F397371

General Info

Members Datasets Scaffolds Average Seq Length
304 210 295 367

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10002429|JGI25406J46586_100024298
Length 408
Sequence MVVMGPGVRRDDSGSLLATCKPCDNPPVISLGGAMNLRVWQNPWRLMLAVNAAVFVGVFLYKITLPPYVPYIHLLVDYYFGFTKRALIGAVIALFTAKVPVWLVFALAGATWLATLALFIQLFRRTFGLDEKHLPLFVFMAGSPFFLKNFMHTLGHFDIYGCLLAICLLLLPARSVAYVLLAASFSVVLMLVHHIHVLLYVPTIAAIVVLRYYLPEGITPQNAIAGLVAFAISGLLFIALQFYGTIEVPPQVFVDHLRSRMIDPSQTKLLAFAYIWYQPLSKEIADTWAWLPHNILGIPLFALLIWLHIPLWRYFAGLIGALASDMHRRIVIAALMTVSAGYLLMFAIVFDYSRWVSNWAVCMFLILHAVKTLPASRETPLIPSDDTKTTIFGAIVTLIPRVGIVRPF

Samples

Sample ID Description Type Environment
1 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
2 2791355199
3 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
4 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
5 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
6 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
7 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
8 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
9 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
10 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
120 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
121 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
199 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
209 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
210 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.36
Metatranscriptomes 0
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.54
Nodule 1.97
Rhizoplane 10.53
Rhizosphere 68.09
Stem 0
Stem Tuber 0
Unclassified 9.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004162 3300000549 Bacteria 1896
2 JGI25406J46586_10002429 3300003203 Bacteria 8810
3 JGI25153J46596_10002154 3300003215 Bacteria 11522
4 JGI25404J52841_10004372 3300003659 Bacteria 2858
5 JGI25404J52841_10019661 3300003659 Bacteria 1463
6 Ga0065715_10130821 3300005293 Bacteria 2019
7 Ga0070683_100012887 3300005329 Bacteria 7276
8 Ga0070670_100189464 3300005331 Bacteria 1786
9 Ga0068869_100115519 3300005334 Bacteria 2047
10 Ga0070680_100012955 3300005336 Bacteria 6485
11 Ga0070680_100023219 3300005336 Bacteria 4945
12 Ga0070682_100017949 3300005337 Bacteria 4128
13 Ga0068868_100073327 3300005338 Bacteria 2733
14 Ga0068868_100087203 3300005338 Bacteria 2510
15 Ga0070660_100082416 3300005339 Bacteria 2526
16 Ga0070668_100012183 3300005347 Bacteria 6404
17 Ga0070668_100065341 3300005347 Bacteria 2822
18 Ga0070671_100306724 3300005355 Bacteria 1352
19 Ga0070688_100101341 3300005365 Bacteria 1899
20 Ga0070709_10000584 3300005434 Bacteria 21359
21 Ga0070714_100046652 3300005435 Bacteria 3677
22 Ga0070714_100052413 3300005435 Bacteria 3479
23 Ga0070714_100205453 3300005435 Bacteria 1803
24 Ga0070713_100002424 3300005436 Bacteria 12160
25 Ga0070713_100016180 3300005436 Bacteria 5606
26 Ga0070710_10002528 3300005437 Bacteria 8679
27 Ga0070710_10204780 3300005437 Bacteria 1248
28 Ga0070711_100065139 3300005439 Bacteria 2547
29 Ga0070708_100037573 3300005445 Bacteria 4225
30 Ga0070663_100171428 3300005455 Bacteria 1678
31 Ga0070678_100040432 3300005456 Bacteria 3300
32 Ga0070678_100127908 3300005456 Bacteria 2014
33 Ga0070678_100166944 3300005456 Bacteria 1789
34 Ga0070681_10034769 3300005458 Bacteria 5061
35 Ga0070681_10061048 3300005458 Bacteria 3746
36 Ga0070681_10214005 3300005458 Bacteria 1843
37 Ga0070698_100159902 3300005471 Bacteria 2197
38 Ga0070679_100014297 3300005530 Bacteria 7623
39 Ga0070679_100014541 3300005530 Bacteria 7561
40 Ga0070679_100016181 3300005530 Bacteria 7186
41 Ga0070684_100012430 3300005535 Bacteria 6823
42 Ga0068853_100104000 3300005539 Bacteria 2514
43 Ga0070665_100035947 3300005548 Bacteria 4983
44 Ga0070665_100236648 3300005548 Bacteria 1827
45 Ga0070665_100343951 3300005548 Bacteria 1496
46 Ga0068855_100062940 3300005563 Bacteria 4330
47 Ga0068855_100157811 3300005563 Bacteria 2577
48 Ga0068855_100290809 3300005563 Bacteria 1811
49 Ga0068857_100130483 3300005577 Bacteria 2266
50 Ga0068857_100383894 3300005577 Bacteria 1305
51 Ga0068854_100205094 3300005578 Bacteria 1552
52 Ga0068856_100055177 3300005614 Bacteria 3921
53 Ga0068852_100243757 3300005616 Bacteria 1719
54 Ga0068866_10063243 3300005718 Bacteria 1928
55 Ga0068861_100033316 3300005719 Bacteria 3799
56 Ga0068858_100358916 3300005842 Bacteria 1397
57 Ga0068860_100075850 3300005843 Bacteria 3197
58 Ga0068860_100428239 3300005843 Bacteria 1313
59 Ga0068862_100171151 3300005844 Bacteria 1945
60 Ga0068862_100255732 3300005844 Bacteria 1597
61 Ga0068862_100303033 3300005844 Bacteria 1470
62 Ga0081455_10004129 3300005937 Bacteria 16422
63 Ga0081455_10007101 3300005937 Bacteria 11861
64 Ga0081455_10011042 3300005937 Bacteria 9097
65 Ga0081455_10051915 3300005937 Bacteria 3514
66 Ga0081455_10062056 3300005937 Bacteria 3143
67 Ga0081538_10055867 3300005981 Bacteria 2319
68 Ga0081540_1005183 3300005983 Bacteria 9759
69 Ga0081540_1007567 3300005983 Bacteria 7722
70 Ga0081540_1014446 3300005983 Bacteria 5057
71 Ga0081540_1064400 3300005983 Bacteria 1730
72 Ga0081539_10005111 3300005985 Bacteria 13729
73 Ga0081539_10024516 3300005985 Bacteria 3910
74 Ga0070717_10000598 3300006028 Bacteria 23163
75 Ga0070717_10009120 3300006028 Bacteria 7451
76 Ga0070717_10125103 3300006028 Bacteria 2206
77 Ga0075365_10073586 3300006038 Bacteria 2303
78 Ga0075368_10019981 3300006042 Bacteria 2532
79 Ga0075364_10022004 3300006051 Bacteria 4022
80 Ga0075364_10022250 3300006051 Bacteria 4001
81 Ga0070716_100145851 3300006173 Bacteria 1516
82 Ga0070712_100063311 3300006175 Bacteria 2618
83 Ga0075366_10124203 3300006195 Bacteria 1556
84 Ga0075370_10030969 3300006353 Bacteria 2985
85 Ga0068871_100092456 3300006358 Bacteria 2523
86 Ga0075428_100022218 3300006844 Bacteria 7024
87 Ga0075434_100281115 3300006871 Bacteria 1684
88 Ga0099822_1000827 3300006943 Bacteria 32648
89 Ga0075435_100236211 3300007076 Bacteria 1554
90 Ga0099794_10036826 3300007265 Bacteria 2314
91 Ga0099794_10100888 3300007265 Bacteria 1441
92 Ga0099795_10034339 3300007788 Bacteria 1767
93 Ga0105240_10395870 3300009093 Bacteria 1557
94 Ga0105247_10078572 3300009101 Bacteria 2076
95 Ga0105247_10106471 3300009101 Bacteria 1799
96 Ga0105241_10051939 3300009174 Bacteria 3128
97 Ga0105241_10056204 3300009174 Bacteria 3017
98 Ga0105248_10102810 3300009177 Bacteria 3220
99 Ga0105237_10067653 3300009545 Bacteria 3566
100 Ga0105237_10088220 3300009545 Bacteria 3091
101 Ga0105238_10121687 3300009551 Bacteria 2589
102 Ga0105238_10194831 3300009551 Bacteria 2002
103 Ga0105249_10302223 3300009553 Bacteria 1605
104 Ga0099796_10043914 3300010159 Bacteria 1525
105 Ga0105239_10016720 3300010375 Bacteria 8108
106 Ga0105239_10157794 3300010375 Bacteria 2534
107 Ga0105239_10164228 3300010375 Bacteria 2482
108 Ga0105246_10047523 3300011119 Bacteria 2931
109 Ga0157374_10270505 3300013296 Bacteria 1675
110 Ga0157378_10345811 3300013297 Bacteria 1451
111 Ga0163162_10033640 3300013306 Bacteria 5095
112 Ga0163162_10132028 3300013306 Bacteria 2606
113 Ga0163163_10014099 3300014325 Bacteria 7340
114 Ga0163163_10053770 3300014325 Bacteria 3976
115 Ga0163163_10316314 3300014325 Bacteria 1615
116 Ga0157377_10116460 3300014745 Bacteria 1614
117 Ga0157379_10139468 3300014968 Bacteria 2185
118 Ga0157376_10194800 3300014969 Bacteria 1861
119 Ga0209677_102510 3300025253 Bacteria 6840
120 Ga0209758_1009343 3300025297 Bacteria 6115
121 Ga0207692_10037170 3300025898 Bacteria 2380
122 Ga0207710_10033158 3300025900 Bacteria 2264
123 Ga0207710_10060392 3300025900 Bacteria 1718
124 Ga0207688_10172201 3300025901 Bacteria 1288
125 Ga0207647_10002277 3300025904 Bacteria 14628
126 Ga0207699_10002585 3300025906 Bacteria 8534
127 Ga0207699_10017413 3300025906 Bacteria 3780
128 Ga0207707_10000100 3300025912 Bacteria 85682
129 Ga0207707_10004560 3300025912 Bacteria 12178
130 Ga0207695_10078496 3300025913 Bacteria 3349
131 Ga0207671_10024540 3300025914 Bacteria 4531
132 Ga0207671_10055238 3300025914 Bacteria 2942
133 Ga0207693_10033379 3300025915 Bacteria 4061
134 Ga0207663_10150097 3300025916 Bacteria 1634
135 Ga0207660_10013595 3300025917 Bacteria 5336
136 Ga0207660_10172934 3300025917 Bacteria 1673
137 Ga0207660_10191048 3300025917 Bacteria 1595
138 Ga0207652_10002952 3300025921 Bacteria 14213
139 Ga0207652_10012911 3300025921 Bacteria 6756
140 Ga0207694_10048783 3300025924 Bacteria 3277
141 Ga0207694_10160442 3300025924 Bacteria 1816
142 Ga0207700_10001725 3300025928 Bacteria 12413
143 Ga0207664_10151924 3300025929 Bacteria 1968
144 Ga0207644_10102917 3300025931 Bacteria 2148
145 Ga0207709_10121157 3300025935 Bacteria 1766
146 Ga0207689_10030444 3300025942 Bacteria 4498
147 Ga0207689_10129337 3300025942 Bacteria 2078
148 Ga0207661_10006554 3300025944 Bacteria 8230
149 Ga0207661_10069776 3300025944 Bacteria 2866
150 Ga0207667_10058734 3300025949 Bacteria 4032
151 Ga0207668_10031635 3300025972 Bacteria 3487
152 Ga0207668_10180466 3300025972 Bacteria 1664
153 Ga0207677_10168165 3300026023 Bacteria 1711
154 Ga0207703_10029876 3300026035 Bacteria 4303
155 Ga0207639_10032737 3300026041 Bacteria 3829
156 Ga0207639_10190381 3300026041 Bacteria 1752
157 Ga0207678_10134227 3300026067 Bacteria 2112
158 Ga0207702_10296328 3300026078 Bacteria 1534
159 Ga0207641_10126124 3300026088 Bacteria 2292
160 Ga0207676_10263100 3300026095 Bacteria 1558
161 Ga0207674_10054507 3300026116 Bacteria 4070
162 Ga0207674_10341353 3300026116 Bacteria 1448
163 Ga0207675_100094030 3300026118 Bacteria 2820
164 Ga0207675_100295759 3300026118 Bacteria 1576
165 Ga0207683_10059388 3300026121 Bacteria 3359
166 Ga0207683_10080956 3300026121 Bacteria 2881
167 Ga0207698_10246855 3300026142 Bacteria 1631
168 Ga0209589_1000021 3300027357 Bacteria 186431
169 Ga0209489_100028 3300027361 Bacteria 186431
170 Ga0209700_100037 3300027363 Bacteria 186431
171 Ga0209588_1032920 3300027671 Bacteria 1662
172 Ga0209813_10009549 3300027866 Bacteria 2486
173 Ga0268266_10003966 3300028379 Bacteria 14358
174 Ga0268266_10072301 3300028379 Bacteria 2990
175 Ga0268266_10124787 3300028379 Bacteria 2296
176 Ga0268266_10255519 3300028379 Bacteria 1622
177 Ga0268265_10170140 3300028380 Bacteria 1861
178 Ga0268265_10265838 3300028380 Bacteria 1527
179 Ga0268264_10088565 3300028381 Bacteria 2664
180 Ga0268264_10162390 3300028381 Bacteria 2014
181 Ga0265334_10038168 3300028573 Bacteria 1891
182 Ga0307517_10001338 3300028786 Bacteria 41372
183 Ga0307515_10085224 3300028794 Bacteria 4046
184 Ga0307511_10081375 3300030521 Bacteria 2274
185 Ga0265339_10090643 3300031249 Bacteria 1603
186 Ga0307508_10000002 3300031616 Bacteria 407635
187 Ga0265342_10003978 3300031712 Bacteria 11831
188 Ga0307516_10025182 3300031730 Bacteria 6061
189 Ga0307516_10187066 3300031730 Bacteria 1800
190 Ga0307407_10064742 3300031903 Bacteria 2150
191 Ga0307414_10235324 3300032004 Bacteria 1513
192 Ga0307415_100314062 3300032126 Bacteria 1304
193 Ga0307510_10001271 3300033180 Bacteria 27493
194 Ga0307510_10082383 3300033180 Bacteria 3113
195 Ga0316215_1002165 3300033544 Bacteria 1857
196 Ga0373936_0010980 3300035113 Bacteria 3423
197 Ga0373935_0093165 3300035692 Bacteria 1975
198 Ga0373927_0048807 3300035695 Bacteria 2738
199 Ga0373927_0071896 3300035695 Bacteria 2239
200 Ga0373927_0074229 3300035695 Bacteria 2202
201 Ga0373933_0000031 3300035724 Bacteria 85038
202 Ga0373925_0030846 3300037068 Bacteria 3936
203 Ga0395898_0166095 3300037466 Bacteria 2111
204 Ga0436365_1593949 3300039437 Bacteria 1626
205 Ga0495592_0074932 3300046454 Bacteria 2458
206 Ga0495603_0015386 3300046455 Bacteria 4628
207 Ga0495629_0040530 3300046459 Bacteria 3276
208 Ga0495638_0080333 3300046460 Bacteria 1981
209 Ga0495582_0040207 3300046473 Bacteria 2575
210 Ga0495639_0028279 3300046475 Bacteria 2483
211 Ga0495583_0034391 3300046506 Bacteria 2428
212 Ga0495618_0041623 3300046514 Bacteria 2894
213 Ga0495632_0051613 3300046519 Bacteria 2024
214 Ga0495643_0033370 3300046522 Bacteria 2848
215 Ga0495648_0064012 3300046524 Bacteria 2168
216 Ga0495640_0007704 3300046533 Bacteria 8471
217 Ga0495645_0219142 3300046543 Bacteria 1281
218 Ga0495633_0023633 3300046558 Bacteria 3043
219 Ga0495634_0144262 3300046642 Bacteria 1509
220 Ga0495659_0011528 3300046664 Bacteria 2848
221 Ga0495588_0121710 3300046674 Bacteria 1375
222 Ga0495658_0026888 3300046683 Bacteria 3089
223 Ga0495669_0023468 3300046684 Bacteria 2685
224 Ga0495669_0075790 3300046684 Bacteria 1539
225 Ga0495581_0175602 3300047315 Bacteria 1252
226 Ga0495674_0004075 3300047319 Bacteria 14133
227 Ga0495676_0077461 3300047321 Bacteria 2535
228 Ga0495684_0014889 3300047471 Bacteria 5989
229 Ga0496101_0129368 3300048904 Bacteria 1916
230 Ga0496102_0050275 3300048905 Bacteria 3795
231 Ga0496102_0198621 3300048905 Bacteria 1890
232 Ga0496102_0342174 3300048905 Bacteria 1408
233 Ga0496103_0036997 3300048906 Bacteria 2990
234 Ga0496103_0171060 3300048906 Bacteria 1395
235 Ga0496104_0080421 3300048907 Bacteria 3107
236 Ga0496104_0110053 3300048907 Bacteria 2640
237 Ga0496104_0191488 3300048907 Bacteria 1957
238 Ga0496105_0093606 3300048908 Bacteria 2481
239 Ga0496106_0001270 3300048909 Bacteria 18908
240 Ga0496106_0017860 3300048909 Bacteria 5246
241 Ga0496107_0001290 3300048910 Bacteria 15326
242 Ga0496108_0002231 3300048911 Bacteria 15526
243 Ga0496108_0116469 3300048911 Bacteria 2289
244 Ga0496108_0137282 3300048911 Bacteria 2105
245 Ga0496109_0010061 3300048912 Bacteria 8071
246 Ga0496109_0128618 3300048912 Bacteria 2363
247 Ga0496109_0193843 3300048912 Bacteria 1909
248 Ga0496109_0532668 3300048912 Bacteria 1108
249 Ga0496110_0140435 3300048913 Bacteria 2184
250 Ga0496110_0143414 3300048913 Bacteria 2159
251 Ga0496111_0187154 3300048914 Bacteria 1539
252 Ga0496112_0017956 3300048915 Bacteria 6657
253 Ga0496112_0176611 3300048915 Bacteria 2100
254 Ga0496112_0233660 3300048915 Bacteria 1793
255 Ga0496113_0100288 3300048916 Bacteria 2243
256 Ga0496113_0142276 3300048916 Bacteria 1888
257 Ga0496114_0155326 3300048917 Bacteria 1986
258 Ga0496115_0024003 3300048918 Bacteria 4737
259 Ga0496115_0091188 3300048918 Bacteria 2490
260 Ga0496115_0106653 3300048918 Bacteria 2300
261 Ga0496117_0044315 3300048920 Bacteria 3224
262 Ga0496117_0126931 3300048920 Bacteria 1555
263 Ga0496118_0006290 3300048921 Bacteria 13129
264 Ga0496118_0017966 3300048921 Bacteria 6409
265 Ga0496118_0104498 3300048921 Bacteria 1901
266 Ga0496121_0000270 3300048924 Bacteria 108787
267 Ga0496121_0000370 3300048924 Bacteria 92397
268 Ga0496121_0037256 3300048924 Bacteria 4322
269 Ga0496122_0106742 3300048925 Bacteria 1853
270 Ga0496124_0009011 3300048927 Bacteria 10323
271 Ga0496126_0002460 3300048929 Bacteria 24974
272 Ga0496126_0005304 3300048929 Bacteria 14797
273 Ga0496126_0165042 3300048929 Bacteria 1890
274 nmdc:mga00v17_84321_c1 3300050491 Bacteria 1989
275 nmdc:mga0yw44_209358_c1 3300050492 Bacteria 1290
276 nmdc:mga06z11_215877_c1 3300050494 Bacteria 1119
277 nmdc:mga07m45_23488_c1 3300050496 Bacteria 3371
278 nmdc:mga07m45_37357_c1 3300050496 Bacteria 2709
279 nmdc:mga0n895_2738_c2 3300050512 Bacteria 5617
280 nmdc:mga0rr50_252807_c1 3300050513 Bacteria 1464
281 Ga0495612_0025372 3300053078 Bacteria 2380
282 Ga0500581_128743 3300053089 Bacteria 1214
283 Ga0500647_0052784 3300053091 Bacteria 1956
284 Ga0500566_0000151 3300053094 Bacteria 35674
285 Ga0500640_055806 3300053095 Bacteria 1720
286 Ga0500641_0017212 3300053096 Bacteria 2700
287 Ga0500595_028427 3300053119 Bacteria 1906
288 Ga0500568_0003071 3300053139 Bacteria 9536
289 Ga0500603_000295 3300053150 Bacteria 13130
290 Ga0500603_039784 3300053150 Bacteria 1250
291 Ga0500604_0021947 3300053151 Bacteria 1809
292 Ga0500638_008140 3300053162 Bacteria 4450
293 Ga0500645_015925 3300053730 Bacteria 2376
294 Ga0500596_002798 3300053735 Bacteria 3408
295 Ga0500601_004585 3300053737 Bacteria 1508

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0532668 Ga0496109_0532668_22_1071 290
2 3300028573 Ga0265334_10038168 Ga0265334_100381682 294
3 3300048910 Ga0496107_0001290 Ga0496107_0001290_8929_9945 295
4 3300048918 Ga0496115_0024003 Ga0496115_0024003_30_1037 295
5 3300050494 nmdc:mga06z11_215877_c1 nmdc:mga06z11_215877_c1_22_1029 302
6 iso_pu_bacteria 2876808645 2876810838 309
7 3300053150 Ga0500603_039784 Ga0500603_039784_201_1235 311
8 3300009093 Ga0105240_10395870 Ga0105240_103958701 315
9 3300006175 Ga0070712_100063311 Ga0070712_1000633111 318
10 3300025915 Ga0207693_10033379 Ga0207693_100333794 318
11 3300005339 Ga0070660_100082416 Ga0070660_1000824162 322
12 3300005365 Ga0070688_100101341 Ga0070688_1001013412 322
13 3300035695 Ga0373927_0048807 Ga0373927_0048807_663_1787 322
14 3300006173 Ga0070716_100145851 Ga0070716_1001458512 325
15 3300010375 Ga0105239_10016720 Ga0105239_100167204 325
16 3300014325 Ga0163163_10014099 Ga0163163_100140999 325
17 3300050512 nmdc:mga0n895_2738_c2 nmdc:mga0n895_2738_c2_4519_5598 325
18 3300053091 Ga0500647_0052784 Ga0500647_0052784_522_1610 325
19 3300053094 Ga0500566_0000151 Ga0500566_0000151_25819_26907 325
20 3300053095 Ga0500640_055806 Ga0500640_055806_553_1641 325
21 3300053737 Ga0500601_004585 Ga0500601_004585_227_1315 325
22 3300005535 Ga0070684_100012430 Ga0070684_1000124304 326
23 3300025944 Ga0207661_10006554 Ga0207661_100065542 326
24 3300035724 Ga0373933_0000031 Ga0373933_0000031_32369_33457 326
25 3300053119 Ga0500595_028427 Ga0500595_028427_57_1145 327
26 3300005334 Ga0068869_100115519 Ga0068869_1001155192 328
27 3300005338 Ga0068868_100073327 Ga0068868_1000733271 328
28 3300005347 Ga0070668_100012183 Ga0070668_1000121834 328
29 3300005355 Ga0070671_100306724 Ga0070671_1003067241 328
30 3300005548 Ga0070665_100035947 Ga0070665_1000359473 328
31 3300005563 Ga0068855_100062940 Ga0068855_1000629403 328
32 3300005614 Ga0068856_100055177 Ga0068856_1000551772 328
33 3300005616 Ga0068852_100243757 Ga0068852_1002437572 328
34 3300005718 Ga0068866_10063243 Ga0068866_100632432 328
35 3300005842 Ga0068858_100358916 Ga0068858_1003589161 328
36 3300005843 Ga0068860_100428239 Ga0068860_1004282391 328
37 3300005844 Ga0068862_100171151 Ga0068862_1001711512 328
38 3300006038 Ga0075365_10073586 Ga0075365_100735862 328
39 3300006051 Ga0075364_10022004 Ga0075364_100220042 328
40 3300009101 Ga0105247_10078572 Ga0105247_100785721 328
41 3300009174 Ga0105241_10056204 Ga0105241_100562042 328
42 3300009545 Ga0105237_10067653 Ga0105237_100676532 328
43 3300009551 Ga0105238_10121687 Ga0105238_101216872 328
44 3300010375 Ga0105239_10164228 Ga0105239_101642282 328
45 3300011119 Ga0105246_10047523 Ga0105246_100475232 328
46 3300014325 Ga0163163_10316314 Ga0163163_103163142 328
47 3300014745 Ga0157377_10116460 Ga0157377_101164601 328
48 3300025900 Ga0207710_10060392 Ga0207710_100603922 328
49 3300025914 Ga0207671_10024540 Ga0207671_100245404 328
50 3300025935 Ga0207709_10121157 Ga0207709_101211572 328
51 3300025942 Ga0207689_10030444 Ga0207689_100304444 328
52 3300025949 Ga0207667_10058734 Ga0207667_100587342 328
53 3300025972 Ga0207668_10031635 Ga0207668_100316353 328
54 3300026023 Ga0207677_10168165 Ga0207677_101681652 328
55 3300026035 Ga0207703_10029876 Ga0207703_100298762 328
56 3300026041 Ga0207639_10190381 Ga0207639_101903812 328
57 3300026088 Ga0207641_10126124 Ga0207641_101261243 328
58 3300026095 Ga0207676_10263100 Ga0207676_102631001 328
59 3300026118 Ga0207675_100094030 Ga0207675_1000940302 328
60 3300026121 Ga0207683_10059388 Ga0207683_100593882 328
61 3300026142 Ga0207698_10246855 Ga0207698_102468552 328
62 3300028379 Ga0268266_10072301 Ga0268266_100723012 328
63 3300028379 Ga0268266_10255519 Ga0268266_102555192 328
64 3300028380 Ga0268265_10170140 Ga0268265_101701402 328
65 3300048907 Ga0496104_0191488 Ga0496104_0191488_581_1666 328
66 3300048911 Ga0496108_0137282 Ga0496108_0137282_465_1550 328
67 3300048912 Ga0496109_0193843 Ga0496109_0193843_800_1885 328
68 3300048920 Ga0496117_0126931 Ga0496117_0126931_120_1205 328
69 3300050491 nmdc:mga00v17_84321_c1 nmdc:mga00v17_84321_c1_212_1297 328
70 3300053139 Ga0500568_0003071 Ga0500568_0003071_7006_8094 328
71 3300053162 Ga0500638_008140 Ga0500638_008140_2733_3821 328
72 3300053735 Ga0500596_002798 Ga0500596_002798_262_1350 328
73 3300005338 Ga0068868_100087203 Ga0068868_1000872033 329
74 3300005435 Ga0070714_100046652 Ga0070714_1000466522 329
75 3300005539 Ga0068853_100104000 Ga0068853_1001040001 329
76 3300005548 Ga0070665_100343951 Ga0070665_1003439512 329
77 3300005844 Ga0068862_100255732 Ga0068862_1002557322 329
78 3300009551 Ga0105238_10194831 Ga0105238_101948312 329
79 3300025253 Ga0209677_102510 Ga0209677_1025104 329
80 3300025924 Ga0207694_10160442 Ga0207694_101604422 329
81 3300026041 Ga0207639_10032737 Ga0207639_100327371 329
82 3300026067 Ga0207678_10134227 Ga0207678_101342272 329
83 3300031616 Ga0307508_10000002 Ga0307508_1000000259 329
84 3300033544 Ga0316215_1002165 Ga0316215_10021652 329
85 3300037068 Ga0373925_0030846 Ga0373925_0030846_59_1147 329
86 3300046454 Ga0495592_0074932 Ga0495592_0074932_10_1098 329
87 3300046674 Ga0495588_0121710 Ga0495588_0121710_247_1335 329
88 3300046684 Ga0495669_0023468 Ga0495669_0023468_1406_2494 329
89 3300048929 Ga0496126_0165042 Ga0496126_0165042_713_1801 329
90 3300048915 Ga0496112_0017956 Ga0496112_0017956_1031_2152 332
91 3300009101 Ga0105247_10106471 Ga0105247_101064712 333
92 3300013296 Ga0157374_10270505 Ga0157374_102705052 333
93 3300013306 Ga0163162_10033640 Ga0163162_100336404 333
94 3300014968 Ga0157379_10139468 Ga0157379_101394683 333
95 3300014969 Ga0157376_10194800 Ga0157376_101948002 333
96 3300048905 Ga0496102_0050275 Ga0496102_0050275_1403_2527 333
97 3300048909 Ga0496106_0017860 Ga0496106_0017860_1662_2786 333
98 3300048912 Ga0496109_0010061 Ga0496109_0010061_5120_6244 333
99 3300048914 Ga0496111_0187154 Ga0496111_0187154_253_1377 333
100 3300048916 Ga0496113_0142276 Ga0496113_0142276_66_1190 333
101 iso_pu_bacteria 2728368998 2728754974 335
102 iso_pu_bacteria 2791355199 2793082765 335
103 iso_pu_bacteria 2844315083 2844315321 335
104 iso_pu_bacteria 2903727486 2903732182 335
105 iso_pu_bacteria 2906602504 2906604259 335
106 iso_pu_bacteria 3005710791 3005710983 335
107 3300005455 Ga0070663_100171428 Ga0070663_1001714282 336
108 3300005458 Ga0070681_10061048 Ga0070681_100610483 336
109 3300005530 Ga0070679_100014297 Ga0070679_1000142972 336
110 3300005548 Ga0070665_100236648 Ga0070665_1002366482 336
111 3300005577 Ga0068857_100130483 Ga0068857_1001304833 336
112 3300005937 Ga0081455_10051915 Ga0081455_100519152 336
113 3300006042 Ga0075368_10019981 Ga0075368_100199813 336
114 3300006051 Ga0075364_10022250 Ga0075364_100222502 336
115 3300009177 Ga0105248_10102810 Ga0105248_101028103 336
116 3300013297 Ga0157378_10345811 Ga0157378_103458112 336
117 3300025901 Ga0207688_10172201 Ga0207688_101722011 336
118 3300025904 Ga0207647_10002277 Ga0207647_100022779 336
119 3300025913 Ga0207695_10078496 Ga0207695_100784963 336
120 3300025917 Ga0207660_10191048 Ga0207660_101910483 336
121 3300025921 Ga0207652_10012911 Ga0207652_100129112 336
122 3300025931 Ga0207644_10102917 Ga0207644_101029172 336
123 3300026078 Ga0207702_10296328 Ga0207702_102963282 336
124 3300026116 Ga0207674_10054507 Ga0207674_100545071 336
125 3300027866 Ga0209813_10009549 Ga0209813_100095492 336
126 3300028379 Ga0268266_10124787 Ga0268266_101247873 336
127 3300031903 Ga0307407_10064742 Ga0307407_100647422 336
128 3300046519 Ga0495632_0051613 Ga0495632_0051613_665_1789 336
129 3300046522 Ga0495643_0033370 Ga0495643_0033370_803_1927 336
130 3300048905 Ga0496102_0342174 Ga0496102_0342174_217_1341 336
131 3300048906 Ga0496103_0036997 Ga0496103_0036997_1524_2648 336
132 3300048907 Ga0496104_0080421 Ga0496104_0080421_1354_2478 336
133 3300048916 Ga0496113_0100288 Ga0496113_0100288_697_1821 336
134 3300048921 Ga0496118_0104498 Ga0496118_0104498_181_1305 336
135 3300048925 Ga0496122_0106742 Ga0496122_0106742_48_1172 336
136 3300050492 nmdc:mga0yw44_209358_c1 nmdc:mga0yw44_209358_c1_150_1274 336
137 3300050496 nmdc:mga07m45_37357_c1 nmdc:mga07m45_37357_c1_636_1760 336
138 3300005456 Ga0070678_100127908 Ga0070678_1001279082 337
139 3300005719 Ga0068861_100033316 Ga0068861_1000333162 337
140 iso_pu_bacteria 2879110137 2879112156 337
141 3300005329 Ga0070683_100012887 Ga0070683_1000128876 338
142 3300005336 Ga0070680_100012955 Ga0070680_1000129558 338
143 3300005456 Ga0070678_100166944 Ga0070678_1001669442 338
144 3300005458 Ga0070681_10034769 Ga0070681_100347694 338
145 3300005471 Ga0070698_100159902 Ga0070698_1001599023 338
146 3300005530 Ga0070679_100016181 Ga0070679_1000161815 338
147 3300005563 Ga0068855_100290809 Ga0068855_1002908092 338
148 3300005577 Ga0068857_100383894 Ga0068857_1003838941 338
149 3300005937 Ga0081455_10007101 Ga0081455_1000710110 338
150 3300025912 Ga0207707_10004560 Ga0207707_100045603 338
151 3300025917 Ga0207660_10013595 Ga0207660_100135956 338
152 3300025944 Ga0207661_10069776 Ga0207661_100697762 338
153 3300026116 Ga0207674_10341353 Ga0207674_103413532 338
154 3300035113 Ga0373936_0010980 Ga0373936_0010980_839_1957 338
155 3300035692 Ga0373935_0093165 Ga0373935_0093165_561_1679 338
156 3300046475 Ga0495639_0028279 Ga0495639_0028279_337_1455 338
157 3300046514 Ga0495618_0041623 Ga0495618_0041623_1423_2589 338
158 3300046533 Ga0495640_0007704 Ga0495640_0007704_2785_3903 338
159 3300046543 Ga0495645_0219142 Ga0495645_0219142_97_1215 338
160 3300046642 Ga0495634_0144262 Ga0495634_0144262_28_1146 338
161 3300046683 Ga0495658_0026888 Ga0495658_0026888_253_1419 338
162 3300047319 Ga0495674_0004075 Ga0495674_0004075_1542_2660 338
163 3300047471 Ga0495684_0014889 Ga0495684_0014889_3187_4305 338
164 3300053078 Ga0495612_0025372 Ga0495612_0025372_1228_2346 338
165 iso_pu_bacteria 2889033259 2889035506 338
166 3300005985 Ga0081539_10024516 Ga0081539_100245163 339
167 3300028794 Ga0307515_10085224 Ga0307515_100852241 339
168 3300031730 Ga0307516_10025182 Ga0307516_100251824 339
169 3300037466 Ga0395898_0166095 Ga0395898_0166095_831_1952 339
170 3300048911 Ga0496108_0002231 Ga0496108_0002231_2690_3838 339
171 3300048918 Ga0496115_0106653 Ga0496115_0106653_394_1515 339
172 3300048924 Ga0496121_0000270 Ga0496121_0000270_15718_16842 339
173 3300000549 LJQas_1004162 LJQas_10041622 340
174 3300003203 JGI25406J46586_10002429 JGI25406J46586_100024298 340
175 3300003215 JGI25153J46596_10002154 JGI25153J46596_1000215410 340
176 3300003659 JGI25404J52841_10004372 JGI25404J52841_100043722 340
177 3300003659 JGI25404J52841_10019661 JGI25404J52841_100196611 340
178 3300005293 Ga0065715_10130821 Ga0065715_101308212 340
179 3300005331 Ga0070670_100189464 Ga0070670_1001894641 340
180 3300005336 Ga0070680_100023219 Ga0070680_1000232193 340
181 3300005337 Ga0070682_100017949 Ga0070682_1000179492 340
182 3300005347 Ga0070668_100065341 Ga0070668_1000653412 340
183 3300005434 Ga0070709_10000584 Ga0070709_1000058416 340
184 3300005435 Ga0070714_100052413 Ga0070714_1000524134 340
185 3300005435 Ga0070714_100205453 Ga0070714_1002054532 340
186 3300005436 Ga0070713_100002424 Ga0070713_10000242412 340
187 3300005436 Ga0070713_100016180 Ga0070713_1000161803 340
188 3300005437 Ga0070710_10002528 Ga0070710_100025286 340
189 3300005437 Ga0070710_10204780 Ga0070710_102047801 340
190 3300005439 Ga0070711_100065139 Ga0070711_1000651392 340
191 3300005445 Ga0070708_100037573 Ga0070708_1000375731 340
192 3300005456 Ga0070678_100040432 Ga0070678_1000404323 340
193 3300005458 Ga0070681_10214005 Ga0070681_102140052 340
194 3300005530 Ga0070679_100014541 Ga0070679_1000145416 340
195 3300005563 Ga0068855_100157811 Ga0068855_1001578113 340
196 3300005578 Ga0068854_100205094 Ga0068854_1002050941 340
197 3300005843 Ga0068860_100075850 Ga0068860_1000758503 340
198 3300005844 Ga0068862_100303033 Ga0068862_1003030332 340
199 3300005937 Ga0081455_10004129 Ga0081455_100041293 340
200 3300005937 Ga0081455_10011042 Ga0081455_100110426 340
201 3300005937 Ga0081455_10062056 Ga0081455_100620562 340
202 3300005981 Ga0081538_10055867 Ga0081538_100558672 340
203 3300005983 Ga0081540_1005183 Ga0081540_100518310 340
204 3300005983 Ga0081540_1007567 Ga0081540_10075677 340
205 3300005983 Ga0081540_1014446 Ga0081540_10144464 340
206 3300005983 Ga0081540_1064400 Ga0081540_10644002 340
207 3300005985 Ga0081539_10005111 Ga0081539_1000511117 340
208 3300006028 Ga0070717_10000598 Ga0070717_1000059812 340
209 3300006028 Ga0070717_10009120 Ga0070717_100091205 340
210 3300006028 Ga0070717_10125103 Ga0070717_101251032 340
211 3300006195 Ga0075366_10124203 Ga0075366_101242031 340
212 3300006353 Ga0075370_10030969 Ga0075370_100309692 340
213 3300006358 Ga0068871_100092456 Ga0068871_1000924561 340
214 3300006844 Ga0075428_100022218 Ga0075428_1000222184 340
215 3300006871 Ga0075434_100281115 Ga0075434_1002811152 340
216 3300006943 Ga0099822_1000827 Ga0099822_100082719 340
217 3300007076 Ga0075435_100236211 Ga0075435_1002362111 340
218 3300007265 Ga0099794_10036826 Ga0099794_100368262 340
219 3300007265 Ga0099794_10100888 Ga0099794_101008882 340
220 3300007788 Ga0099795_10034339 Ga0099795_100343392 340
221 3300009174 Ga0105241_10051939 Ga0105241_100519392 340
222 3300009545 Ga0105237_10088220 Ga0105237_100882202 340
223 3300009553 Ga0105249_10302223 Ga0105249_103022231 340
224 3300010159 Ga0099796_10043914 Ga0099796_100439141 340
225 3300010375 Ga0105239_10157794 Ga0105239_101577942 340
226 3300013306 Ga0163162_10132028 Ga0163162_101320282 340
227 3300014325 Ga0163163_10053770 Ga0163163_100537703 340
228 3300025297 Ga0209758_1009343 Ga0209758_10093432 340
229 3300025898 Ga0207692_10037170 Ga0207692_100371703 340
230 3300025900 Ga0207710_10033158 Ga0207710_100331582 340
231 3300025906 Ga0207699_10002585 Ga0207699_100025854 340
232 3300025906 Ga0207699_10017413 Ga0207699_100174133 340
233 3300025912 Ga0207707_10000100 Ga0207707_100001009 340
234 3300025914 Ga0207671_10055238 Ga0207671_100552382 340
235 3300025916 Ga0207663_10150097 Ga0207663_101500972 340
236 3300025917 Ga0207660_10172934 Ga0207660_101729342 340
237 3300025921 Ga0207652_10002952 Ga0207652_100029524 340
238 3300025924 Ga0207694_10048783 Ga0207694_100487833 340
239 3300025928 Ga0207700_10001725 Ga0207700_100017253 340
240 3300025929 Ga0207664_10151924 Ga0207664_101519242 340
241 3300025942 Ga0207689_10129337 Ga0207689_101293372 340
242 3300025972 Ga0207668_10180466 Ga0207668_101804661 340
243 3300026118 Ga0207675_100295759 Ga0207675_1002957592 340
244 3300026121 Ga0207683_10080956 Ga0207683_100809563 340
245 3300027357 Ga0209589_1000021 Ga0209589_1000021135 340
246 3300027361 Ga0209489_100028 Ga0209489_100028135 340
247 3300027363 Ga0209700_100037 Ga0209700_100037135 340
248 3300027671 Ga0209588_1032920 Ga0209588_10329201 340
249 3300028379 Ga0268266_10003966 Ga0268266_100039668 340
250 3300028380 Ga0268265_10265838 Ga0268265_102658382 340
251 3300028381 Ga0268264_10088565 Ga0268264_100885652 340
252 3300028381 Ga0268264_10162390 Ga0268264_101623902 340
253 3300028786 Ga0307517_10001338 Ga0307517_1000133819 340
254 3300030521 Ga0307511_10081375 Ga0307511_100813752 340
255 3300031249 Ga0265339_10090643 Ga0265339_100906431 340
256 3300031712 Ga0265342_10003978 Ga0265342_100039786 340
257 3300031730 Ga0307516_10187066 Ga0307516_101870662 340
258 3300032004 Ga0307414_10235324 Ga0307414_102353242 340
259 3300032126 Ga0307415_100314062 Ga0307415_1003140622 340
260 3300033180 Ga0307510_10001271 Ga0307510_100012719 340
261 3300033180 Ga0307510_10082383 Ga0307510_100823832 340
262 3300035695 Ga0373927_0071896 Ga0373927_0071896_810_1937 340
263 3300035695 Ga0373927_0074229 Ga0373927_0074229_419_1543 340
264 3300039437 Ga0436365_1593949 Ga0436365_1593949_257_1381 340
265 3300046455 Ga0495603_0015386 Ga0495603_0015386_2519_3643 340
266 3300046459 Ga0495629_0040530 Ga0495629_0040530_1619_2743 340
267 3300046460 Ga0495638_0080333 Ga0495638_0080333_265_1389 340
268 3300046473 Ga0495582_0040207 Ga0495582_0040207_172_1296 340
269 3300046506 Ga0495583_0034391 Ga0495583_0034391_571_1740 340
270 3300046524 Ga0495648_0064012 Ga0495648_0064012_901_2070 340
271 3300046558 Ga0495633_0023633 Ga0495633_0023633_1837_3006 340
272 3300046664 Ga0495659_0011528 Ga0495659_0011528_1623_2792 340
273 3300046684 Ga0495669_0075790 Ga0495669_0075790_98_1222 340
274 3300047315 Ga0495581_0175602 Ga0495581_0175602_58_1182 340
275 3300047321 Ga0495676_0077461 Ga0495676_0077461_67_1236 340
276 3300048904 Ga0496101_0129368 Ga0496101_0129368_605_1732 340
277 3300048905 Ga0496102_0198621 Ga0496102_0198621_117_1244 340
278 3300048906 Ga0496103_0171060 Ga0496103_0171060_28_1152 340
279 3300048907 Ga0496104_0110053 Ga0496104_0110053_873_2000 340
280 3300048908 Ga0496105_0093606 Ga0496105_0093606_34_1161 340
281 3300048909 Ga0496106_0001270 Ga0496106_0001270_8807_9985 340
282 3300048911 Ga0496108_0116469 Ga0496108_0116469_362_1486 340
283 3300048912 Ga0496109_0128618 Ga0496109_0128618_417_1547 340
284 3300048913 Ga0496110_0140435 Ga0496110_0140435_73_1197 340
285 3300048913 Ga0496110_0143414 Ga0496110_0143414_269_1396 340
286 3300048915 Ga0496112_0176611 Ga0496112_0176611_384_1511 340
287 3300048915 Ga0496112_0233660 Ga0496112_0233660_587_1711 340
288 3300048917 Ga0496114_0155326 Ga0496114_0155326_27_1154 340
289 3300048918 Ga0496115_0091188 Ga0496115_0091188_751_1878 340
290 3300048920 Ga0496117_0044315 Ga0496117_0044315_1753_2931 340
291 3300048921 Ga0496118_0006290 Ga0496118_0006290_3505_4638 340
292 3300048921 Ga0496118_0017966 Ga0496118_0017966_3256_4434 340
293 3300048924 Ga0496121_0000370 Ga0496121_0000370_14112_15290 340
294 3300048924 Ga0496121_0037256 Ga0496121_0037256_450_1574 340
295 3300048927 Ga0496124_0009011 Ga0496124_0009011_7969_9147 340
296 3300048929 Ga0496126_0002460 Ga0496126_0002460_3296_4420 340
297 3300048929 Ga0496126_0005304 Ga0496126_0005304_2758_3936 340
298 3300050496 nmdc:mga07m45_23488_c1 nmdc:mga07m45_23488_c1_1273_2397 340
299 3300050513 nmdc:mga0rr50_252807_c1 nmdc:mga0rr50_252807_c1_136_1260 340
300 3300053089 Ga0500581_128743 Ga0500581_128743_58_1182 340
301 3300053096 Ga0500641_0017212 Ga0500641_0017212_212_1336 340
302 3300053150 Ga0500603_000295 Ga0500603_000295_2684_3832 340
303 3300053151 Ga0500604_0021947 Ga0500604_0021947_503_1627 340
304 3300053730 Ga0500645_015925 Ga0500645_015925_308_1432 340

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dwl-assembly1.cif.gz_C avd molecule from bordetella bacteriophage dgr 0.4254 227 335
4dwl-assembly1.cif.gz_C avd molecule from bordetella bacteriophage dgr 0.3983 227 335
8a6m-assembly1.cif.gz_A phosphatidylserine-dependent synaptic vesicle membrane sculpting by synaptogyrin 0.3371 219 340
8a6m-assembly1.cif.gz_A phosphatidylserine-dependent synaptic vesicle membrane sculpting by synaptogyrin 0.2799 219 340
8i9w-assembly1.cif.gz_CH cryo-em structure of a chaetomium thermophilum pre-60s ribosomal subunit - dbp10-3 0.2767 178 333
ID Description Score Start End Superfamily
af_G5EGK1_693_820_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.492 226 336 1.20.120.230
af_A0A0R4IDZ8_661_785_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4796 226 336 1.20.120.230
af_P26039_661_785_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4684 226 336 1.20.120.230
af_D3ZA84_664_788_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4646 226 336 1.20.120.230
1jqiA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4603 226 336 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A537SK85-F1-model_v4 Uncharacterized protein 0.7731 193 340 GO:0016020
AF-A0A537SK85-F1-model_v4 Uncharacterized protein 0.7686 193 340 GO:0016020
AF-A0A0D7PF57-F1-model_v4 EpsG family protein 0.7043 1 340 GO:0016020
AF-A0A0D7PF57-F1-model_v4 EpsG family protein 0.7025 1 340 GO:0016020
AF-A0A533J5D9-F1-model_v4 deleted 0.6907 1 300

Feature Viewer

pLDDT pTM Quality
65.6 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map