F397236
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 197 | 606 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0000229|Ga0495686_0000229_66545_67105 |
| Length | 186 |
| Sequence | MSTKYVLDPADRRRLLASPAGWIACGFGSGLTPKAQGTFGSLAAILPWLFLRTLSIEYWLAIIAVSFALGVWACDVAGRIIGVADHRSLVWDEFVGQWIALIPALFIHELWAVPAAFVLFRAFDVRKPWPIGWIDRRVKGGLGVMIDDVVAGVFAAVVLYLIYIISTGIIIGFAGYLIYLMFGHHS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 12 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 69 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 105 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 106 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 111 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 112 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 113 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 117 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 118 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 119 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 120 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 121 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 122 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 123 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 124 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 125 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 126 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 127 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 130 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 147 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 148 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 150 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 151 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 152 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 153 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 154 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 155 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 156 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 157 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 158 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 185 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 186 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 187 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 188 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 189 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 192 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 193 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 194 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 195 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 196 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 197 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.36 |
| Metatranscriptomes | 0.66 |
| Isolates | 1.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.58 |
| Nodule | 0 |
| Rhizoplane | 3.3 |
| Rhizosphere | 76.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495686_0000229 | 3300047472 | Bacteria | 103283 |
| 2 | JGI24736J21556_1001729 | 3300001904 | Bacteria | 3936 |
| 3 | JGI24740J21852_10002486 | 3300001979 | Bacteria | 8337 |
| 4 | JGI24739J22299_10007591 | 3300001989 | Bacteria | 4062 |
| 5 | JGI24737J22298_10012310 | 3300001990 | Bacteria | 2789 |
| 6 | JGI24735J21928_10047970 | 3300002067 | Bacteria | 1237 |
| 7 | JGI24738J21930_10016457 | 3300002075 | Bacteria | 1562 |
| 8 | rootH1_10075932 | 3300003316 | Bacteria | 2381 |
| 9 | rootL2_10199438 | 3300003322 | Bacteria | 1992 |
| 10 | rootH1_10256663 | 3300003323 | Bacteria | 2828 |
| 11 | Ga0006562J51391_1042664 | 3300003578 | Bacteria | 8710 |
| 12 | Ga0006562J51391_1042666 | 3300003578 | Bacteria | 6180 |
| 13 | Ga0055525_1000055 | 3300003759 | Bacteria | 215181 |
| 14 | Ga0055527_1000210 | 3300003760 | Bacteria | 37874 |
| 15 | Ga0055535_1000454 | 3300003761 | Bacteria | 37846 |
| 16 | Ga0055542_1000468 | 3300003762 | Bacteria | 37874 |
| 17 | Ga0055529_1000479 | 3300003763 | Bacteria | 37884 |
| 18 | Ga0055540_1053095 | 3300003792 | Bacteria | 830 |
| 19 | Ga0055543_1007681 | 3300004625 | Bacteria | 2464 |
| 20 | Ga0065165_1000108 | 3300005262 | Bacteria | 139605 |
| 21 | Ga0065165_1005817 | 3300005262 | Bacteria | 6725 |
| 22 | Ga0070658_10014704 | 3300005327 | Bacteria | 6277 |
| 23 | Ga0070666_10000013 | 3300005335 | Bacteria | 230442 |
| 24 | Ga0070666_10000487 | 3300005335 | Bacteria | 23992 |
| 25 | Ga0070661_100007367 | 3300005344 | Bacteria | 7588 |
| 26 | Ga0070661_100095657 | 3300005344 | Bacteria | 2203 |
| 27 | Ga0070661_100231950 | 3300005344 | Bacteria | 1419 |
| 28 | Ga0070668_100014083 | 3300005347 | Bacteria | 5978 |
| 29 | Ga0070667_100000072 | 3300005367 | Bacteria | 122929 |
| 30 | Ga0070663_100005396 | 3300005455 | Bacteria | 7595 |
| 31 | Ga0070663_100128248 | 3300005455 | Bacteria | 1923 |
| 32 | Ga0068853_100001849 | 3300005539 | Bacteria | 15546 |
| 33 | Ga0068853_100010111 | 3300005539 | Bacteria | 7625 |
| 34 | Ga0070693_100325362 | 3300005547 | Bacteria | 1044 |
| 35 | Ga0070665_100007039 | 3300005548 | Bacteria | 11429 |
| 36 | Ga0068855_100042790 | 3300005563 | Bacteria | 5366 |
| 37 | Ga0068855_100071187 | 3300005563 | Bacteria | 4044 |
| 38 | Ga0070664_100664193 | 3300005564 | Bacteria | 969 |
| 39 | Ga0068857_100013283 | 3300005577 | Bacteria | 7173 |
| 40 | Ga0068854_100002865 | 3300005578 | Bacteria | 10728 |
| 41 | Ga0068856_100733794 | 3300005614 | Bacteria | 1008 |
| 42 | Ga0068856_100942343 | 3300005614 | Bacteria | 882 |
| 43 | Ga0068852_100006036 | 3300005616 | Bacteria | 8728 |
| 44 | Ga0068852_100049027 | 3300005616 | Bacteria | 3611 |
| 45 | Ga0068852_100058443 | 3300005616 | Bacteria | 3341 |
| 46 | Ga0068859_100373175 | 3300005617 | Bacteria | 1522 |
| 47 | Ga0068864_100004209 | 3300005618 | Bacteria | 11834 |
| 48 | Ga0068851_10000908 | 3300005834 | Bacteria | 12753 |
| 49 | Ga0068851_10010365 | 3300005834 | Bacteria | 4350 |
| 50 | Ga0068863_100006254 | 3300005841 | Bacteria | 11695 |
| 51 | Ga0068863_101226554 | 3300005841 | Bacteria | 756 |
| 52 | Ga0068860_100017401 | 3300005843 | Bacteria | 7003 |
| 53 | Ga0068862_100453617 | 3300005844 | Bacteria | 1209 |
| 54 | Ga0070716_100260207 | 3300006173 | Bacteria | 1187 |
| 55 | Ga0097621_100001824 | 3300006237 | Bacteria | 14593 |
| 56 | Ga0068871_100069663 | 3300006358 | Bacteria | 2889 |
| 57 | Ga0097620_100373206 | 3300006931 | Bacteria | 1522 |
| 58 | Ga0105250_10412687 | 3300009092 | Unclassified | 600 |
| 59 | Ga0105240_10011172 | 3300009093 | Bacteria | 12533 |
| 60 | Ga0105240_10023678 | 3300009093 | Bacteria | 8112 |
| 61 | Ga0105240_10032548 | 3300009093 | Bacteria | 6750 |
| 62 | Ga0105240_10143630 | 3300009093 | Bacteria | 2850 |
| 63 | Ga0105245_10101667 | 3300009098 | Bacteria | 2661 |
| 64 | Ga0105245_10459777 | 3300009098 | Bacteria | 1283 |
| 65 | Ga0105247_10002916 | 3300009101 | Bacteria | 11384 |
| 66 | Ga0105241_10014588 | 3300009174 | Bacteria | 5754 |
| 67 | Ga0105237_10000084 | 3300009545 | Bacteria | 125742 |
| 68 | Ga0105237_10589687 | 3300009545 | Bacteria | 1118 |
| 69 | Ga0105238_10000131 | 3300009551 | Bacteria | 82050 |
| 70 | Ga0105249_10680199 | 3300009553 | Bacteria | 1088 |
| 71 | Ga0105239_10002525 | 3300010375 | Bacteria | 23254 |
| 72 | Ga0105239_10018126 | 3300010375 | Bacteria | 7783 |
| 73 | Ga0105239_10029526 | 3300010375 | Bacteria | 6028 |
| 74 | Ga0105239_10117030 | 3300010375 | Bacteria | 2958 |
| 75 | Ga0105239_10182761 | 3300010375 | Bacteria | 2346 |
| 76 | Ga0157314_1000507 | 3300012500 | Bacteria | 3702 |
| 77 | Ga0157370_10045998 | 3300013104 | Bacteria | 4186 |
| 78 | Ga0157370_10638925 | 3300013104 | Bacteria | 973 |
| 79 | Ga0157369_10065473 | 3300013105 | Bacteria | 3911 |
| 80 | Ga0157369_10169698 | 3300013105 | Bacteria | 2299 |
| 81 | Ga0157374_10384425 | 3300013296 | Bacteria | 1398 |
| 82 | Ga0163162_10000221 | 3300013306 | Bacteria | 52249 |
| 83 | Ga0157372_10000334 | 3300013307 | Bacteria | 51813 |
| 84 | Ga0157372_10124881 | 3300013307 | Bacteria | 2959 |
| 85 | Ga0157372_11052393 | 3300013307 | Bacteria | 942 |
| 86 | Ga0157375_11830008 | 3300013308 | Unclassified | 720 |
| 87 | Ga0163163_10000112 | 3300014325 | Bacteria | 86324 |
| 88 | Ga0163163_10000585 | 3300014325 | Bacteria | 32121 |
| 89 | Ga0182008_10006516 | 3300014497 | Bacteria | 6516 |
| 90 | Ga0157379_10007853 | 3300014968 | Bacteria | 9242 |
| 91 | Ga0157376_11297484 | 3300014969 | Unclassified | 758 |
| 92 | Ga0182006_1000031 | 3300015261 | Bacteria | 240055 |
| 93 | Ga0182006_1000496 | 3300015261 | Bacteria | 30592 |
| 94 | Ga0182007_10003787 | 3300015262 | Bacteria | 7047 |
| 95 | Ga0182007_10046249 | 3300015262 | Bacteria | 1442 |
| 96 | Ga0182005_1001001 | 3300015265 | Bacteria | 12121 |
| 97 | Ga0182005_1002650 | 3300015265 | Bacteria | 6301 |
| 98 | Ga0183369_1013 | 3300015685 | Bacteria | 222738 |
| 99 | Ga0209674_100785 | 3300025226 | Bacteria | 10709 |
| 100 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 101 | Ga0209147_110118 | 3300025229 | Bacteria | 1093 |
| 102 | Ga0209563_100076 | 3300025230 | Bacteria | 215269 |
| 103 | Ga0209437_100782 | 3300025233 | Bacteria | 14969 |
| 104 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 105 | Ga0209148_1000025 | 3300025254 | Bacteria | 663262 |
| 106 | Ga0209129_1001515 | 3300025258 | Bacteria | 12873 |
| 107 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 108 | Ga0209758_1000301 | 3300025297 | Bacteria | 96998 |
| 109 | Ga0209051_1007151 | 3300025303 | Bacteria | 6152 |
| 110 | Ga0209051_1086804 | 3300025303 | Bacteria | 883 |
| 111 | Ga0207656_10002307 | 3300025321 | Bacteria | 6408 |
| 112 | Ga0207656_10003182 | 3300025321 | Bacteria | 5613 |
| 113 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 114 | Ga0207680_10000598 | 3300025903 | Bacteria | 17011 |
| 115 | Ga0207647_10000034 | 3300025904 | Bacteria | 99280 |
| 116 | Ga0207647_10002308 | 3300025904 | Bacteria | 14534 |
| 117 | Ga0207705_10023786 | 3300025909 | Bacteria | 4371 |
| 118 | Ga0207705_10307269 | 3300025909 | Bacteria | 1217 |
| 119 | Ga0207654_10000719 | 3300025911 | Bacteria | 18479 |
| 120 | Ga0207654_10397228 | 3300025911 | Bacteria | 958 |
| 121 | Ga0207695_10004205 | 3300025913 | Bacteria | 19775 |
| 122 | Ga0207695_10037931 | 3300025913 | Bacteria | 5195 |
| 123 | Ga0207695_10058752 | 3300025913 | Bacteria | 3991 |
| 124 | Ga0207695_10128550 | 3300025913 | Bacteria | 2493 |
| 125 | Ga0207695_10129186 | 3300025913 | Bacteria | 2486 |
| 126 | Ga0207671_10000011 | 3300025914 | Bacteria | 530349 |
| 127 | Ga0207649_10006569 | 3300025920 | Bacteria | 6318 |
| 128 | Ga0207649_10103192 | 3300025920 | Bacteria | 1891 |
| 129 | Ga0207694_10000654 | 3300025924 | Bacteria | 31284 |
| 130 | Ga0207687_10197149 | 3300025927 | Bacteria | 1571 |
| 131 | Ga0207687_10255264 | 3300025927 | Bacteria | 1395 |
| 132 | Ga0207711_10001918 | 3300025941 | Bacteria | 18898 |
| 133 | Ga0207667_10000219 | 3300025949 | Bacteria | 80218 |
| 134 | Ga0207667_10000446 | 3300025949 | Bacteria | 55443 |
| 135 | Ga0207668_10008877 | 3300025972 | Bacteria | 6012 |
| 136 | Ga0207640_10000280 | 3300025981 | Bacteria | 34294 |
| 137 | Ga0207640_10010303 | 3300025981 | Bacteria | 5260 |
| 138 | Ga0207640_10169460 | 3300025981 | Bacteria | 1625 |
| 139 | Ga0207658_10000997 | 3300025986 | Bacteria | 23236 |
| 140 | Ga0207658_10085292 | 3300025986 | Bacteria | 2432 |
| 141 | Ga0207639_10001412 | 3300026041 | Bacteria | 16219 |
| 142 | Ga0207639_10007087 | 3300026041 | Bacteria | 7646 |
| 143 | Ga0207678_10002665 | 3300026067 | Bacteria | 16207 |
| 144 | Ga0207678_10044550 | 3300026067 | Bacteria | 3837 |
| 145 | Ga0207702_10956320 | 3300026078 | Bacteria | 849 |
| 146 | Ga0207641_10025217 | 3300026088 | Bacteria | 4903 |
| 147 | Ga0207676_10038682 | 3300026095 | Bacteria | 3643 |
| 148 | Ga0207676_11285484 | 3300026095 | Bacteria | 726 |
| 149 | Ga0207674_10001145 | 3300026116 | Bacteria | 34394 |
| 150 | Ga0207698_10010564 | 3300026142 | Bacteria | 5943 |
| 151 | Ga0207698_10037112 | 3300026142 | Bacteria | 3585 |
| 152 | Ga0207698_10225080 | 3300026142 | Bacteria | 1698 |
| 153 | Ga0268266_10000075 | 3300028379 | Bacteria | 218045 |
| 154 | Ga0268266_10002665 | 3300028379 | Bacteria | 18789 |
| 155 | Ga0268264_10003031 | 3300028381 | Bacteria | 14566 |
| 156 | Ga0268264_11639370 | 3300028381 | Unclassified | 654 |
| 157 | Ga0307405_10666438 | 3300031731 | Bacteria | 857 |
| 158 | Ga0307412_10001016 | 3300031911 | Bacteria | 16068 |
| 159 | Ga0395899_0045161 | 3300037312 | Bacteria | 3282 |
| 160 | Ga0395900_0046633 | 3300037418 | Bacteria | 4463 |
| 161 | Ga0395898_0044330 | 3300037466 | Bacteria | 4379 |
| 162 | Ga0395901_0175871 | 3300038443 | Bacteria | 2245 |
| 163 | Ga0439436_0000032 | 3300041404 | Bacteria | 46437 |
| 164 | Ga0439465_0010578 | 3300041413 | Bacteria | 2897 |
| 165 | Ga0451791_1129347 | 3300041451 | Bacteria | 8600 |
| 166 | Ga0451793_0152202 | 3300041452 | Bacteria | 631 |
| 167 | Ga0451793_0561099 | 3300041452 | Bacteria | 877 |
| 168 | Ga0451802_0459958 | 3300041460 | Bacteria | 930 |
| 169 | Ga0451807_1035907 | 3300041486 | Bacteria | 5871 |
| 170 | Ga0451837_1153363 | 3300041494 | Bacteria | 4002 |
| 171 | Ga0451853_0399036 | 3300041512 | Bacteria | 3876 |
| 172 | Ga0450897_030839 | 3300042128 | Bacteria | 606 |
| 173 | Ga0450908_000007 | 3300042184 | Bacteria | 55488 |
| 174 | Ga0466969_0039348 | 3300044656 | Bacteria | 2375 |
| 175 | Ga0466982_0000018 | 3300044672 | Bacteria | 113912 |
| 176 | Ga0466982_0000096 | 3300044672 | Bacteria | 21532 |
| 177 | Ga0466965_0212617 | 3300044683 | Bacteria | 1028 |
| 178 | Ga0466966_0007696 | 3300044684 | Bacteria | 7137 |
| 179 | Ga0466964_0001814 | 3300044706 | Bacteria | 7433 |
| 180 | Ga0466971_0054764 | 3300044719 | Bacteria | 1797 |
| 181 | Ga0466968_0001797 | 3300044735 | Bacteria | 7743 |
| 182 | Ga0466968_0022560 | 3300044735 | Bacteria | 2558 |
| 183 | Ga0466957_0002919 | 3300044842 | Bacteria | 9262 |
| 184 | Ga0466957_0165434 | 3300044842 | Bacteria | 1438 |
| 185 | Ga0466957_0287851 | 3300044842 | Bacteria | 1101 |
| 186 | Ga0466960_0022862 | 3300044901 | Bacteria | 2799 |
| 187 | Ga0466958_0146021 | 3300045836 | Bacteria | 1491 |
| 188 | Ga0495638_0011198 | 3300046460 | Bacteria | 6192 |
| 189 | Ga0495650_0000350 | 3300046471 | Bacteria | 81541 |
| 190 | Ga0495650_0000869 | 3300046471 | Bacteria | 35923 |
| 191 | Ga0495585_0001138 | 3300046492 | Bacteria | 21797 |
| 192 | Ga0495606_0053722 | 3300046507 | Bacteria | 2613 |
| 193 | Ga0495606_0072886 | 3300046507 | Bacteria | 2156 |
| 194 | Ga0495610_0000824 | 3300046512 | Bacteria | 29002 |
| 195 | Ga0495610_0062706 | 3300046512 | Bacteria | 1762 |
| 196 | Ga0495631_0000036 | 3300046518 | Bacteria | 81635 |
| 197 | Ga0495631_0000318 | 3300046518 | Bacteria | 33436 |
| 198 | Ga0495632_0027070 | 3300046519 | Bacteria | 3008 |
| 199 | Ga0495643_0075534 | 3300046522 | Bacteria | 1763 |
| 200 | Ga0495668_0009490 | 3300046616 | Bacteria | 5974 |
| 201 | Ga0495611_0000028 | 3300046648 | Bacteria | 116155 |
| 202 | Ga0495625_0070601 | 3300046660 | Bacteria | 2452 |
| 203 | Ga0495625_0282494 | 3300046660 | Bacteria | 1067 |
| 204 | Ga0495670_0005296 | 3300046691 | Bacteria | 6347 |
| 205 | Ga0495649_0095642 | 3300046694 | Bacteria | 1581 |
| 206 | Ga0495660_0004438 | 3300046810 | Bacteria | 8484 |
| 207 | Ga0495680_0117721 | 3300047322 | Bacteria | 1964 |
| 208 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 209 | Ga0495673_0000041 | 3300047469 | Bacteria | 296723 |
| 210 | Ga0495673_0079993 | 3300047469 | Bacteria | 1355 |
| 211 | Ga0495686_0000117 | 3300047472 | Bacteria | 166073 |
| 212 | Ga0496102_0275134 | 3300048905 | Bacteria | 1587 |
| 213 | Ga0496106_0345603 | 3300048909 | Bacteria | 1195 |
| 214 | Ga0496108_0069552 | 3300048911 | Bacteria | 2971 |
| 215 | Ga0496110_0881874 | 3300048913 | Bacteria | 800 |
| 216 | Ga0496115_0269589 | 3300048918 | Bacteria | 1399 |
| 217 | Ga0496116_0064576 | 3300048919 | Bacteria | 2353 |
| 218 | Ga0496117_0023133 | 3300048920 | Bacteria | 4963 |
| 219 | Ga0496117_0030912 | 3300048920 | Bacteria | 4099 |
| 220 | Ga0496118_0002903 | 3300048921 | Bacteria | 22296 |
| 221 | Ga0496118_0006396 | 3300048921 | Bacteria | 12971 |
| 222 | Ga0496118_0093538 | 3300048921 | Bacteria | 2059 |
| 223 | Ga0496120_0174192 | 3300048923 | Bacteria | 1062 |
| 224 | Ga0496121_0000771 | 3300048924 | Bacteria | 58811 |
| 225 | Ga0496121_0001298 | 3300048924 | Bacteria | 42922 |
| 226 | Ga0496121_0014080 | 3300048924 | Bacteria | 8531 |
| 227 | Ga0496121_0284125 | 3300048924 | Bacteria | 1130 |
| 228 | Ga0496122_0019348 | 3300048925 | Bacteria | 6224 |
| 229 | Ga0496122_0102736 | 3300048925 | Bacteria | 1904 |
| 230 | Ga0496123_0009820 | 3300048926 | Bacteria | 8547 |
| 231 | Ga0496123_0078537 | 3300048926 | Bacteria | 2021 |
| 232 | Ga0496125_0001450 | 3300048928 | Bacteria | 34494 |
| 233 | Ga0496125_0008488 | 3300048928 | Bacteria | 10750 |
| 234 | Ga0496125_0068692 | 3300048928 | Bacteria | 2786 |
| 235 | Ga0496126_0009745 | 3300048929 | Bacteria | 10172 |
| 236 | Ga0496126_0016296 | 3300048929 | Bacteria | 7438 |
| 237 | Ga0496126_0256935 | 3300048929 | Bacteria | 1454 |
| 238 | Ga0496126_0276115 | 3300048929 | Bacteria | 1393 |
| 239 | Ga0495682_0003108 | 3300049460 | Bacteria | 7515 |
| 240 | Ga0501031_0004820 | 3300049568 | Bacteria | 8763 |
| 241 | Ga0501032_0016091 | 3300049569 | Bacteria | 5264 |
| 242 | Ga0501032_0160696 | 3300049569 | Bacteria | 1475 |
| 243 | Ga0501032_0260715 | 3300049569 | Bacteria | 1124 |
| 244 | Ga0501033_0000375 | 3300049570 | Bacteria | 42833 |
| 245 | Ga0501033_0047050 | 3300049570 | Bacteria | 3207 |
| 246 | Ga0501033_0145005 | 3300049570 | Bacteria | 1715 |
| 247 | Ga0501033_0199236 | 3300049570 | Bacteria | 1431 |
| 248 | Ga0501034_0003104 | 3300049571 | Bacteria | 19154 |
| 249 | Ga0501034_0131738 | 3300049571 | Bacteria | 2483 |
| 250 | Ga0501034_0261517 | 3300049571 | Bacteria | 1673 |
| 251 | Ga0501036_0044118 | 3300049572 | Bacteria | 3776 |
| 252 | Ga0501036_0935986 | 3300049572 | Bacteria | 710 |
| 253 | Ga0501037_0179120 | 3300049573 | Bacteria | 1504 |
| 254 | Ga0501038_0015538 | 3300049574 | Bacteria | 6920 |
| 255 | Ga0501038_0193151 | 3300049574 | Bacteria | 1637 |
| 256 | Ga0501038_0497483 | 3300049574 | Bacteria | 932 |
| 257 | Ga0501043_0093171 | 3300049579 | Bacteria | 2368 |
| 258 | Ga0501043_0323937 | 3300049579 | Bacteria | 1174 |
| 259 | Ga0501043_0446303 | 3300049579 | Bacteria | 972 |
| 260 | Ga0501046_0038064 | 3300049580 | Bacteria | 3862 |
| 261 | Ga0501046_0078807 | 3300049580 | Bacteria | 2548 |
| 262 | Ga0501046_0207957 | 3300049580 | Bacteria | 1454 |
| 263 | Ga0501047_0002093 | 3300049581 | Bacteria | 19094 |
| 264 | Ga0501047_0014043 | 3300049581 | Bacteria | 7610 |
| 265 | Ga0501047_0074727 | 3300049581 | Bacteria | 3262 |
| 266 | Ga0501047_0124605 | 3300049581 | Bacteria | 2457 |
| 267 | Ga0501047_0236464 | 3300049581 | Bacteria | 1678 |
| 268 | Ga0501048_0029769 | 3300049582 | Bacteria | 3955 |
| 269 | Ga0501067_0000583 | 3300049583 | Bacteria | 19798 |
| 270 | Ga0501068_0007857 | 3300049584 | Bacteria | 5911 |
| 271 | Ga0501068_0292634 | 3300049584 | Bacteria | 1042 |
| 272 | Ga0501069_0002178 | 3300049585 | Bacteria | 9867 |
| 273 | Ga0501070_0004339 | 3300049586 | Bacteria | 12191 |
| 274 | Ga0501072_0002507 | 3300049588 | Bacteria | 13756 |
| 275 | Ga0501073_0000954 | 3300049589 | Bacteria | 20809 |
| 276 | Ga0501073_0054262 | 3300049589 | Bacteria | 2806 |
| 277 | Ga0501074_0008549 | 3300049590 | Bacteria | 7417 |
| 278 | Ga0501079_0379399 | 3300049741 | Bacteria | 1108 |
| 279 | Ga0501080_0001893 | 3300049742 | Bacteria | 18018 |
| 280 | Ga0501080_0304533 | 3300049742 | Bacteria | 1445 |
| 281 | Ga0501083_0001929 | 3300049744 | Bacteria | 14264 |
| 282 | Ga0501035_0089863 | 3300049822 | Bacteria | 2704 |
| 283 | Ga0501035_0111649 | 3300049822 | Bacteria | 2395 |
| 284 | Ga0501035_0481465 | 3300049822 | Bacteria | 1023 |
| 285 | Ga0501035_0487857 | 3300049822 | Bacteria | 1015 |
| 286 | Ga0501035_0642210 | 3300049822 | Bacteria | 861 |
| 287 | Ga0501044_0003272 | 3300049823 | Bacteria | 18232 |
| 288 | Ga0501044_0023396 | 3300049823 | Bacteria | 6571 |
| 289 | Ga0501044_0356413 | 3300049823 | Bacteria | 1381 |
| 290 | Ga0500643_008248 | 3300053087 | Bacteria | 4110 |
| 291 | Ga0500646_0028356 | 3300053090 | Bacteria | 1528 |
| 292 | Ga0500651_0020968 | 3300053093 | Bacteria | 4071 |
| 293 | Ga0500597_000016 | 3300053120 | Bacteria | 38903 |
| 294 | Ga0500645_000639 | 3300053730 | Bacteria | 22272 |
| 295 | Ga0501084_0061361 | 3300054114 | Bacteria | 3148 |
| 296 | Ga0501082_0078623 | 3300060353 | Bacteria | 2845 |
| 297 | Ga0466962_0000272 | 3300061719 | Bacteria | 21817 |
| 298 | 2687584291 | 2687453130 | Bacteria | 4227172 |
| 299 | 2842918670 | 2842914999 | Bacteria | 4419378 |
| 300 | 2842922145 | 2842918807 | Bacteria | 4289178 |
| 301 | 2884341932 | 2884338543 | Bacteria | 4610696 |
| 302 | 2941474338 | 2941471342 | Bacteria | 5018624 |
| 303 | 2953997263 | 2953994433 | Bacteria | 4303959 |
| 304 | Ga0495686_0000229 | |||
| 305 | JGI24736J21556_1001729 | |||
| 306 | JGI24740J21852_10002486 | |||
| 307 | JGI24739J22299_10007591 | |||
| 308 | JGI24737J22298_10012310 | |||
| 309 | JGI24735J21928_10047970 | |||
| 310 | JGI24738J21930_10016457 | |||
| 311 | rootH1_10075932 | |||
| 312 | rootL2_10199438 | |||
| 313 | rootH1_10256663 | |||
| 314 | Ga0006562J51391_1042664 | |||
| 315 | Ga0006562J51391_1042666 | |||
| 316 | Ga0055525_1000055 | |||
| 317 | Ga0055527_1000210 | |||
| 318 | Ga0055535_1000454 | |||
| 319 | Ga0055542_1000468 | |||
| 320 | Ga0055529_1000479 | |||
| 321 | Ga0055540_1053095 | |||
| 322 | Ga0055543_1007681 | |||
| 323 | Ga0065165_1000108 | |||
| 324 | Ga0065165_1005817 | |||
| 325 | Ga0070658_10014704 | |||
| 326 | Ga0070666_10000013 | |||
| 327 | Ga0070666_10000487 | |||
| 328 | Ga0070661_100007367 | |||
| 329 | Ga0070661_100095657 | |||
| 330 | Ga0070661_100231950 | |||
| 331 | Ga0070668_100014083 | |||
| 332 | Ga0070667_100000072 | |||
| 333 | Ga0070663_100005396 | |||
| 334 | Ga0070663_100128248 | |||
| 335 | Ga0068853_100001849 | |||
| 336 | Ga0068853_100010111 | |||
| 337 | Ga0070693_100325362 | |||
| 338 | Ga0070665_100007039 | |||
| 339 | Ga0068855_100042790 | |||
| 340 | Ga0068855_100071187 | |||
| 341 | Ga0070664_100664193 | |||
| 342 | Ga0068857_100013283 | |||
| 343 | Ga0068854_100002865 | |||
| 344 | Ga0068856_100733794 | |||
| 345 | Ga0068856_100942343 | |||
| 346 | Ga0068852_100006036 | |||
| 347 | Ga0068852_100049027 | |||
| 348 | Ga0068852_100058443 | |||
| 349 | Ga0068859_100373175 | |||
| 350 | Ga0068864_100004209 | |||
| 351 | Ga0068851_10000908 | |||
| 352 | Ga0068851_10010365 | |||
| 353 | Ga0068863_100006254 | |||
| 354 | Ga0068863_101226554 | |||
| 355 | Ga0068860_100017401 | |||
| 356 | Ga0068862_100453617 | |||
| 357 | Ga0070716_100260207 | |||
| 358 | Ga0097621_100001824 | |||
| 359 | Ga0068871_100069663 | |||
| 360 | Ga0097620_100373206 | |||
| 361 | Ga0105250_10412687 | |||
| 362 | Ga0105240_10011172 | |||
| 363 | Ga0105240_10023678 | |||
| 364 | Ga0105240_10032548 | |||
| 365 | Ga0105240_10143630 | |||
| 366 | Ga0105245_10101667 | |||
| 367 | Ga0105245_10459777 | |||
| 368 | Ga0105247_10002916 | |||
| 369 | Ga0105241_10014588 | |||
| 370 | Ga0105237_10000084 | |||
| 371 | Ga0105237_10589687 | |||
| 372 | Ga0105238_10000131 | |||
| 373 | Ga0105249_10680199 | |||
| 374 | Ga0105239_10002525 | |||
| 375 | Ga0105239_10018126 | |||
| 376 | Ga0105239_10029526 | |||
| 377 | Ga0105239_10117030 | |||
| 378 | Ga0105239_10182761 | |||
| 379 | Ga0157314_1000507 | |||
| 380 | Ga0157370_10045998 | |||
| 381 | Ga0157370_10638925 | |||
| 382 | Ga0157369_10065473 | |||
| 383 | Ga0157369_10169698 | |||
| 384 | Ga0157374_10384425 | |||
| 385 | Ga0163162_10000221 | |||
| 386 | Ga0157372_10000334 | |||
| 387 | Ga0157372_10124881 | |||
| 388 | Ga0157372_11052393 | |||
| 389 | Ga0157375_11830008 | |||
| 390 | Ga0163163_10000112 | |||
| 391 | Ga0163163_10000585 | |||
| 392 | Ga0182008_10006516 | |||
| 393 | Ga0157379_10007853 | |||
| 394 | Ga0157376_11297484 | |||
| 395 | Ga0182006_1000031 | |||
| 396 | Ga0182006_1000496 | |||
| 397 | Ga0182007_10003787 | |||
| 398 | Ga0182007_10046249 | |||
| 399 | Ga0182005_1001001 | |||
| 400 | Ga0182005_1002650 | |||
| 401 | Ga0183369_1013 | |||
| 402 | Ga0209674_100785 | |||
| 403 | Ga0209672_100004 | |||
| 404 | Ga0209147_110118 | |||
| 405 | Ga0209563_100076 | |||
| 406 | Ga0209437_100782 | |||
| 407 | Ga0209258_100003 | |||
| 408 | Ga0209148_1000025 | |||
| 409 | Ga0209129_1001515 | |||
| 410 | Ga0209455_1000004 | |||
| 411 | Ga0209758_1000301 | |||
| 412 | Ga0209051_1007151 | |||
| 413 | Ga0209051_1086804 | |||
| 414 | Ga0207656_10002307 | |||
| 415 | Ga0207656_10003182 | |||
| 416 | Ga0207680_10000001 | |||
| 417 | Ga0207680_10000598 | |||
| 418 | Ga0207647_10000034 | |||
| 419 | Ga0207647_10002308 | |||
| 420 | Ga0207705_10023786 | |||
| 421 | Ga0207705_10307269 | |||
| 422 | Ga0207654_10000719 | |||
| 423 | Ga0207654_10397228 | |||
| 424 | Ga0207695_10004205 | |||
| 425 | Ga0207695_10037931 | |||
| 426 | Ga0207695_10058752 | |||
| 427 | Ga0207695_10128550 | |||
| 428 | Ga0207695_10129186 | |||
| 429 | Ga0207671_10000011 | |||
| 430 | Ga0207649_10006569 | |||
| 431 | Ga0207649_10103192 | |||
| 432 | Ga0207694_10000654 | |||
| 433 | Ga0207687_10197149 | |||
| 434 | Ga0207687_10255264 | |||
| 435 | Ga0207711_10001918 | |||
| 436 | Ga0207667_10000219 | |||
| 437 | Ga0207667_10000446 | |||
| 438 | Ga0207668_10008877 | |||
| 439 | Ga0207640_10000280 | |||
| 440 | Ga0207640_10010303 | |||
| 441 | Ga0207640_10169460 | |||
| 442 | Ga0207658_10000997 | |||
| 443 | Ga0207658_10085292 | |||
| 444 | Ga0207639_10001412 | |||
| 445 | Ga0207639_10007087 | |||
| 446 | Ga0207678_10002665 | |||
| 447 | Ga0207678_10044550 | |||
| 448 | Ga0207702_10956320 | |||
| 449 | Ga0207641_10025217 | |||
| 450 | Ga0207676_10038682 | |||
| 451 | Ga0207676_11285484 | |||
| 452 | Ga0207674_10001145 | |||
| 453 | Ga0207698_10010564 | |||
| 454 | Ga0207698_10037112 | |||
| 455 | Ga0207698_10225080 | |||
| 456 | Ga0268266_10000075 | |||
| 457 | Ga0268266_10002665 | |||
| 458 | Ga0268264_10003031 | |||
| 459 | Ga0268264_11639370 | |||
| 460 | Ga0307405_10666438 | |||
| 461 | Ga0307412_10001016 | |||
| 462 | Ga0395899_0045161 | |||
| 463 | Ga0395900_0046633 | |||
| 464 | Ga0395898_0044330 | |||
| 465 | Ga0395901_0175871 | |||
| 466 | Ga0439436_0000032 | |||
| 467 | Ga0439465_0010578 | |||
| 468 | Ga0451791_1129347 | |||
| 469 | Ga0451793_0152202 | |||
| 470 | Ga0451793_0561099 | |||
| 471 | Ga0451802_0459958 | |||
| 472 | Ga0451807_1035907 | |||
| 473 | Ga0451837_1153363 | |||
| 474 | Ga0451853_0399036 | |||
| 475 | Ga0450897_030839 | |||
| 476 | Ga0450908_000007 | |||
| 477 | Ga0466969_0039348 | |||
| 478 | Ga0466982_0000018 | |||
| 479 | Ga0466982_0000096 | |||
| 480 | Ga0466965_0212617 | |||
| 481 | Ga0466966_0007696 | |||
| 482 | Ga0466964_0001814 | |||
| 483 | Ga0466971_0054764 | |||
| 484 | Ga0466968_0001797 | |||
| 485 | Ga0466968_0022560 | |||
| 486 | Ga0466957_0002919 | |||
| 487 | Ga0466957_0165434 | |||
| 488 | Ga0466957_0287851 | |||
| 489 | Ga0466960_0022862 | |||
| 490 | Ga0466958_0146021 | |||
| 491 | Ga0495638_0011198 | |||
| 492 | Ga0495650_0000350 | |||
| 493 | Ga0495650_0000869 | |||
| 494 | Ga0495585_0001138 | |||
| 495 | Ga0495606_0053722 | |||
| 496 | Ga0495606_0072886 | |||
| 497 | Ga0495610_0000824 | |||
| 498 | Ga0495610_0062706 | |||
| 499 | Ga0495631_0000036 | |||
| 500 | Ga0495631_0000318 | |||
| 501 | Ga0495632_0027070 | |||
| 502 | Ga0495643_0075534 | |||
| 503 | Ga0495668_0009490 | |||
| 504 | Ga0495611_0000028 | |||
| 505 | Ga0495625_0070601 | |||
| 506 | Ga0495625_0282494 | |||
| 507 | Ga0495670_0005296 | |||
| 508 | Ga0495649_0095642 | |||
| 509 | Ga0495660_0004438 | |||
| 510 | Ga0495680_0117721 | |||
| 511 | Ga0495673_0000004 | |||
| 512 | Ga0495673_0000041 | |||
| 513 | Ga0495673_0079993 | |||
| 514 | Ga0495686_0000117 | |||
| 515 | Ga0496102_0275134 | |||
| 516 | Ga0496106_0345603 | |||
| 517 | Ga0496108_0069552 | |||
| 518 | Ga0496110_0881874 | |||
| 519 | Ga0496115_0269589 | |||
| 520 | Ga0496116_0064576 | |||
| 521 | Ga0496117_0023133 | |||
| 522 | Ga0496117_0030912 | |||
| 523 | Ga0496118_0002903 | |||
| 524 | Ga0496118_0006396 | |||
| 525 | Ga0496118_0093538 | |||
| 526 | Ga0496120_0174192 | |||
| 527 | Ga0496121_0000771 | |||
| 528 | Ga0496121_0001298 | |||
| 529 | Ga0496121_0014080 | |||
| 530 | Ga0496121_0284125 | |||
| 531 | Ga0496122_0019348 | |||
| 532 | Ga0496122_0102736 | |||
| 533 | Ga0496123_0009820 | |||
| 534 | Ga0496123_0078537 | |||
| 535 | Ga0496125_0001450 | |||
| 536 | Ga0496125_0008488 | |||
| 537 | Ga0496125_0068692 | |||
| 538 | Ga0496126_0009745 | |||
| 539 | Ga0496126_0016296 | |||
| 540 | Ga0496126_0256935 | |||
| 541 | Ga0496126_0276115 | |||
| 542 | Ga0495682_0003108 | |||
| 543 | Ga0501031_0004820 | |||
| 544 | Ga0501032_0016091 | |||
| 545 | Ga0501032_0160696 | |||
| 546 | Ga0501032_0260715 | |||
| 547 | Ga0501033_0000375 | |||
| 548 | Ga0501033_0047050 | |||
| 549 | Ga0501033_0145005 | |||
| 550 | Ga0501033_0199236 | |||
| 551 | Ga0501034_0003104 | |||
| 552 | Ga0501034_0131738 | |||
| 553 | Ga0501034_0261517 | |||
| 554 | Ga0501036_0044118 | |||
| 555 | Ga0501036_0935986 | |||
| 556 | Ga0501037_0179120 | |||
| 557 | Ga0501038_0015538 | |||
| 558 | Ga0501038_0193151 | |||
| 559 | Ga0501038_0497483 | |||
| 560 | Ga0501043_0093171 | |||
| 561 | Ga0501043_0323937 | |||
| 562 | Ga0501043_0446303 | |||
| 563 | Ga0501046_0038064 | |||
| 564 | Ga0501046_0078807 | |||
| 565 | Ga0501046_0207957 | |||
| 566 | Ga0501047_0002093 | |||
| 567 | Ga0501047_0014043 | |||
| 568 | Ga0501047_0074727 | |||
| 569 | Ga0501047_0124605 | |||
| 570 | Ga0501047_0236464 | |||
| 571 | Ga0501048_0029769 | |||
| 572 | Ga0501067_0000583 | |||
| 573 | Ga0501068_0007857 | |||
| 574 | Ga0501068_0292634 | |||
| 575 | Ga0501069_0002178 | |||
| 576 | Ga0501070_0004339 | |||
| 577 | Ga0501072_0002507 | |||
| 578 | Ga0501073_0000954 | |||
| 579 | Ga0501073_0054262 | |||
| 580 | Ga0501074_0008549 | |||
| 581 | Ga0501079_0379399 | |||
| 582 | Ga0501080_0001893 | |||
| 583 | Ga0501080_0304533 | |||
| 584 | Ga0501083_0001929 | |||
| 585 | Ga0501035_0089863 | |||
| 586 | Ga0501035_0111649 | |||
| 587 | Ga0501035_0481465 | |||
| 588 | Ga0501035_0487857 | |||
| 589 | Ga0501035_0642210 | |||
| 590 | Ga0501044_0003272 | |||
| 591 | Ga0501044_0023396 | |||
| 592 | Ga0501044_0356413 | |||
| 593 | Ga0500643_008248 | |||
| 594 | Ga0500646_0028356 | |||
| 595 | Ga0500651_0020968 | |||
| 596 | Ga0500597_000016 | |||
| 597 | Ga0500645_000639 | |||
| 598 | Ga0501084_0061361 | |||
| 599 | Ga0501082_0078623 | |||
| 600 | Ga0466962_0000272 | |||
| 601 | 2687584291 | |||
| 602 | 2842918670 | |||
| 603 | 2842922145 | |||
| 604 | 2884341932 | |||
| 605 | 2941474338 | |||
| 606 | 2953997263 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hfb-assembly4.cif.gz_D | outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. | 0.4204 | 11 | 165 |
| 1rfz-assembly1.cif.gz_C | structure of protein of unknown function from bacillus stearothermophilus | 0.4081 | 3 | 164 |
| 1rfz-assembly1.cif.gz_C | structure of protein of unknown function from bacillus stearothermophilus | 0.4015 | 3 | 164 |
| 6hfb-assembly4.cif.gz_D | outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. | 0.3974 | 11 | 165 |
| 1rfz-assembly1.cif.gz_D | structure of protein of unknown function from bacillus stearothermophilus | 0.3649 | 9 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4IAG3_1915_2027_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.3791 | 42 | 164 | 1.25.10.10 |
| af_H8W3Z0_1_170_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3713 | 35 | 166 | 1.20.140.150 |
| af_O02108_146_277_1.20.58.610 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Cdc37, Hsp90 binding domain | 0.3695 | 1 | 166 | 1.20.58.610 |
| af_O02108_146_277_1.20.58.610 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Cdc37, Hsp90 binding domain | 0.3653 | 1 | 166 | 1.20.58.610 |
| 1knzI01 | Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Rotavirus non-structural protein NSP3, N-terminal domain | 0.3622 | 55 | 136 | 6.10.280.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5UA05-F1-model_v4 | Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) | 0.9865 | 2 | 167 |
GO:0005886
GO:0006655 GO:0008962 GO:0009395 GO:0046872 |
| AF-L0GUN8-F1-model_v4 | Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) | 0.9825 | 17 | 166 |
GO:0005886
GO:0006655 GO:0008962 GO:0009395 GO:0046872 |
| AF-A0A7X5TRP0-F1-model_v4 | Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) | 0.9807 | 1 | 162 |
GO:0005886
GO:0006655 GO:0008962 GO:0009395 GO:0046872 |
| AF-A0A328P945-F1-model_v4 | Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) | 0.9806 | 4 | 162 |
GO:0005886
GO:0006655 GO:0008962 GO:0009395 GO:0046872 |
| AF-A0A154QMI7-F1-model_v4 | Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) | 0.9789 | 1 | 167 |
GO:0005886
GO:0006655 GO:0008962 GO:0009395 GO:0046872 |