F397371
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 210 | 295 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300003203|JGI25406J46586_10002429|JGI25406J46586_100024298 |
| Length | 408 |
| Sequence | MVVMGPGVRRDDSGSLLATCKPCDNPPVISLGGAMNLRVWQNPWRLMLAVNAAVFVGVFLYKITLPPYVPYIHLLVDYYFGFTKRALIGAVIALFTAKVPVWLVFALAGATWLATLALFIQLFRRTFGLDEKHLPLFVFMAGSPFFLKNFMHTLGHFDIYGCLLAICLLLLPARSVAYVLLAASFSVVLMLVHHIHVLLYVPTIAAIVVLRYYLPEGITPQNAIAGLVAFAISGLLFIALQFYGTIEVPPQVFVDHLRSRMIDPSQTKLLAFAYIWYQPLSKEIADTWAWLPHNILGIPLFALLIWLHIPLWRYFAGLIGALASDMHRRIVIAALMTVSAGYLLMFAIVFDYSRWVSNWAVCMFLILHAVKTLPASRETPLIPSDDTKTTIFGAIVTLIPRVGIVRPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 2 | 2791355199 | |||
| 3 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 4 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 5 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 6 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 7 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 8 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 9 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 10 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 67 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 120 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 121 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 122 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 131 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 133 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 139 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 140 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 141 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 143 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 146 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 147 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 172 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 181 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 182 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 183 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 184 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 185 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 186 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 187 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 188 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 189 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 190 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 191 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 193 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 194 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 195 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 199 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 200 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 201 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 202 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 203 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 204 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 205 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 206 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 207 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 208 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 209 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 210 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.36 |
| Metatranscriptomes | 0 |
| Isolates | 2.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.54 |
| Nodule | 1.97 |
| Rhizoplane | 10.53 |
| Rhizosphere | 68.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1004162 | 3300000549 | Bacteria | 1896 |
| 2 | JGI25406J46586_10002429 | 3300003203 | Bacteria | 8810 |
| 3 | JGI25153J46596_10002154 | 3300003215 | Bacteria | 11522 |
| 4 | JGI25404J52841_10004372 | 3300003659 | Bacteria | 2858 |
| 5 | JGI25404J52841_10019661 | 3300003659 | Bacteria | 1463 |
| 6 | Ga0065715_10130821 | 3300005293 | Bacteria | 2019 |
| 7 | Ga0070683_100012887 | 3300005329 | Bacteria | 7276 |
| 8 | Ga0070670_100189464 | 3300005331 | Bacteria | 1786 |
| 9 | Ga0068869_100115519 | 3300005334 | Bacteria | 2047 |
| 10 | Ga0070680_100012955 | 3300005336 | Bacteria | 6485 |
| 11 | Ga0070680_100023219 | 3300005336 | Bacteria | 4945 |
| 12 | Ga0070682_100017949 | 3300005337 | Bacteria | 4128 |
| 13 | Ga0068868_100073327 | 3300005338 | Bacteria | 2733 |
| 14 | Ga0068868_100087203 | 3300005338 | Bacteria | 2510 |
| 15 | Ga0070660_100082416 | 3300005339 | Bacteria | 2526 |
| 16 | Ga0070668_100012183 | 3300005347 | Bacteria | 6404 |
| 17 | Ga0070668_100065341 | 3300005347 | Bacteria | 2822 |
| 18 | Ga0070671_100306724 | 3300005355 | Bacteria | 1352 |
| 19 | Ga0070688_100101341 | 3300005365 | Bacteria | 1899 |
| 20 | Ga0070709_10000584 | 3300005434 | Bacteria | 21359 |
| 21 | Ga0070714_100046652 | 3300005435 | Bacteria | 3677 |
| 22 | Ga0070714_100052413 | 3300005435 | Bacteria | 3479 |
| 23 | Ga0070714_100205453 | 3300005435 | Bacteria | 1803 |
| 24 | Ga0070713_100002424 | 3300005436 | Bacteria | 12160 |
| 25 | Ga0070713_100016180 | 3300005436 | Bacteria | 5606 |
| 26 | Ga0070710_10002528 | 3300005437 | Bacteria | 8679 |
| 27 | Ga0070710_10204780 | 3300005437 | Bacteria | 1248 |
| 28 | Ga0070711_100065139 | 3300005439 | Bacteria | 2547 |
| 29 | Ga0070708_100037573 | 3300005445 | Bacteria | 4225 |
| 30 | Ga0070663_100171428 | 3300005455 | Bacteria | 1678 |
| 31 | Ga0070678_100040432 | 3300005456 | Bacteria | 3300 |
| 32 | Ga0070678_100127908 | 3300005456 | Bacteria | 2014 |
| 33 | Ga0070678_100166944 | 3300005456 | Bacteria | 1789 |
| 34 | Ga0070681_10034769 | 3300005458 | Bacteria | 5061 |
| 35 | Ga0070681_10061048 | 3300005458 | Bacteria | 3746 |
| 36 | Ga0070681_10214005 | 3300005458 | Bacteria | 1843 |
| 37 | Ga0070698_100159902 | 3300005471 | Bacteria | 2197 |
| 38 | Ga0070679_100014297 | 3300005530 | Bacteria | 7623 |
| 39 | Ga0070679_100014541 | 3300005530 | Bacteria | 7561 |
| 40 | Ga0070679_100016181 | 3300005530 | Bacteria | 7186 |
| 41 | Ga0070684_100012430 | 3300005535 | Bacteria | 6823 |
| 42 | Ga0068853_100104000 | 3300005539 | Bacteria | 2514 |
| 43 | Ga0070665_100035947 | 3300005548 | Bacteria | 4983 |
| 44 | Ga0070665_100236648 | 3300005548 | Bacteria | 1827 |
| 45 | Ga0070665_100343951 | 3300005548 | Bacteria | 1496 |
| 46 | Ga0068855_100062940 | 3300005563 | Bacteria | 4330 |
| 47 | Ga0068855_100157811 | 3300005563 | Bacteria | 2577 |
| 48 | Ga0068855_100290809 | 3300005563 | Bacteria | 1811 |
| 49 | Ga0068857_100130483 | 3300005577 | Bacteria | 2266 |
| 50 | Ga0068857_100383894 | 3300005577 | Bacteria | 1305 |
| 51 | Ga0068854_100205094 | 3300005578 | Bacteria | 1552 |
| 52 | Ga0068856_100055177 | 3300005614 | Bacteria | 3921 |
| 53 | Ga0068852_100243757 | 3300005616 | Bacteria | 1719 |
| 54 | Ga0068866_10063243 | 3300005718 | Bacteria | 1928 |
| 55 | Ga0068861_100033316 | 3300005719 | Bacteria | 3799 |
| 56 | Ga0068858_100358916 | 3300005842 | Bacteria | 1397 |
| 57 | Ga0068860_100075850 | 3300005843 | Bacteria | 3197 |
| 58 | Ga0068860_100428239 | 3300005843 | Bacteria | 1313 |
| 59 | Ga0068862_100171151 | 3300005844 | Bacteria | 1945 |
| 60 | Ga0068862_100255732 | 3300005844 | Bacteria | 1597 |
| 61 | Ga0068862_100303033 | 3300005844 | Bacteria | 1470 |
| 62 | Ga0081455_10004129 | 3300005937 | Bacteria | 16422 |
| 63 | Ga0081455_10007101 | 3300005937 | Bacteria | 11861 |
| 64 | Ga0081455_10011042 | 3300005937 | Bacteria | 9097 |
| 65 | Ga0081455_10051915 | 3300005937 | Bacteria | 3514 |
| 66 | Ga0081455_10062056 | 3300005937 | Bacteria | 3143 |
| 67 | Ga0081538_10055867 | 3300005981 | Bacteria | 2319 |
| 68 | Ga0081540_1005183 | 3300005983 | Bacteria | 9759 |
| 69 | Ga0081540_1007567 | 3300005983 | Bacteria | 7722 |
| 70 | Ga0081540_1014446 | 3300005983 | Bacteria | 5057 |
| 71 | Ga0081540_1064400 | 3300005983 | Bacteria | 1730 |
| 72 | Ga0081539_10005111 | 3300005985 | Bacteria | 13729 |
| 73 | Ga0081539_10024516 | 3300005985 | Bacteria | 3910 |
| 74 | Ga0070717_10000598 | 3300006028 | Bacteria | 23163 |
| 75 | Ga0070717_10009120 | 3300006028 | Bacteria | 7451 |
| 76 | Ga0070717_10125103 | 3300006028 | Bacteria | 2206 |
| 77 | Ga0075365_10073586 | 3300006038 | Bacteria | 2303 |
| 78 | Ga0075368_10019981 | 3300006042 | Bacteria | 2532 |
| 79 | Ga0075364_10022004 | 3300006051 | Bacteria | 4022 |
| 80 | Ga0075364_10022250 | 3300006051 | Bacteria | 4001 |
| 81 | Ga0070716_100145851 | 3300006173 | Bacteria | 1516 |
| 82 | Ga0070712_100063311 | 3300006175 | Bacteria | 2618 |
| 83 | Ga0075366_10124203 | 3300006195 | Bacteria | 1556 |
| 84 | Ga0075370_10030969 | 3300006353 | Bacteria | 2985 |
| 85 | Ga0068871_100092456 | 3300006358 | Bacteria | 2523 |
| 86 | Ga0075428_100022218 | 3300006844 | Bacteria | 7024 |
| 87 | Ga0075434_100281115 | 3300006871 | Bacteria | 1684 |
| 88 | Ga0099822_1000827 | 3300006943 | Bacteria | 32648 |
| 89 | Ga0075435_100236211 | 3300007076 | Bacteria | 1554 |
| 90 | Ga0099794_10036826 | 3300007265 | Bacteria | 2314 |
| 91 | Ga0099794_10100888 | 3300007265 | Bacteria | 1441 |
| 92 | Ga0099795_10034339 | 3300007788 | Bacteria | 1767 |
| 93 | Ga0105240_10395870 | 3300009093 | Bacteria | 1557 |
| 94 | Ga0105247_10078572 | 3300009101 | Bacteria | 2076 |
| 95 | Ga0105247_10106471 | 3300009101 | Bacteria | 1799 |
| 96 | Ga0105241_10051939 | 3300009174 | Bacteria | 3128 |
| 97 | Ga0105241_10056204 | 3300009174 | Bacteria | 3017 |
| 98 | Ga0105248_10102810 | 3300009177 | Bacteria | 3220 |
| 99 | Ga0105237_10067653 | 3300009545 | Bacteria | 3566 |
| 100 | Ga0105237_10088220 | 3300009545 | Bacteria | 3091 |
| 101 | Ga0105238_10121687 | 3300009551 | Bacteria | 2589 |
| 102 | Ga0105238_10194831 | 3300009551 | Bacteria | 2002 |
| 103 | Ga0105249_10302223 | 3300009553 | Bacteria | 1605 |
| 104 | Ga0099796_10043914 | 3300010159 | Bacteria | 1525 |
| 105 | Ga0105239_10016720 | 3300010375 | Bacteria | 8108 |
| 106 | Ga0105239_10157794 | 3300010375 | Bacteria | 2534 |
| 107 | Ga0105239_10164228 | 3300010375 | Bacteria | 2482 |
| 108 | Ga0105246_10047523 | 3300011119 | Bacteria | 2931 |
| 109 | Ga0157374_10270505 | 3300013296 | Bacteria | 1675 |
| 110 | Ga0157378_10345811 | 3300013297 | Bacteria | 1451 |
| 111 | Ga0163162_10033640 | 3300013306 | Bacteria | 5095 |
| 112 | Ga0163162_10132028 | 3300013306 | Bacteria | 2606 |
| 113 | Ga0163163_10014099 | 3300014325 | Bacteria | 7340 |
| 114 | Ga0163163_10053770 | 3300014325 | Bacteria | 3976 |
| 115 | Ga0163163_10316314 | 3300014325 | Bacteria | 1615 |
| 116 | Ga0157377_10116460 | 3300014745 | Bacteria | 1614 |
| 117 | Ga0157379_10139468 | 3300014968 | Bacteria | 2185 |
| 118 | Ga0157376_10194800 | 3300014969 | Bacteria | 1861 |
| 119 | Ga0209677_102510 | 3300025253 | Bacteria | 6840 |
| 120 | Ga0209758_1009343 | 3300025297 | Bacteria | 6115 |
| 121 | Ga0207692_10037170 | 3300025898 | Bacteria | 2380 |
| 122 | Ga0207710_10033158 | 3300025900 | Bacteria | 2264 |
| 123 | Ga0207710_10060392 | 3300025900 | Bacteria | 1718 |
| 124 | Ga0207688_10172201 | 3300025901 | Bacteria | 1288 |
| 125 | Ga0207647_10002277 | 3300025904 | Bacteria | 14628 |
| 126 | Ga0207699_10002585 | 3300025906 | Bacteria | 8534 |
| 127 | Ga0207699_10017413 | 3300025906 | Bacteria | 3780 |
| 128 | Ga0207707_10000100 | 3300025912 | Bacteria | 85682 |
| 129 | Ga0207707_10004560 | 3300025912 | Bacteria | 12178 |
| 130 | Ga0207695_10078496 | 3300025913 | Bacteria | 3349 |
| 131 | Ga0207671_10024540 | 3300025914 | Bacteria | 4531 |
| 132 | Ga0207671_10055238 | 3300025914 | Bacteria | 2942 |
| 133 | Ga0207693_10033379 | 3300025915 | Bacteria | 4061 |
| 134 | Ga0207663_10150097 | 3300025916 | Bacteria | 1634 |
| 135 | Ga0207660_10013595 | 3300025917 | Bacteria | 5336 |
| 136 | Ga0207660_10172934 | 3300025917 | Bacteria | 1673 |
| 137 | Ga0207660_10191048 | 3300025917 | Bacteria | 1595 |
| 138 | Ga0207652_10002952 | 3300025921 | Bacteria | 14213 |
| 139 | Ga0207652_10012911 | 3300025921 | Bacteria | 6756 |
| 140 | Ga0207694_10048783 | 3300025924 | Bacteria | 3277 |
| 141 | Ga0207694_10160442 | 3300025924 | Bacteria | 1816 |
| 142 | Ga0207700_10001725 | 3300025928 | Bacteria | 12413 |
| 143 | Ga0207664_10151924 | 3300025929 | Bacteria | 1968 |
| 144 | Ga0207644_10102917 | 3300025931 | Bacteria | 2148 |
| 145 | Ga0207709_10121157 | 3300025935 | Bacteria | 1766 |
| 146 | Ga0207689_10030444 | 3300025942 | Bacteria | 4498 |
| 147 | Ga0207689_10129337 | 3300025942 | Bacteria | 2078 |
| 148 | Ga0207661_10006554 | 3300025944 | Bacteria | 8230 |
| 149 | Ga0207661_10069776 | 3300025944 | Bacteria | 2866 |
| 150 | Ga0207667_10058734 | 3300025949 | Bacteria | 4032 |
| 151 | Ga0207668_10031635 | 3300025972 | Bacteria | 3487 |
| 152 | Ga0207668_10180466 | 3300025972 | Bacteria | 1664 |
| 153 | Ga0207677_10168165 | 3300026023 | Bacteria | 1711 |
| 154 | Ga0207703_10029876 | 3300026035 | Bacteria | 4303 |
| 155 | Ga0207639_10032737 | 3300026041 | Bacteria | 3829 |
| 156 | Ga0207639_10190381 | 3300026041 | Bacteria | 1752 |
| 157 | Ga0207678_10134227 | 3300026067 | Bacteria | 2112 |
| 158 | Ga0207702_10296328 | 3300026078 | Bacteria | 1534 |
| 159 | Ga0207641_10126124 | 3300026088 | Bacteria | 2292 |
| 160 | Ga0207676_10263100 | 3300026095 | Bacteria | 1558 |
| 161 | Ga0207674_10054507 | 3300026116 | Bacteria | 4070 |
| 162 | Ga0207674_10341353 | 3300026116 | Bacteria | 1448 |
| 163 | Ga0207675_100094030 | 3300026118 | Bacteria | 2820 |
| 164 | Ga0207675_100295759 | 3300026118 | Bacteria | 1576 |
| 165 | Ga0207683_10059388 | 3300026121 | Bacteria | 3359 |
| 166 | Ga0207683_10080956 | 3300026121 | Bacteria | 2881 |
| 167 | Ga0207698_10246855 | 3300026142 | Bacteria | 1631 |
| 168 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 169 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 170 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 171 | Ga0209588_1032920 | 3300027671 | Bacteria | 1662 |
| 172 | Ga0209813_10009549 | 3300027866 | Bacteria | 2486 |
| 173 | Ga0268266_10003966 | 3300028379 | Bacteria | 14358 |
| 174 | Ga0268266_10072301 | 3300028379 | Bacteria | 2990 |
| 175 | Ga0268266_10124787 | 3300028379 | Bacteria | 2296 |
| 176 | Ga0268266_10255519 | 3300028379 | Bacteria | 1622 |
| 177 | Ga0268265_10170140 | 3300028380 | Bacteria | 1861 |
| 178 | Ga0268265_10265838 | 3300028380 | Bacteria | 1527 |
| 179 | Ga0268264_10088565 | 3300028381 | Bacteria | 2664 |
| 180 | Ga0268264_10162390 | 3300028381 | Bacteria | 2014 |
| 181 | Ga0265334_10038168 | 3300028573 | Bacteria | 1891 |
| 182 | Ga0307517_10001338 | 3300028786 | Bacteria | 41372 |
| 183 | Ga0307515_10085224 | 3300028794 | Bacteria | 4046 |
| 184 | Ga0307511_10081375 | 3300030521 | Bacteria | 2274 |
| 185 | Ga0265339_10090643 | 3300031249 | Bacteria | 1603 |
| 186 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 187 | Ga0265342_10003978 | 3300031712 | Bacteria | 11831 |
| 188 | Ga0307516_10025182 | 3300031730 | Bacteria | 6061 |
| 189 | Ga0307516_10187066 | 3300031730 | Bacteria | 1800 |
| 190 | Ga0307407_10064742 | 3300031903 | Bacteria | 2150 |
| 191 | Ga0307414_10235324 | 3300032004 | Bacteria | 1513 |
| 192 | Ga0307415_100314062 | 3300032126 | Bacteria | 1304 |
| 193 | Ga0307510_10001271 | 3300033180 | Bacteria | 27493 |
| 194 | Ga0307510_10082383 | 3300033180 | Bacteria | 3113 |
| 195 | Ga0316215_1002165 | 3300033544 | Bacteria | 1857 |
| 196 | Ga0373936_0010980 | 3300035113 | Bacteria | 3423 |
| 197 | Ga0373935_0093165 | 3300035692 | Bacteria | 1975 |
| 198 | Ga0373927_0048807 | 3300035695 | Bacteria | 2738 |
| 199 | Ga0373927_0071896 | 3300035695 | Bacteria | 2239 |
| 200 | Ga0373927_0074229 | 3300035695 | Bacteria | 2202 |
| 201 | Ga0373933_0000031 | 3300035724 | Bacteria | 85038 |
| 202 | Ga0373925_0030846 | 3300037068 | Bacteria | 3936 |
| 203 | Ga0395898_0166095 | 3300037466 | Bacteria | 2111 |
| 204 | Ga0436365_1593949 | 3300039437 | Bacteria | 1626 |
| 205 | Ga0495592_0074932 | 3300046454 | Bacteria | 2458 |
| 206 | Ga0495603_0015386 | 3300046455 | Bacteria | 4628 |
| 207 | Ga0495629_0040530 | 3300046459 | Bacteria | 3276 |
| 208 | Ga0495638_0080333 | 3300046460 | Bacteria | 1981 |
| 209 | Ga0495582_0040207 | 3300046473 | Bacteria | 2575 |
| 210 | Ga0495639_0028279 | 3300046475 | Bacteria | 2483 |
| 211 | Ga0495583_0034391 | 3300046506 | Bacteria | 2428 |
| 212 | Ga0495618_0041623 | 3300046514 | Bacteria | 2894 |
| 213 | Ga0495632_0051613 | 3300046519 | Bacteria | 2024 |
| 214 | Ga0495643_0033370 | 3300046522 | Bacteria | 2848 |
| 215 | Ga0495648_0064012 | 3300046524 | Bacteria | 2168 |
| 216 | Ga0495640_0007704 | 3300046533 | Bacteria | 8471 |
| 217 | Ga0495645_0219142 | 3300046543 | Bacteria | 1281 |
| 218 | Ga0495633_0023633 | 3300046558 | Bacteria | 3043 |
| 219 | Ga0495634_0144262 | 3300046642 | Bacteria | 1509 |
| 220 | Ga0495659_0011528 | 3300046664 | Bacteria | 2848 |
| 221 | Ga0495588_0121710 | 3300046674 | Bacteria | 1375 |
| 222 | Ga0495658_0026888 | 3300046683 | Bacteria | 3089 |
| 223 | Ga0495669_0023468 | 3300046684 | Bacteria | 2685 |
| 224 | Ga0495669_0075790 | 3300046684 | Bacteria | 1539 |
| 225 | Ga0495581_0175602 | 3300047315 | Bacteria | 1252 |
| 226 | Ga0495674_0004075 | 3300047319 | Bacteria | 14133 |
| 227 | Ga0495676_0077461 | 3300047321 | Bacteria | 2535 |
| 228 | Ga0495684_0014889 | 3300047471 | Bacteria | 5989 |
| 229 | Ga0496101_0129368 | 3300048904 | Bacteria | 1916 |
| 230 | Ga0496102_0050275 | 3300048905 | Bacteria | 3795 |
| 231 | Ga0496102_0198621 | 3300048905 | Bacteria | 1890 |
| 232 | Ga0496102_0342174 | 3300048905 | Bacteria | 1408 |
| 233 | Ga0496103_0036997 | 3300048906 | Bacteria | 2990 |
| 234 | Ga0496103_0171060 | 3300048906 | Bacteria | 1395 |
| 235 | Ga0496104_0080421 | 3300048907 | Bacteria | 3107 |
| 236 | Ga0496104_0110053 | 3300048907 | Bacteria | 2640 |
| 237 | Ga0496104_0191488 | 3300048907 | Bacteria | 1957 |
| 238 | Ga0496105_0093606 | 3300048908 | Bacteria | 2481 |
| 239 | Ga0496106_0001270 | 3300048909 | Bacteria | 18908 |
| 240 | Ga0496106_0017860 | 3300048909 | Bacteria | 5246 |
| 241 | Ga0496107_0001290 | 3300048910 | Bacteria | 15326 |
| 242 | Ga0496108_0002231 | 3300048911 | Bacteria | 15526 |
| 243 | Ga0496108_0116469 | 3300048911 | Bacteria | 2289 |
| 244 | Ga0496108_0137282 | 3300048911 | Bacteria | 2105 |
| 245 | Ga0496109_0010061 | 3300048912 | Bacteria | 8071 |
| 246 | Ga0496109_0128618 | 3300048912 | Bacteria | 2363 |
| 247 | Ga0496109_0193843 | 3300048912 | Bacteria | 1909 |
| 248 | Ga0496109_0532668 | 3300048912 | Bacteria | 1108 |
| 249 | Ga0496110_0140435 | 3300048913 | Bacteria | 2184 |
| 250 | Ga0496110_0143414 | 3300048913 | Bacteria | 2159 |
| 251 | Ga0496111_0187154 | 3300048914 | Bacteria | 1539 |
| 252 | Ga0496112_0017956 | 3300048915 | Bacteria | 6657 |
| 253 | Ga0496112_0176611 | 3300048915 | Bacteria | 2100 |
| 254 | Ga0496112_0233660 | 3300048915 | Bacteria | 1793 |
| 255 | Ga0496113_0100288 | 3300048916 | Bacteria | 2243 |
| 256 | Ga0496113_0142276 | 3300048916 | Bacteria | 1888 |
| 257 | Ga0496114_0155326 | 3300048917 | Bacteria | 1986 |
| 258 | Ga0496115_0024003 | 3300048918 | Bacteria | 4737 |
| 259 | Ga0496115_0091188 | 3300048918 | Bacteria | 2490 |
| 260 | Ga0496115_0106653 | 3300048918 | Bacteria | 2300 |
| 261 | Ga0496117_0044315 | 3300048920 | Bacteria | 3224 |
| 262 | Ga0496117_0126931 | 3300048920 | Bacteria | 1555 |
| 263 | Ga0496118_0006290 | 3300048921 | Bacteria | 13129 |
| 264 | Ga0496118_0017966 | 3300048921 | Bacteria | 6409 |
| 265 | Ga0496118_0104498 | 3300048921 | Bacteria | 1901 |
| 266 | Ga0496121_0000270 | 3300048924 | Bacteria | 108787 |
| 267 | Ga0496121_0000370 | 3300048924 | Bacteria | 92397 |
| 268 | Ga0496121_0037256 | 3300048924 | Bacteria | 4322 |
| 269 | Ga0496122_0106742 | 3300048925 | Bacteria | 1853 |
| 270 | Ga0496124_0009011 | 3300048927 | Bacteria | 10323 |
| 271 | Ga0496126_0002460 | 3300048929 | Bacteria | 24974 |
| 272 | Ga0496126_0005304 | 3300048929 | Bacteria | 14797 |
| 273 | Ga0496126_0165042 | 3300048929 | Bacteria | 1890 |
| 274 | nmdc:mga00v17_84321_c1 | 3300050491 | Bacteria | 1989 |
| 275 | nmdc:mga0yw44_209358_c1 | 3300050492 | Bacteria | 1290 |
| 276 | nmdc:mga06z11_215877_c1 | 3300050494 | Bacteria | 1119 |
| 277 | nmdc:mga07m45_23488_c1 | 3300050496 | Bacteria | 3371 |
| 278 | nmdc:mga07m45_37357_c1 | 3300050496 | Bacteria | 2709 |
| 279 | nmdc:mga0n895_2738_c2 | 3300050512 | Bacteria | 5617 |
| 280 | nmdc:mga0rr50_252807_c1 | 3300050513 | Bacteria | 1464 |
| 281 | Ga0495612_0025372 | 3300053078 | Bacteria | 2380 |
| 282 | Ga0500581_128743 | 3300053089 | Bacteria | 1214 |
| 283 | Ga0500647_0052784 | 3300053091 | Bacteria | 1956 |
| 284 | Ga0500566_0000151 | 3300053094 | Bacteria | 35674 |
| 285 | Ga0500640_055806 | 3300053095 | Bacteria | 1720 |
| 286 | Ga0500641_0017212 | 3300053096 | Bacteria | 2700 |
| 287 | Ga0500595_028427 | 3300053119 | Bacteria | 1906 |
| 288 | Ga0500568_0003071 | 3300053139 | Bacteria | 9536 |
| 289 | Ga0500603_000295 | 3300053150 | Bacteria | 13130 |
| 290 | Ga0500603_039784 | 3300053150 | Bacteria | 1250 |
| 291 | Ga0500604_0021947 | 3300053151 | Bacteria | 1809 |
| 292 | Ga0500638_008140 | 3300053162 | Bacteria | 4450 |
| 293 | Ga0500645_015925 | 3300053730 | Bacteria | 2376 |
| 294 | Ga0500596_002798 | 3300053735 | Bacteria | 3408 |
| 295 | Ga0500601_004585 | 3300053737 | Bacteria | 1508 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0532668 | Ga0496109_0532668_22_1071 | 290 |
| 2 | 3300028573 | Ga0265334_10038168 | Ga0265334_100381682 | 294 |
| 3 | 3300048910 | Ga0496107_0001290 | Ga0496107_0001290_8929_9945 | 295 |
| 4 | 3300048918 | Ga0496115_0024003 | Ga0496115_0024003_30_1037 | 295 |
| 5 | 3300050494 | nmdc:mga06z11_215877_c1 | nmdc:mga06z11_215877_c1_22_1029 | 302 |
| 6 | iso_pu_bacteria | 2876808645 | 2876810838 | 309 |
| 7 | 3300053150 | Ga0500603_039784 | Ga0500603_039784_201_1235 | 311 |
| 8 | 3300009093 | Ga0105240_10395870 | Ga0105240_103958701 | 315 |
| 9 | 3300006175 | Ga0070712_100063311 | Ga0070712_1000633111 | 318 |
| 10 | 3300025915 | Ga0207693_10033379 | Ga0207693_100333794 | 318 |
| 11 | 3300005339 | Ga0070660_100082416 | Ga0070660_1000824162 | 322 |
| 12 | 3300005365 | Ga0070688_100101341 | Ga0070688_1001013412 | 322 |
| 13 | 3300035695 | Ga0373927_0048807 | Ga0373927_0048807_663_1787 | 322 |
| 14 | 3300006173 | Ga0070716_100145851 | Ga0070716_1001458512 | 325 |
| 15 | 3300010375 | Ga0105239_10016720 | Ga0105239_100167204 | 325 |
| 16 | 3300014325 | Ga0163163_10014099 | Ga0163163_100140999 | 325 |
| 17 | 3300050512 | nmdc:mga0n895_2738_c2 | nmdc:mga0n895_2738_c2_4519_5598 | 325 |
| 18 | 3300053091 | Ga0500647_0052784 | Ga0500647_0052784_522_1610 | 325 |
| 19 | 3300053094 | Ga0500566_0000151 | Ga0500566_0000151_25819_26907 | 325 |
| 20 | 3300053095 | Ga0500640_055806 | Ga0500640_055806_553_1641 | 325 |
| 21 | 3300053737 | Ga0500601_004585 | Ga0500601_004585_227_1315 | 325 |
| 22 | 3300005535 | Ga0070684_100012430 | Ga0070684_1000124304 | 326 |
| 23 | 3300025944 | Ga0207661_10006554 | Ga0207661_100065542 | 326 |
| 24 | 3300035724 | Ga0373933_0000031 | Ga0373933_0000031_32369_33457 | 326 |
| 25 | 3300053119 | Ga0500595_028427 | Ga0500595_028427_57_1145 | 327 |
| 26 | 3300005334 | Ga0068869_100115519 | Ga0068869_1001155192 | 328 |
| 27 | 3300005338 | Ga0068868_100073327 | Ga0068868_1000733271 | 328 |
| 28 | 3300005347 | Ga0070668_100012183 | Ga0070668_1000121834 | 328 |
| 29 | 3300005355 | Ga0070671_100306724 | Ga0070671_1003067241 | 328 |
| 30 | 3300005548 | Ga0070665_100035947 | Ga0070665_1000359473 | 328 |
| 31 | 3300005563 | Ga0068855_100062940 | Ga0068855_1000629403 | 328 |
| 32 | 3300005614 | Ga0068856_100055177 | Ga0068856_1000551772 | 328 |
| 33 | 3300005616 | Ga0068852_100243757 | Ga0068852_1002437572 | 328 |
| 34 | 3300005718 | Ga0068866_10063243 | Ga0068866_100632432 | 328 |
| 35 | 3300005842 | Ga0068858_100358916 | Ga0068858_1003589161 | 328 |
| 36 | 3300005843 | Ga0068860_100428239 | Ga0068860_1004282391 | 328 |
| 37 | 3300005844 | Ga0068862_100171151 | Ga0068862_1001711512 | 328 |
| 38 | 3300006038 | Ga0075365_10073586 | Ga0075365_100735862 | 328 |
| 39 | 3300006051 | Ga0075364_10022004 | Ga0075364_100220042 | 328 |
| 40 | 3300009101 | Ga0105247_10078572 | Ga0105247_100785721 | 328 |
| 41 | 3300009174 | Ga0105241_10056204 | Ga0105241_100562042 | 328 |
| 42 | 3300009545 | Ga0105237_10067653 | Ga0105237_100676532 | 328 |
| 43 | 3300009551 | Ga0105238_10121687 | Ga0105238_101216872 | 328 |
| 44 | 3300010375 | Ga0105239_10164228 | Ga0105239_101642282 | 328 |
| 45 | 3300011119 | Ga0105246_10047523 | Ga0105246_100475232 | 328 |
| 46 | 3300014325 | Ga0163163_10316314 | Ga0163163_103163142 | 328 |
| 47 | 3300014745 | Ga0157377_10116460 | Ga0157377_101164601 | 328 |
| 48 | 3300025900 | Ga0207710_10060392 | Ga0207710_100603922 | 328 |
| 49 | 3300025914 | Ga0207671_10024540 | Ga0207671_100245404 | 328 |
| 50 | 3300025935 | Ga0207709_10121157 | Ga0207709_101211572 | 328 |
| 51 | 3300025942 | Ga0207689_10030444 | Ga0207689_100304444 | 328 |
| 52 | 3300025949 | Ga0207667_10058734 | Ga0207667_100587342 | 328 |
| 53 | 3300025972 | Ga0207668_10031635 | Ga0207668_100316353 | 328 |
| 54 | 3300026023 | Ga0207677_10168165 | Ga0207677_101681652 | 328 |
| 55 | 3300026035 | Ga0207703_10029876 | Ga0207703_100298762 | 328 |
| 56 | 3300026041 | Ga0207639_10190381 | Ga0207639_101903812 | 328 |
| 57 | 3300026088 | Ga0207641_10126124 | Ga0207641_101261243 | 328 |
| 58 | 3300026095 | Ga0207676_10263100 | Ga0207676_102631001 | 328 |
| 59 | 3300026118 | Ga0207675_100094030 | Ga0207675_1000940302 | 328 |
| 60 | 3300026121 | Ga0207683_10059388 | Ga0207683_100593882 | 328 |
| 61 | 3300026142 | Ga0207698_10246855 | Ga0207698_102468552 | 328 |
| 62 | 3300028379 | Ga0268266_10072301 | Ga0268266_100723012 | 328 |
| 63 | 3300028379 | Ga0268266_10255519 | Ga0268266_102555192 | 328 |
| 64 | 3300028380 | Ga0268265_10170140 | Ga0268265_101701402 | 328 |
| 65 | 3300048907 | Ga0496104_0191488 | Ga0496104_0191488_581_1666 | 328 |
| 66 | 3300048911 | Ga0496108_0137282 | Ga0496108_0137282_465_1550 | 328 |
| 67 | 3300048912 | Ga0496109_0193843 | Ga0496109_0193843_800_1885 | 328 |
| 68 | 3300048920 | Ga0496117_0126931 | Ga0496117_0126931_120_1205 | 328 |
| 69 | 3300050491 | nmdc:mga00v17_84321_c1 | nmdc:mga00v17_84321_c1_212_1297 | 328 |
| 70 | 3300053139 | Ga0500568_0003071 | Ga0500568_0003071_7006_8094 | 328 |
| 71 | 3300053162 | Ga0500638_008140 | Ga0500638_008140_2733_3821 | 328 |
| 72 | 3300053735 | Ga0500596_002798 | Ga0500596_002798_262_1350 | 328 |
| 73 | 3300005338 | Ga0068868_100087203 | Ga0068868_1000872033 | 329 |
| 74 | 3300005435 | Ga0070714_100046652 | Ga0070714_1000466522 | 329 |
| 75 | 3300005539 | Ga0068853_100104000 | Ga0068853_1001040001 | 329 |
| 76 | 3300005548 | Ga0070665_100343951 | Ga0070665_1003439512 | 329 |
| 77 | 3300005844 | Ga0068862_100255732 | Ga0068862_1002557322 | 329 |
| 78 | 3300009551 | Ga0105238_10194831 | Ga0105238_101948312 | 329 |
| 79 | 3300025253 | Ga0209677_102510 | Ga0209677_1025104 | 329 |
| 80 | 3300025924 | Ga0207694_10160442 | Ga0207694_101604422 | 329 |
| 81 | 3300026041 | Ga0207639_10032737 | Ga0207639_100327371 | 329 |
| 82 | 3300026067 | Ga0207678_10134227 | Ga0207678_101342272 | 329 |
| 83 | 3300031616 | Ga0307508_10000002 | Ga0307508_1000000259 | 329 |
| 84 | 3300033544 | Ga0316215_1002165 | Ga0316215_10021652 | 329 |
| 85 | 3300037068 | Ga0373925_0030846 | Ga0373925_0030846_59_1147 | 329 |
| 86 | 3300046454 | Ga0495592_0074932 | Ga0495592_0074932_10_1098 | 329 |
| 87 | 3300046674 | Ga0495588_0121710 | Ga0495588_0121710_247_1335 | 329 |
| 88 | 3300046684 | Ga0495669_0023468 | Ga0495669_0023468_1406_2494 | 329 |
| 89 | 3300048929 | Ga0496126_0165042 | Ga0496126_0165042_713_1801 | 329 |
| 90 | 3300048915 | Ga0496112_0017956 | Ga0496112_0017956_1031_2152 | 332 |
| 91 | 3300009101 | Ga0105247_10106471 | Ga0105247_101064712 | 333 |
| 92 | 3300013296 | Ga0157374_10270505 | Ga0157374_102705052 | 333 |
| 93 | 3300013306 | Ga0163162_10033640 | Ga0163162_100336404 | 333 |
| 94 | 3300014968 | Ga0157379_10139468 | Ga0157379_101394683 | 333 |
| 95 | 3300014969 | Ga0157376_10194800 | Ga0157376_101948002 | 333 |
| 96 | 3300048905 | Ga0496102_0050275 | Ga0496102_0050275_1403_2527 | 333 |
| 97 | 3300048909 | Ga0496106_0017860 | Ga0496106_0017860_1662_2786 | 333 |
| 98 | 3300048912 | Ga0496109_0010061 | Ga0496109_0010061_5120_6244 | 333 |
| 99 | 3300048914 | Ga0496111_0187154 | Ga0496111_0187154_253_1377 | 333 |
| 100 | 3300048916 | Ga0496113_0142276 | Ga0496113_0142276_66_1190 | 333 |
| 101 | iso_pu_bacteria | 2728368998 | 2728754974 | 335 |
| 102 | iso_pu_bacteria | 2791355199 | 2793082765 | 335 |
| 103 | iso_pu_bacteria | 2844315083 | 2844315321 | 335 |
| 104 | iso_pu_bacteria | 2903727486 | 2903732182 | 335 |
| 105 | iso_pu_bacteria | 2906602504 | 2906604259 | 335 |
| 106 | iso_pu_bacteria | 3005710791 | 3005710983 | 335 |
| 107 | 3300005455 | Ga0070663_100171428 | Ga0070663_1001714282 | 336 |
| 108 | 3300005458 | Ga0070681_10061048 | Ga0070681_100610483 | 336 |
| 109 | 3300005530 | Ga0070679_100014297 | Ga0070679_1000142972 | 336 |
| 110 | 3300005548 | Ga0070665_100236648 | Ga0070665_1002366482 | 336 |
| 111 | 3300005577 | Ga0068857_100130483 | Ga0068857_1001304833 | 336 |
| 112 | 3300005937 | Ga0081455_10051915 | Ga0081455_100519152 | 336 |
| 113 | 3300006042 | Ga0075368_10019981 | Ga0075368_100199813 | 336 |
| 114 | 3300006051 | Ga0075364_10022250 | Ga0075364_100222502 | 336 |
| 115 | 3300009177 | Ga0105248_10102810 | Ga0105248_101028103 | 336 |
| 116 | 3300013297 | Ga0157378_10345811 | Ga0157378_103458112 | 336 |
| 117 | 3300025901 | Ga0207688_10172201 | Ga0207688_101722011 | 336 |
| 118 | 3300025904 | Ga0207647_10002277 | Ga0207647_100022779 | 336 |
| 119 | 3300025913 | Ga0207695_10078496 | Ga0207695_100784963 | 336 |
| 120 | 3300025917 | Ga0207660_10191048 | Ga0207660_101910483 | 336 |
| 121 | 3300025921 | Ga0207652_10012911 | Ga0207652_100129112 | 336 |
| 122 | 3300025931 | Ga0207644_10102917 | Ga0207644_101029172 | 336 |
| 123 | 3300026078 | Ga0207702_10296328 | Ga0207702_102963282 | 336 |
| 124 | 3300026116 | Ga0207674_10054507 | Ga0207674_100545071 | 336 |
| 125 | 3300027866 | Ga0209813_10009549 | Ga0209813_100095492 | 336 |
| 126 | 3300028379 | Ga0268266_10124787 | Ga0268266_101247873 | 336 |
| 127 | 3300031903 | Ga0307407_10064742 | Ga0307407_100647422 | 336 |
| 128 | 3300046519 | Ga0495632_0051613 | Ga0495632_0051613_665_1789 | 336 |
| 129 | 3300046522 | Ga0495643_0033370 | Ga0495643_0033370_803_1927 | 336 |
| 130 | 3300048905 | Ga0496102_0342174 | Ga0496102_0342174_217_1341 | 336 |
| 131 | 3300048906 | Ga0496103_0036997 | Ga0496103_0036997_1524_2648 | 336 |
| 132 | 3300048907 | Ga0496104_0080421 | Ga0496104_0080421_1354_2478 | 336 |
| 133 | 3300048916 | Ga0496113_0100288 | Ga0496113_0100288_697_1821 | 336 |
| 134 | 3300048921 | Ga0496118_0104498 | Ga0496118_0104498_181_1305 | 336 |
| 135 | 3300048925 | Ga0496122_0106742 | Ga0496122_0106742_48_1172 | 336 |
| 136 | 3300050492 | nmdc:mga0yw44_209358_c1 | nmdc:mga0yw44_209358_c1_150_1274 | 336 |
| 137 | 3300050496 | nmdc:mga07m45_37357_c1 | nmdc:mga07m45_37357_c1_636_1760 | 336 |
| 138 | 3300005456 | Ga0070678_100127908 | Ga0070678_1001279082 | 337 |
| 139 | 3300005719 | Ga0068861_100033316 | Ga0068861_1000333162 | 337 |
| 140 | iso_pu_bacteria | 2879110137 | 2879112156 | 337 |
| 141 | 3300005329 | Ga0070683_100012887 | Ga0070683_1000128876 | 338 |
| 142 | 3300005336 | Ga0070680_100012955 | Ga0070680_1000129558 | 338 |
| 143 | 3300005456 | Ga0070678_100166944 | Ga0070678_1001669442 | 338 |
| 144 | 3300005458 | Ga0070681_10034769 | Ga0070681_100347694 | 338 |
| 145 | 3300005471 | Ga0070698_100159902 | Ga0070698_1001599023 | 338 |
| 146 | 3300005530 | Ga0070679_100016181 | Ga0070679_1000161815 | 338 |
| 147 | 3300005563 | Ga0068855_100290809 | Ga0068855_1002908092 | 338 |
| 148 | 3300005577 | Ga0068857_100383894 | Ga0068857_1003838941 | 338 |
| 149 | 3300005937 | Ga0081455_10007101 | Ga0081455_1000710110 | 338 |
| 150 | 3300025912 | Ga0207707_10004560 | Ga0207707_100045603 | 338 |
| 151 | 3300025917 | Ga0207660_10013595 | Ga0207660_100135956 | 338 |
| 152 | 3300025944 | Ga0207661_10069776 | Ga0207661_100697762 | 338 |
| 153 | 3300026116 | Ga0207674_10341353 | Ga0207674_103413532 | 338 |
| 154 | 3300035113 | Ga0373936_0010980 | Ga0373936_0010980_839_1957 | 338 |
| 155 | 3300035692 | Ga0373935_0093165 | Ga0373935_0093165_561_1679 | 338 |
| 156 | 3300046475 | Ga0495639_0028279 | Ga0495639_0028279_337_1455 | 338 |
| 157 | 3300046514 | Ga0495618_0041623 | Ga0495618_0041623_1423_2589 | 338 |
| 158 | 3300046533 | Ga0495640_0007704 | Ga0495640_0007704_2785_3903 | 338 |
| 159 | 3300046543 | Ga0495645_0219142 | Ga0495645_0219142_97_1215 | 338 |
| 160 | 3300046642 | Ga0495634_0144262 | Ga0495634_0144262_28_1146 | 338 |
| 161 | 3300046683 | Ga0495658_0026888 | Ga0495658_0026888_253_1419 | 338 |
| 162 | 3300047319 | Ga0495674_0004075 | Ga0495674_0004075_1542_2660 | 338 |
| 163 | 3300047471 | Ga0495684_0014889 | Ga0495684_0014889_3187_4305 | 338 |
| 164 | 3300053078 | Ga0495612_0025372 | Ga0495612_0025372_1228_2346 | 338 |
| 165 | iso_pu_bacteria | 2889033259 | 2889035506 | 338 |
| 166 | 3300005985 | Ga0081539_10024516 | Ga0081539_100245163 | 339 |
| 167 | 3300028794 | Ga0307515_10085224 | Ga0307515_100852241 | 339 |
| 168 | 3300031730 | Ga0307516_10025182 | Ga0307516_100251824 | 339 |
| 169 | 3300037466 | Ga0395898_0166095 | Ga0395898_0166095_831_1952 | 339 |
| 170 | 3300048911 | Ga0496108_0002231 | Ga0496108_0002231_2690_3838 | 339 |
| 171 | 3300048918 | Ga0496115_0106653 | Ga0496115_0106653_394_1515 | 339 |
| 172 | 3300048924 | Ga0496121_0000270 | Ga0496121_0000270_15718_16842 | 339 |
| 173 | 3300000549 | LJQas_1004162 | LJQas_10041622 | 340 |
| 174 | 3300003203 | JGI25406J46586_10002429 | JGI25406J46586_100024298 | 340 |
| 175 | 3300003215 | JGI25153J46596_10002154 | JGI25153J46596_1000215410 | 340 |
| 176 | 3300003659 | JGI25404J52841_10004372 | JGI25404J52841_100043722 | 340 |
| 177 | 3300003659 | JGI25404J52841_10019661 | JGI25404J52841_100196611 | 340 |
| 178 | 3300005293 | Ga0065715_10130821 | Ga0065715_101308212 | 340 |
| 179 | 3300005331 | Ga0070670_100189464 | Ga0070670_1001894641 | 340 |
| 180 | 3300005336 | Ga0070680_100023219 | Ga0070680_1000232193 | 340 |
| 181 | 3300005337 | Ga0070682_100017949 | Ga0070682_1000179492 | 340 |
| 182 | 3300005347 | Ga0070668_100065341 | Ga0070668_1000653412 | 340 |
| 183 | 3300005434 | Ga0070709_10000584 | Ga0070709_1000058416 | 340 |
| 184 | 3300005435 | Ga0070714_100052413 | Ga0070714_1000524134 | 340 |
| 185 | 3300005435 | Ga0070714_100205453 | Ga0070714_1002054532 | 340 |
| 186 | 3300005436 | Ga0070713_100002424 | Ga0070713_10000242412 | 340 |
| 187 | 3300005436 | Ga0070713_100016180 | Ga0070713_1000161803 | 340 |
| 188 | 3300005437 | Ga0070710_10002528 | Ga0070710_100025286 | 340 |
| 189 | 3300005437 | Ga0070710_10204780 | Ga0070710_102047801 | 340 |
| 190 | 3300005439 | Ga0070711_100065139 | Ga0070711_1000651392 | 340 |
| 191 | 3300005445 | Ga0070708_100037573 | Ga0070708_1000375731 | 340 |
| 192 | 3300005456 | Ga0070678_100040432 | Ga0070678_1000404323 | 340 |
| 193 | 3300005458 | Ga0070681_10214005 | Ga0070681_102140052 | 340 |
| 194 | 3300005530 | Ga0070679_100014541 | Ga0070679_1000145416 | 340 |
| 195 | 3300005563 | Ga0068855_100157811 | Ga0068855_1001578113 | 340 |
| 196 | 3300005578 | Ga0068854_100205094 | Ga0068854_1002050941 | 340 |
| 197 | 3300005843 | Ga0068860_100075850 | Ga0068860_1000758503 | 340 |
| 198 | 3300005844 | Ga0068862_100303033 | Ga0068862_1003030332 | 340 |
| 199 | 3300005937 | Ga0081455_10004129 | Ga0081455_100041293 | 340 |
| 200 | 3300005937 | Ga0081455_10011042 | Ga0081455_100110426 | 340 |
| 201 | 3300005937 | Ga0081455_10062056 | Ga0081455_100620562 | 340 |
| 202 | 3300005981 | Ga0081538_10055867 | Ga0081538_100558672 | 340 |
| 203 | 3300005983 | Ga0081540_1005183 | Ga0081540_100518310 | 340 |
| 204 | 3300005983 | Ga0081540_1007567 | Ga0081540_10075677 | 340 |
| 205 | 3300005983 | Ga0081540_1014446 | Ga0081540_10144464 | 340 |
| 206 | 3300005983 | Ga0081540_1064400 | Ga0081540_10644002 | 340 |
| 207 | 3300005985 | Ga0081539_10005111 | Ga0081539_1000511117 | 340 |
| 208 | 3300006028 | Ga0070717_10000598 | Ga0070717_1000059812 | 340 |
| 209 | 3300006028 | Ga0070717_10009120 | Ga0070717_100091205 | 340 |
| 210 | 3300006028 | Ga0070717_10125103 | Ga0070717_101251032 | 340 |
| 211 | 3300006195 | Ga0075366_10124203 | Ga0075366_101242031 | 340 |
| 212 | 3300006353 | Ga0075370_10030969 | Ga0075370_100309692 | 340 |
| 213 | 3300006358 | Ga0068871_100092456 | Ga0068871_1000924561 | 340 |
| 214 | 3300006844 | Ga0075428_100022218 | Ga0075428_1000222184 | 340 |
| 215 | 3300006871 | Ga0075434_100281115 | Ga0075434_1002811152 | 340 |
| 216 | 3300006943 | Ga0099822_1000827 | Ga0099822_100082719 | 340 |
| 217 | 3300007076 | Ga0075435_100236211 | Ga0075435_1002362111 | 340 |
| 218 | 3300007265 | Ga0099794_10036826 | Ga0099794_100368262 | 340 |
| 219 | 3300007265 | Ga0099794_10100888 | Ga0099794_101008882 | 340 |
| 220 | 3300007788 | Ga0099795_10034339 | Ga0099795_100343392 | 340 |
| 221 | 3300009174 | Ga0105241_10051939 | Ga0105241_100519392 | 340 |
| 222 | 3300009545 | Ga0105237_10088220 | Ga0105237_100882202 | 340 |
| 223 | 3300009553 | Ga0105249_10302223 | Ga0105249_103022231 | 340 |
| 224 | 3300010159 | Ga0099796_10043914 | Ga0099796_100439141 | 340 |
| 225 | 3300010375 | Ga0105239_10157794 | Ga0105239_101577942 | 340 |
| 226 | 3300013306 | Ga0163162_10132028 | Ga0163162_101320282 | 340 |
| 227 | 3300014325 | Ga0163163_10053770 | Ga0163163_100537703 | 340 |
| 228 | 3300025297 | Ga0209758_1009343 | Ga0209758_10093432 | 340 |
| 229 | 3300025898 | Ga0207692_10037170 | Ga0207692_100371703 | 340 |
| 230 | 3300025900 | Ga0207710_10033158 | Ga0207710_100331582 | 340 |
| 231 | 3300025906 | Ga0207699_10002585 | Ga0207699_100025854 | 340 |
| 232 | 3300025906 | Ga0207699_10017413 | Ga0207699_100174133 | 340 |
| 233 | 3300025912 | Ga0207707_10000100 | Ga0207707_100001009 | 340 |
| 234 | 3300025914 | Ga0207671_10055238 | Ga0207671_100552382 | 340 |
| 235 | 3300025916 | Ga0207663_10150097 | Ga0207663_101500972 | 340 |
| 236 | 3300025917 | Ga0207660_10172934 | Ga0207660_101729342 | 340 |
| 237 | 3300025921 | Ga0207652_10002952 | Ga0207652_100029524 | 340 |
| 238 | 3300025924 | Ga0207694_10048783 | Ga0207694_100487833 | 340 |
| 239 | 3300025928 | Ga0207700_10001725 | Ga0207700_100017253 | 340 |
| 240 | 3300025929 | Ga0207664_10151924 | Ga0207664_101519242 | 340 |
| 241 | 3300025942 | Ga0207689_10129337 | Ga0207689_101293372 | 340 |
| 242 | 3300025972 | Ga0207668_10180466 | Ga0207668_101804661 | 340 |
| 243 | 3300026118 | Ga0207675_100295759 | Ga0207675_1002957592 | 340 |
| 244 | 3300026121 | Ga0207683_10080956 | Ga0207683_100809563 | 340 |
| 245 | 3300027357 | Ga0209589_1000021 | Ga0209589_1000021135 | 340 |
| 246 | 3300027361 | Ga0209489_100028 | Ga0209489_100028135 | 340 |
| 247 | 3300027363 | Ga0209700_100037 | Ga0209700_100037135 | 340 |
| 248 | 3300027671 | Ga0209588_1032920 | Ga0209588_10329201 | 340 |
| 249 | 3300028379 | Ga0268266_10003966 | Ga0268266_100039668 | 340 |
| 250 | 3300028380 | Ga0268265_10265838 | Ga0268265_102658382 | 340 |
| 251 | 3300028381 | Ga0268264_10088565 | Ga0268264_100885652 | 340 |
| 252 | 3300028381 | Ga0268264_10162390 | Ga0268264_101623902 | 340 |
| 253 | 3300028786 | Ga0307517_10001338 | Ga0307517_1000133819 | 340 |
| 254 | 3300030521 | Ga0307511_10081375 | Ga0307511_100813752 | 340 |
| 255 | 3300031249 | Ga0265339_10090643 | Ga0265339_100906431 | 340 |
| 256 | 3300031712 | Ga0265342_10003978 | Ga0265342_100039786 | 340 |
| 257 | 3300031730 | Ga0307516_10187066 | Ga0307516_101870662 | 340 |
| 258 | 3300032004 | Ga0307414_10235324 | Ga0307414_102353242 | 340 |
| 259 | 3300032126 | Ga0307415_100314062 | Ga0307415_1003140622 | 340 |
| 260 | 3300033180 | Ga0307510_10001271 | Ga0307510_100012719 | 340 |
| 261 | 3300033180 | Ga0307510_10082383 | Ga0307510_100823832 | 340 |
| 262 | 3300035695 | Ga0373927_0071896 | Ga0373927_0071896_810_1937 | 340 |
| 263 | 3300035695 | Ga0373927_0074229 | Ga0373927_0074229_419_1543 | 340 |
| 264 | 3300039437 | Ga0436365_1593949 | Ga0436365_1593949_257_1381 | 340 |
| 265 | 3300046455 | Ga0495603_0015386 | Ga0495603_0015386_2519_3643 | 340 |
| 266 | 3300046459 | Ga0495629_0040530 | Ga0495629_0040530_1619_2743 | 340 |
| 267 | 3300046460 | Ga0495638_0080333 | Ga0495638_0080333_265_1389 | 340 |
| 268 | 3300046473 | Ga0495582_0040207 | Ga0495582_0040207_172_1296 | 340 |
| 269 | 3300046506 | Ga0495583_0034391 | Ga0495583_0034391_571_1740 | 340 |
| 270 | 3300046524 | Ga0495648_0064012 | Ga0495648_0064012_901_2070 | 340 |
| 271 | 3300046558 | Ga0495633_0023633 | Ga0495633_0023633_1837_3006 | 340 |
| 272 | 3300046664 | Ga0495659_0011528 | Ga0495659_0011528_1623_2792 | 340 |
| 273 | 3300046684 | Ga0495669_0075790 | Ga0495669_0075790_98_1222 | 340 |
| 274 | 3300047315 | Ga0495581_0175602 | Ga0495581_0175602_58_1182 | 340 |
| 275 | 3300047321 | Ga0495676_0077461 | Ga0495676_0077461_67_1236 | 340 |
| 276 | 3300048904 | Ga0496101_0129368 | Ga0496101_0129368_605_1732 | 340 |
| 277 | 3300048905 | Ga0496102_0198621 | Ga0496102_0198621_117_1244 | 340 |
| 278 | 3300048906 | Ga0496103_0171060 | Ga0496103_0171060_28_1152 | 340 |
| 279 | 3300048907 | Ga0496104_0110053 | Ga0496104_0110053_873_2000 | 340 |
| 280 | 3300048908 | Ga0496105_0093606 | Ga0496105_0093606_34_1161 | 340 |
| 281 | 3300048909 | Ga0496106_0001270 | Ga0496106_0001270_8807_9985 | 340 |
| 282 | 3300048911 | Ga0496108_0116469 | Ga0496108_0116469_362_1486 | 340 |
| 283 | 3300048912 | Ga0496109_0128618 | Ga0496109_0128618_417_1547 | 340 |
| 284 | 3300048913 | Ga0496110_0140435 | Ga0496110_0140435_73_1197 | 340 |
| 285 | 3300048913 | Ga0496110_0143414 | Ga0496110_0143414_269_1396 | 340 |
| 286 | 3300048915 | Ga0496112_0176611 | Ga0496112_0176611_384_1511 | 340 |
| 287 | 3300048915 | Ga0496112_0233660 | Ga0496112_0233660_587_1711 | 340 |
| 288 | 3300048917 | Ga0496114_0155326 | Ga0496114_0155326_27_1154 | 340 |
| 289 | 3300048918 | Ga0496115_0091188 | Ga0496115_0091188_751_1878 | 340 |
| 290 | 3300048920 | Ga0496117_0044315 | Ga0496117_0044315_1753_2931 | 340 |
| 291 | 3300048921 | Ga0496118_0006290 | Ga0496118_0006290_3505_4638 | 340 |
| 292 | 3300048921 | Ga0496118_0017966 | Ga0496118_0017966_3256_4434 | 340 |
| 293 | 3300048924 | Ga0496121_0000370 | Ga0496121_0000370_14112_15290 | 340 |
| 294 | 3300048924 | Ga0496121_0037256 | Ga0496121_0037256_450_1574 | 340 |
| 295 | 3300048927 | Ga0496124_0009011 | Ga0496124_0009011_7969_9147 | 340 |
| 296 | 3300048929 | Ga0496126_0002460 | Ga0496126_0002460_3296_4420 | 340 |
| 297 | 3300048929 | Ga0496126_0005304 | Ga0496126_0005304_2758_3936 | 340 |
| 298 | 3300050496 | nmdc:mga07m45_23488_c1 | nmdc:mga07m45_23488_c1_1273_2397 | 340 |
| 299 | 3300050513 | nmdc:mga0rr50_252807_c1 | nmdc:mga0rr50_252807_c1_136_1260 | 340 |
| 300 | 3300053089 | Ga0500581_128743 | Ga0500581_128743_58_1182 | 340 |
| 301 | 3300053096 | Ga0500641_0017212 | Ga0500641_0017212_212_1336 | 340 |
| 302 | 3300053150 | Ga0500603_000295 | Ga0500603_000295_2684_3832 | 340 |
| 303 | 3300053151 | Ga0500604_0021947 | Ga0500604_0021947_503_1627 | 340 |
| 304 | 3300053730 | Ga0500645_015925 | Ga0500645_015925_308_1432 | 340 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dwl-assembly1.cif.gz_C | avd molecule from bordetella bacteriophage dgr | 0.4254 | 227 | 335 |
| 4dwl-assembly1.cif.gz_C | avd molecule from bordetella bacteriophage dgr | 0.3983 | 227 | 335 |
| 8a6m-assembly1.cif.gz_A | phosphatidylserine-dependent synaptic vesicle membrane sculpting by synaptogyrin | 0.3371 | 219 | 340 |
| 8a6m-assembly1.cif.gz_A | phosphatidylserine-dependent synaptic vesicle membrane sculpting by synaptogyrin | 0.2799 | 219 | 340 |
| 8i9w-assembly1.cif.gz_CH | cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - dbp10-3 | 0.2767 | 178 | 333 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_G5EGK1_693_820_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.492 | 226 | 336 | 1.20.120.230 |
| af_A0A0R4IDZ8_661_785_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.4796 | 226 | 336 | 1.20.120.230 |
| af_P26039_661_785_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.4684 | 226 | 336 | 1.20.120.230 |
| af_D3ZA84_664_788_1.20.120.230 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.4646 | 226 | 336 | 1.20.120.230 |
| 1jqiA03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.4603 | 226 | 336 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537SK85-F1-model_v4 | Uncharacterized protein | 0.7731 | 193 | 340 |
GO:0016020
|
| AF-A0A537SK85-F1-model_v4 | Uncharacterized protein | 0.7686 | 193 | 340 |
GO:0016020
|
| AF-A0A0D7PF57-F1-model_v4 | EpsG family protein | 0.7043 | 1 | 340 |
GO:0016020
|
| AF-A0A0D7PF57-F1-model_v4 | EpsG family protein | 0.7025 | 1 | 340 |
GO:0016020
|
| AF-A0A533J5D9-F1-model_v4 | deleted | 0.6907 | 1 | 300 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar