_100218839 3300005548 Bacteria 1905
31 Ga0068855_100037268 3300005563 Bacteria 5784
32 Ga0068855_100037862 3300005563 Bacteria 5732
33 Ga0068855_100225383 3300005563 Bacteria 2101
34 Ga0068859_100218600 3300005617 Bacteria 1993
35 Ga0068864_100000126 3300005618 Bacteria 74385
36 Ga0068864_100002537 3300005618 Bacteria 15079
37 Ga0068864_100080982 3300005618 Bacteria 2846
38 Ga0068863_100000247 3300005841 Bacteria 57319
39 Ga0068863_100000367 3300005841 Bacteria 45948
40 Ga0068863_100075443 3300005841 Bacteria 3190
41 Ga0068858_100000219 3300005842 Bacteria 61717
42 Ga0068858_100069117 3300005842 Bacteria 3274
43 Ga0068860_100000616 3300005843 Bacteria 42070
44 Ga0068862_100000527 3300005844 Bacteria 40316
45 Ga0068862_100016816 3300005844 Bacteria 6090
46 Ga0068862_100174016 3300005844 Bacteria 1928
47 Ga0075364_10003747 3300006051 Bacteria 8683
48 Ga0075369_10005653 3300006186 Bacteria 4684
49 Ga0075369_10012460 3300006186 Bacteria 3360
50 Ga0075366_10031955 3300006195 Bacteria 3098
51 Ga0097620_100218601 3300006931 Bacteria 1993
52 Ga0079104_1023886 3300006946 Bacteria 1619
53 Ga0099795_10028261 3300007788 Bacteria 1905
54 Ga0105240_10000798 3300009093 Bacteria 57073
55 Ga0105240_10191821 3300009093 Bacteria 2402
56 Ga0105248_10026494 3300009177 Bacteria 6450
57 Ga0105248_10102090 3300009177 Bacteria 3233
58 Ga0157373_10001230 3300013100 Bacteria 19573
59 Ga0157373_10001673 3300013100 Bacteria 16931
60 Ga0182008_10118296 3300014497 Bacteria 1316
61 Ga0157379_10178166 3300014968 Bacteria 1920
62 Ga0183365_10005 3300015684 Bacteria 249619
63 Ga0213876_10000414 3300021384 Bacteria 35795
64 Ga0213876_10052716 3300021384 Bacteria 2150
65 Ga0209026_1001009 3300025250 Bacteria 13901
66 Ga0209565_1000469 3300025263 Bacteria 30315
67 Ga0209673_1002952 3300025273 Bacteria 10658
68 Ga0209675_1014545 3300025291 Bacteria 2390
69 Ga0209676_1000691 3300025292 Bacteria 47509
70 Ga0209676_1001269 3300025292 Bacteria 26245
71 Ga0209676_1001404 3300025292 Bacteria 23284
72 Ga0209564_1017573 3300025295 Bacteria 2779
73 Ga0209564_1024340 3300025295 Bacteria 2072
74 Ga0209564_1031379 3300025295 Bacteria 1624
75 Ga0209758_1001228 3300025297 Bacteria 32082
76 Ga0209758_1001292 3300025297 Bacteria 30782
77 Ga0209050_1000101 3300025298 Bacteria 230076
78 Ga0209050_1001227 3300025298 Bacteria 29766
79 Ga0209050_1001896 3300025298 Bacteria 20030
80 Ga0209256_1001791 3300025299 Bacteria 20307
81 Ga0209256_1001906 3300025299 Bacteria 19078
82 Ga0209257_1000187 3300025304 Bacteria 154077
83 Ga0209257_1001165 3300025304 Bacteria 33428
84 Ga0209257_1001622 3300025304 Bacteria 25777
85 Ga0209257_1002808 3300025304 Bacteria 16367
86 Ga0209257_1005810 3300025304 Bacteria 8381
87 Ga0207680_10035696 3300025903 Bacteria 2857
88 Ga0207705_10006230 3300025909 Bacteria 8861
89 Ga0207654_10046911 3300025911 Bacteria 2466
90 Ga0207707_10216038 3300025912 Bacteria 1669
91 Ga0207695_10001328 3300025913 Bacteria 41985
92 Ga0207695_10002756 3300025913 Bacteria 25626
93 Ga0207695_10018744 3300025913 Bacteria 7990
94 Ga0207695_10019731 3300025913 Bacteria 7750
95 Ga0207695_10027497 3300025913 Bacteria 6332
96 Ga0207695_10173085 3300025913 Bacteria 2083
97 Ga0207660_10006120 3300025917 Bacteria 7810
98 Ga0207660_10060319 3300025917 Bacteria 2726
99 Ga0207657_10027394 3300025919 Bacteria 5220
100 Ga0207652_10013308 3300025921 Bacteria 6662
101 Ga0207650_10000084 3300025925 Bacteria 125773
102 Ga0207644_10007416 3300025931 Bacteria 7150
103 Ga0207706_10053115 3300025933 Bacteria 3577
104 Ga0207711_10000482 3300025941 Bacteria 41192
105 Ga0207711_10007977 3300025941 Bacteria 8857
106 Ga0207689_10190810 3300025942 Bacteria 1690
107 Ga0207679_10136527 3300025945 Bacteria 1976
108 Ga0207667_10012364 3300025949 Bacteria 9840
109 Ga0207651_10001555 3300025960 Bacteria 10492
110 Ga0207712_10000554 3300025961 Bacteria 30188
111 Ga0207712_10123776 3300025961 Bacteria 1960
112 Ga0207668_10000032 3300025972 Bacteria 122020
113 Ga0207668_10000036 3300025972 Bacteria 117190
114 Ga0207658_10002743 3300025986 Bacteria 12715
115 Ga0207658_10008046 3300025986 Bacteria 7184
116 Ga0207703_10000675 3300026035 Bacteria 34030
117 Ga0207703_10007777 3300026035 Bacteria 8484
118 Ga0207639_10005882 3300026041 Bacteria 8314
119 Ga0207641_10000070 3300026088 Bacteria 152598
120 Ga0207641_10000913 3300026088 Bacteria 30529
121 Ga0207676_10000102 3300026095 Bacteria 77065
122 Ga0207676_10001282 3300026095 Bacteria 18690
123 Ga0207676_10002766 3300026095 Bacteria 12477
124 Ga0268266_10000106 3300028379 Bacteria 175109
125 Ga0268266_10001096 3300028379 Bacteria 33990
126 Ga0268266_10003600 3300028379 Bacteria 15326
127 Ga0268266_10131664 3300028379 Bacteria 2237
128 Ga0268265_10018789 3300028380 Bacteria 4795
129 Ga0268265_10054113 3300028380 Bacteria 3043
130 Ga0268264_10000284 3300028381 Bacteria 85451
131 Ga0265326_10014705 3300028558 Bacteria 2279
132 Ga0265334_10016031 3300028573 Bacteria 3103
133 Ga0307517_10013329 3300028786 Bacteria 11177
134 Ga0307517_10024176 3300028786 Bacteria 7507
135 Ga0307515_10053259 3300028794 Bacteria 5976
136 Ga0307515_10120350 3300028794 Bacteria 2979
137 Ga0265338_10018992 3300028800 Bacteria 7324
138 Ga0265338_10023212 3300028800 Bacteria 6387
139 Ga0265338_10024385 3300028800 Bacteria 6180
140 Ga0265338_10056378 3300028800 Bacteria 3485
141 Ga0307511_10028566 3300030521 Bacteria 5059
142 Ga0265327_10000166 3300031251 Bacteria 141539
143 Ga0265327_10003056 3300031251 Bacteria 16539
144 Ga0265327_10010420 3300031251 Bacteria 6545
145 Ga0307513_10000162 3300031456 Bacteria 96000
146 Ga0307513_10004143 3300031456 Bacteria 19418
147 Ga0307513_10007176 3300031456 Bacteria 14472
148 Ga0265314_10036652 3300031711 Bacteria 3561
149 Ga0307413_10066496 3300031824 Bacteria 2249
150 Ga0307510_10017415 3300033180 Bacteria 8474
151 Ga0373927_0000368 3300035695 Bacteria 34930
152 Ga0373925_0000507 3300037068 Bacteria 39351
153 Ga0395899_0000105 3300037312 Bacteria 146163
154 Ga0395900_0000009 3300037418 Bacteria 476249
155 Ga0395898_0003798 3300037466 Bacteria 16721
156 Ga0395905_0000346 3300037471 Bacteria 65961
157 Ga0395905_0009782 3300037471 Bacteria 9347
158 Ga0395905_0099683 3300037471 Bacteria 2728
159 Ga0395901_0011668 3300038443 Bacteria 8900
160 Ga0395901_0378616 3300038443 Bacteria 1457
161 Ga0436365_0800829 3300039437 Bacteria 5337
162 Ga0436365_1830840 3300039437 Bacteria 45078
163 Ga0436360_0037000 3300039438 Bacteria 6687
164 Ga0436361_0536408 3300039447 Bacteria 2523
165 Ga0439431_0016450 3300041997 Bacteria 1731
166 Ga0439435_0006251 3300042436 Bacteria 2669
167 Ga0439459_0003618 3300042438 Bacteria 2464
168 Ga0466969_0007448 3300044656 Bacteria 5814
169 Ga0466966_0000050 3300044684 Bacteria 88948
170 Ga0466961_0008018 3300044693 Bacteria 6730
171 Ga0466971_0048526 3300044719 Bacteria 1909
172 Ga0466970_0005184 3300044765 Bacteria 6443
173 Ga0466957_0021409 3300044842 Bacteria 3809
174 Ga0466959_0000565 3300045049 Bacteria 21544
175 Ga0451576_0000707 3300045051 Bacteria 67610
176 Ga0466958_0000741 3300045836 Bacteria 14286
177 Ga0495627_001069 3300046453 Bacteria 18121
178 Ga0495590_0005140 3300046457 Bacteria 5207
179 Ga0495629_0008724 3300046459 Bacteria 7455
180 Ga0495638_0000421 3300046460 Bacteria 51251
181 Ga0495638_0002399 3300046460 Bacteria 15336
182 Ga0495638_0015624 3300046460 Bacteria 5094
183 Ga0495650_0000030 3300046471 Bacteria 436318
184 Ga0495583_0000002 3300046506 Bacteria 782521
185 Ga0495606_0003344 3300046507 Bacteria 17106
186 Ga0495606_0104512 3300046507 Bacteria 1719
187 Ga0495610_0000091 3300046512 Bacteria 105916
188 Ga0495610_0003154 3300046512 Bacteria 13078
189 Ga0495610_0005962 3300046512 Bacteria 8531
190 Ga0495616_0000206 3300046513 Bacteria 49005
191 Ga0495630_0184424 3300046517 Bacteria 1592
192 Ga0495631_0003397 3300046518 Bacteria 8718
193 Ga0495632_0002830 3300046519 Bacteria 12839
194 Ga0495643_0018594 3300046522 Bacteria 4035
195 Ga0495648_0000154 3300046524 Bacteria 81679
196 Ga0495654_0000048 3300046530 Bacteria 147348
197 Ga0495654_0020490 3300046530 Bacteria 3445
198 Ga0495640_0023951 3300046533 Bacteria 4441
199 Ga0495598_0031392 3300046537 Bacteria 1494
200 Ga0495597_0003367 3300046542 Bacteria 9392
201 Ga0495668_0000703 3300046616 Bacteria 40297
202 Ga0495668_0030501 3300046616 Bacteria 3044
203 Ga0495668_0043733 3300046616 Bacteria 2490
204 Ga0495625_0000058 3300046660 Bacteria 180863
205 Ga0495625_0009823 3300046660 Bacteria 7963
206 Ga0495625_0026271 3300046660 Bacteria 4402
207 Ga0495625_0032528 3300046660 Bacteria 3865
208 Ga0495625_0035260 3300046660 Bacteria 3689
209 Ga0495625_0039688 3300046660 Bacteria 3436
210 Ga0495625_0045814 3300046660 Bacteria 3159
211 Ga0495669_0000024 3300046684 Bacteria 113943
212 Ga0495669_0000196 3300046684 Bacteria 37390
213 Ga0495613_0012920 3300046689 Bacteria 6206
214 Ga0495589_0027480 3300046794 Bacteria 2877
215 Ga0495672_0001353 3300047320 Bacteria 24293
216 Ga0495687_032907 3300047443 Bacteria 2360
217 Ga0495677_0006938 3300047445 Bacteria 4254
218 Ga0495673_0000225 3300047469 Bacteria 83589
219 Ga0495673_0001111 3300047469 Bacteria 23151
220 Ga0495673_0016065 3300047469 Bacteria 3838
221 Ga0495686_0000449 3300047472 Bacteria 62252
222 Ga0495686_0006951 3300047472 Bacteria 8549
223 Ga0495686_0027363 3300047472 Bacteria 3724
224 Ga0495686_0081210 3300047472 Bacteria 1980
225 Ga0496102_0020266 3300048905 Bacteria 5876
226 Ga0496102_0029375 3300048905 Bacteria 4920
227 Ga0496106_0032210 3300048909 Bacteria 3908
228 Ga0496107_0000456 3300048910 Bacteria 22347
229 Ga0496109_0011512 3300048912 Bacteria 7609
230 Ga0496110_0132955 3300048913 Bacteria 2247
231 Ga0496115_0002377 3300048918 Bacteria 13492
232 Ga0496115_0003649 3300048918 Bacteria 11079
233 Ga0496117_0009853 3300048920 Bacteria 8802
234 Ga0496118_0005250 3300048921 Bacteria 14796
235 Ga0496121_0010269 3300048924 Bacteria 10594
236 Ga0496121_0014838 3300048924 Bacteria 8221
237 Ga0496124_0029391 3300048927 Bacteria 4899
238 Ga0496126_0018292 3300048929 Bacteria 6951
239 Ga0501033_0011065 3300049570 Bacteria 6909
240 Ga0501034_0084616 3300049571 Bacteria 3173
241 Ga0501034_0281674 3300049571 Bacteria 1602
242 Ga0501034_0337960 3300049571 Bacteria 1436
243 Ga0501037_0031929 3300049573 Bacteria 3888
244 Ga0501047_0030216 3300049581 Bacteria 5224
245 Ga0501035_0065264 3300049822 Bacteria 3234
246 Ga0501044_0006211 3300049823 Bacteria 13205
247 Ga0501044_0097398 3300049823 Bacteria 2963
248 nmdc:mga00v17_2072_c1 3300050491 Bacteria 10328
249 nmdc:mga0k408_33044_c1 3300050493 Bacteria 2957
250 nmdc:mga0k408_56474_c1 3300050493 Bacteria 2278
251 nmdc:mga07m45_46155_c1 3300050496 Bacteria 2447
252 nmdc:mga0sz30_7449_c1 3300050516 Bacteria 4104
253 Ga0500635_0000102 3300053080 Bacteria 51023
254 Ga0500635_0002473 3300053080 Bacteria 4584
255 Ga0500578_0001504 3300053086 Bacteria 23136
256 Ga0500643_000298 3300053087 Bacteria 41754
257 Ga0500643_018639 3300053087 Bacteria 2299
258 Ga0500644_0000340 3300053088 Bacteria 23717
259 Ga0500566_0050357 3300053094 Bacteria 2385
260 Ga0500641_0001060 3300053096 Bacteria 9810
261 Ga0500641_0002309 3300053096 Bacteria 6758
262 Ga0500650_0058249 3300053098 Bacteria 1802
263 Ga0500555_009451 3300053103 Bacteria 2789
264 Ga0500556_0003499 3300053104 Bacteria 4608
265 Ga0500562_000292 3300053108 Bacteria 12208
266 Ga0500562_001375 3300053108 Bacteria 5990
267 Ga0500562_003117 3300053108 Bacteria 4140
268 Ga0500569_001504 3300053109 Bacteria 4418
269 Ga0500572_002159 3300053111 Bacteria 4843
270 Ga0500594_0000137 3300053118 Bacteria 20341
271 Ga0500595_000910 3300053119 Bacteria 16856
272 Ga0500595_005809 3300053119 Bacteria 5325
273 Ga0500608_001112 3300053122 Bacteria 9584
274 Ga0500608_003958 3300053122 Bacteria 5658
275 Ga0500608_006081 3300053122 Bacteria 4875
276 Ga0500559_0000062 3300053136 Bacteria 87142
277 Ga0500559_0004386 3300053136 Bacteria 6713
278 Ga0500559_0041687 3300053136 Bacteria 2001
279 Ga0500577_0000818 3300053142 Bacteria 8022
280 Ga0500590_025817 3300053148 Bacteria 3051
281 Ga0500590_084044 3300053148 Bacteria 1558
282 Ga0500616_0018370 3300053153 Bacteria 3955
283 Ga0500622_0003015 3300053156 Bacteria 11638
284 Ga0500637_0117097 3300053178 Bacteria 1545
285 Ga0500625_002213 3300053729 Bacteria 7178
286 Ga0500645_000851 3300053730 Bacteria 17875
287 Ga0500609_002288 3300053731 Bacteria 2732
288 2511125030 2510917020 Bacteria 5657507
289 2585146873 2582581279 Bacteria 4980720
290 2585151432 2582581280 Bacteria 5994497
291 2585196146 2582581293 Bacteria 5907401
292 2587919456 2585428106 Bacteria 5179711
293 2643749498 2643221545 Bacteria 5083237
294 2643782285 2643221552 Bacteria 5708754
295 2643926491 2643221583 Bacteria 5218014
296 2643928928 2643221584 Bacteria 5511711
297 2644508454 2643221691 Bacteria 5093099
298 2739793431 2739367756 Bacteria 4553612
299 2819536979 2818991435 Bacteria 5433759
300 2819645391 2818991454 Bacteria 5563326
301 2884960687 2884960567 Bacteria 5437054
302 2928534415 2928531327 Bacteria 5101314
303 3000019850 3000017691 Bacteria 3772574
304 Ga0436361_0196619
305 rootH1_10134748
306 Ga0055537_1002099
307 Ga0055524_1003351
308 Ga0055536_1003932
309 Ga0055531_10005501
310 Ga0055543_1010772
311 Ga0065165_1000210
312 Ga0065165_1001578
313 Ga0065165_1038780
314 Ga0070658_10072886
315 Ga0070670_100000062
316 Ga0070666_10167414
317 Ga0070680_100015686
318 Ga0070680_100084231
319 Ga0070691_10035892
320 Ga0070661_100105569
321 Ga0070668_100000121
322 Ga0070668_100006461
323 Ga0070673_100062229
324 Ga0070667_100000178
325 Ga0070667_100100897
326 Ga0070681_10053310
327 Ga0070681_10060097
328 Ga0068853_100050026
329 Ga0068853_100053747
330 Ga0068853_100053988
331 Ga0070665_100000121
332 Ga0070665_100002101
333 Ga0070665_100218839
334 Ga0068855_100037268
335 Ga0068855_100037862
336 Ga0068855_100225383
337 Ga0068859_100218600
338 Ga0068864_100000126
339 Ga0068864_100002537
340 Ga0068864_100080982
341 Ga0068863_100000247
342 Ga0068863_100000367
343 Ga0068863_100075443
344 Ga0068858_100000219
345 Ga0068858_100069117
346 Ga0068860_100000616
347 Ga0068862_100000527
348 Ga0068862_100016816
349 Ga0068862_100174016
350 Ga0075364_10003747
351 Ga0075369_10005653
352 Ga0075369_10012460
353 Ga0075366_10031955
354 Ga0097620_100218601
355 Ga0079104_1023886
356 Ga0099795_10028261
357 Ga0105240_10000798
358 Ga0105240_10191821
359 Ga0105248_10026494
360 Ga0105248_10102090
361 Ga0157373_10001230
362 Ga0157373_10001673
363 Ga0182008_10118296
364 Ga0157379_10178166
365 Ga0183365_10005
366 Ga0213876_10000414
367 Ga0213876_10052716
368 Ga0209026_1001009
369 Ga0209565_1000469
370 Ga0209673_1002952
371 Ga0209675_1014545
372 Ga0209676_1000691
373 Ga0209676_1001269
374 Ga0209676_1001404
375 Ga0209564_1017573
376 Ga0209564_1024340
377 Ga0209564_1031379
378 Ga0209758_1001228
379 Ga0209758_1001292
380 Ga0209050_1000101
381 Ga0209050_1001227
382 Ga0209050_1001896
383 Ga0209256_1001791
384 Ga0209256_1001906
385 Ga0209257_1000187
386 Ga0209257_1001165
387 Ga0209257_1001622
388 Ga0209257_1002808
389 Ga0209257_1005810
390 Ga0207680_10035696
391 Ga0207705_10006230
392 Ga0207654_10046911
393 Ga0207707_10216038
394 Ga0207695_10001328
395 Ga0207695_10002756
396 Ga0207695_10018744
397 Ga0207695_10019731
398 Ga0207695_10027497
399 Ga0207695_10173085
400 Ga0207660_10006120
401 Ga0207660_10060319
402 Ga0207657_10027394
403 Ga0207652_10013308
404 Ga0207650_10000084
405 Ga0207644_10007416
406 Ga0207706_10053115
407 Ga0207711_10000482
408 Ga0207711_10007977
409 Ga0207689_10190810
410 Ga0207679_10136527
411 Ga0207667_10012364
412 Ga0207651_10001555
413 Ga0207712_10000554
414 Ga0207712_10123776
415 Ga0207668_10000032
416 Ga0207668_10000036
417 Ga0207658_10002743
418 Ga0207658_10008046
419 Ga0207703_10000675
420 Ga0207703_10007777
421 Ga0207639_10005882
422 Ga0207641_10000070
423 Ga0207641_10000913
424 Ga0207676_10000102
425 Ga0207676_10001282
426 Ga0207676_10002766
427 Ga0268266_10000106
428 Ga0268266_10001096
429 Ga0268266_10003600
430 Ga0268266_10131664
431 Ga0268265_10018789
432 Ga0268265_10054113
433 Ga0268264_10000284
434 Ga0265326_10014705
435 Ga0265334_10016031
436 Ga0307517_10013329
437 Ga0307517_10024176
438 Ga0307515_10053259
439 Ga0307515_10120350
440 Ga0265338_10018992
441 Ga0265338_10023212
442 Ga0265338_10024385
443 Ga0265338_10056378
444 Ga0307511_10028566
445 Ga0265327_10000166
446 Ga0265327_10003056
447 Ga0265327_10010420
448 Ga0307513_10000162
449 Ga0307513_10004143
450 Ga0307513_10007176
451 Ga0265314_10036652
452 Ga0307413_10066496
453 Ga0307510_10017415
454 Ga0373927_0000368
455 Ga0373925_0000507
456 Ga0395899_0000105
457 Ga0395900_0000009
458 Ga0395898_0003798
459 Ga0395905_0000346
460 Ga0395905_0009782
461 Ga0395905_0099683
462 Ga0395901_0011668
463 Ga0395901_0378616
464 Ga0436365_0800829
465 Ga0436365_1830840
466 Ga0436360_0037000
467 Ga0436361_0536408
468 Ga0439431_0016450
469 Ga0439435_0006251
470 Ga0439459_0003618
471 Ga0466969_0007448
472 Ga0466966_0000050
473 Ga0466961_0008018
474 Ga0466971_0048526
475 Ga0466970_0005184
476 Ga0466957_0021409
477 Ga0466959_0000565
478 Ga0451576_0000707
479 Ga0466958_0000741
480 Ga0495627_001069
481 Ga0495590_0005140
482 Ga0495629_0008724
483 Ga0495638_0000421
484 Ga0495638_0002399
485 Ga0495638_0015624
486 Ga0495650_0000030
487 Ga0495583_0000002
488 Ga0495606_0003344
489 Ga0495606_0104512
490 Ga0495610_0000091
491 Ga0495610_0003154
492 Ga0495610_0005962
493 Ga0495616_0000206
494 Ga0495630_0184424
495 Ga0495631_0003397
496 Ga0495632_0002830
497 Ga0495643_0018594
498 Ga0495648_0000154
499 Ga0495654_0000048
500 Ga0495654_0020490
501 Ga0495640_0023951
502 Ga0495598_0031392
503 Ga0495597_0003367
504 Ga0495668_0000703
505 Ga0495668_0030501
506 Ga0495668_0043733
507 Ga0495625_0000058
508 Ga0495625_0009823
509 Ga0495625_0026271
510 Ga0495625_0032528
511 Ga0495625_0035260
512 Ga0495625_0039688
513 Ga0495625_0045814
514 Ga0495669_0000024
515 Ga0495669_0000196
516 Ga0495613_0012920
517 Ga0495589_0027480
518 Ga0495672_0001353
519 Ga0495687_032907
520 Ga0495677_0006938
521 Ga0495673_0000225
522 Ga0495673_0001111
523 Ga0495673_0016065
524 Ga0495686_0000449
525 Ga0495686_0006951
526 Ga0495686_0027363
527 Ga0495686_0081210
528 Ga0496102_0020266
529 Ga0496102_0029375
530 Ga0496106_0032210
531 Ga0496107_0000456
532 Ga0496109_0011512
533 Ga0496110_0132955
534 Ga0496115_0002377
535 Ga0496115_0003649
536 Ga0496117_0009853
537 Ga0496118_0005250
538 Ga0496121_0010269
539 Ga0496121_0014838
540 Ga0496124_0029391
541 Ga0496126_0018292
542 Ga0501033_0011065
543 Ga0501034_0084616
544 Ga0501034_0281674
545 Ga0501034_0337960
546 Ga0501037_0031929
547 Ga0501047_0030216
548 Ga0501035_0065264
549 Ga0501044_0006211
550 Ga0501044_0097398
551 nmdc:mga00v17_2072_c1
552 nmdc:mga0k408_33044_c1
553 nmdc:mga0k408_56474_c1
554 nmdc:mga07m45_46155_c1
555 nmdc:mga0sz30_7449_c1
556 Ga0500635_0000102
557 Ga0500635_0002473
558 Ga0500578_0001504
559 Ga0500643_000298
560 Ga0500643_018639
561 Ga0500644_0000340
562 Ga0500566_0050357
563 Ga0500641_0001060
564 Ga0500641_0002309
565 Ga0500650_0058249
566 Ga0500555_009451
567 Ga0500556_0003499
568 Ga0500562_000292
569 Ga0500562_001375
570 Ga0500562_003117
571 Ga0500569_001504
572 Ga0500572_002159
573 Ga0500594_0000137
574 Ga0500595_000910
575 Ga0500595_005809
576 Ga0500608_001112
577 Ga0500608_003958
578 Ga0500608_006081
579 Ga0500559_0000062
580 Ga0500559_0004386
581 Ga0500559_0041687
582 Ga0500577_0000818
583 Ga0500590_025817
584 Ga0500590_084044
585 Ga0500616_0018370
586 Ga0500622_0003015
587 Ga0500637_0117097
588 Ga0500625_002213
589 Ga0500645_000851
590 Ga0500609_002288
591 2511125030
592 2585146873
593 2585151432
594 2585196146
595 2587919456
596 2643749498
597 2643782285
598 2643926491
599 2643928928
600 2644508454
601 2739793431
602 2819536979
603 2819645391
604 2884960687
605 2928534415
606 3000019850

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07969

Amidohydro_3

Amidohydrolase family

344

431

0.94

PF01979

Amidohydro_1

Amidohydrolase family

229

430

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xrf-assembly1.cif.gz_A the crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution 0.9543 3 428
4bjh-assembly1.cif.gz_A crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) 0.9535 1 428
3d6n-assembly1.cif.gz_A crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase 0.9534 1 428
4bjh-assembly1.cif.gz_A crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) 0.9513 1 428
3d6n-assembly1.cif.gz_A crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase 0.9512 1 428
ID Description Score Start End Superfamily
af_P9WHL3_52_363_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.952 60 368 3.20.20.140
4bjhA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9518 60 371 3.20.20.140
1xrfA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9504 60 371 3.20.20.140
4bjhA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9488 60 371 3.20.20.140
1xrfA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9467 60 371 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A659YHQ9-F1-model_v4 deleted 0.9722 58 183
AF-A0A2N3CFB4-F1-model_v4 Dihydroorotase (EC 3.5.2.3) 0.971 3 428 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0006221
GO:0046872
AF-A0A7G5LQI2-F1-model_v4 Dihydroorotase (EC 3.5.2.3) 0.9697 1 428 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0006221
GO:0046872
AF-A0A7W2BJR5-F1-model_v4 Dihydroorotase (EC 3.5.2.3) 0.9695 3 428 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0006221
GO:0046872
AF-A0A3B8QJC9-F1-model_v4 Dihydroorotase (EC 3.5.2.3) 0.9689 63 428 GO:0004038
GO:0004151
GO:0005737
GO:0006145
GO:0006221
GO:0046872

Map