F397497

General Info

Members Datasets Scaffolds Average Seq Length
304 248 608 181

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1111920|Ga0081540_11119202
Length 181
Sequence LAARRIGIARLEVIVADITTLGVDAIVNAANSTLLGGGGVDGAIHRAAGPELLTECRTLHGCNTGDAKITKGYRLKARHVIHAVGPVWNGGGGEDALLASCYRRAIELCQDNDLASVAFPAISTGVYRFPPDRAAGIAVSATVVALATASAVNRVIFCCFSRDSATLHEQALEGFGSPCPD

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
27 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
53 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
54 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
76 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
77 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
78 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
88 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
106 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
165 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
166 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
167 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
170 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
176 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
177 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
178 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
179 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
180 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
181 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
182 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
183 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
184 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
185 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
186 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
187 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
188 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
189 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
190 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
191 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
192 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
193 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
194 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
195 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
196 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
197 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
198 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
199 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
200 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
201 2904699407
202 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
203 2906610324
204 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
205 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
206 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
207 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
208 2922368715
209 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
210 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
211 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
212 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
213 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
214 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
215 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
216 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
217 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
218 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
219 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
220 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
221 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
222 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
223 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
224 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
225 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
226 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
227 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
228 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
229 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
230 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
231 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
232 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
233 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
234 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
235 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
236 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
237 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
238 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
239 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
240 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
241 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
242 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
243 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
244 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
245 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
246 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
247 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
248 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.41
Metatranscriptomes 0
Isolates 22.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.58
Nodule 19.08
Rhizoplane 12.5
Rhizosphere 49.67
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1111920 3300005983 Bacteria 1152
2 JGI25404J52841_10048861 3300003659 Bacteria 890
3 Ga0070690_100392046 3300005330 Bacteria 1018
4 Ga0070670_100509727 3300005331 Bacteria 1070
5 Ga0070661_100222082 3300005344 Bacteria 1450
6 Ga0070671_100466729 3300005355 Bacteria 1084
7 Ga0070673_100028843 3300005364 Bacteria 4132
8 Ga0070688_100013163 3300005365 Bacteria 4658
9 Ga0070713_100974149 3300005436 Bacteria 817
10 Ga0070663_100022795 3300005455 Bacteria 4190
11 Ga0070678_100025693 3300005456 Bacteria 3968
12 Ga0070706_100093833 3300005467 Bacteria 2785
13 Ga0070698_101050188 3300005471 Bacteria 762
14 Ga0070699_100245248 3300005518 Bacteria 1600
15 Ga0068853_100138858 3300005539 Bacteria 2181
16 Ga0070672_100077983 3300005543 Bacteria 2650
17 Ga0068855_100776422 3300005563 Bacteria 1020
18 Ga0068856_100414649 3300005614 Bacteria 1367
19 Ga0068852_100485247 3300005616 Bacteria 1229
20 Ga0068858_100406449 3300005842 Bacteria 1308
21 Ga0081455_10002712 3300005937 Bacteria 20903
22 Ga0081455_10509796 3300005937 Bacteria 806
23 Ga0081540_1017894 3300005983 Bacteria 4369
24 Ga0081540_1060133 3300005983 Bacteria 1820
25 Ga0075365_10186796 3300006038 Bacteria 1449
26 Ga0075367_10161896 3300006178 Bacteria 1392
27 Ga0068871_100440979 3300006358 Bacteria 1166
28 Ga0068865_100074849 3300006881 Bacteria 2413
29 Ga0099824_1022493 3300006942 Bacteria 4146
30 Ga0099824_1023475 3300006942 Bacteria 3818
31 Ga0099822_1011696 3300006943 Bacteria 10656
32 Ga0099822_1081312 3300006943 Bacteria 791
33 Ga0105240_10063664 3300009093 Bacteria 4586
34 Ga0111539_10345914 3300009094 Bacteria 1731
35 Ga0111539_10461407 3300009094 Bacteria 1479
36 Ga0105245_10170522 3300009098 Bacteria 2072
37 Ga0105247_10113590 3300009101 Bacteria 1746
38 Ga0105247_10130299 3300009101 Bacteria 1639
39 Ga0114129_12719969 3300009147 Bacteria 589
40 Ga0105243_10124766 3300009148 Bacteria 2176
41 Ga0105243_10200877 3300009148 Bacteria 1748
42 Ga0105243_11765876 3300009148 Bacteria 649
43 Ga0105241_10043010 3300009174 Bacteria 3420
44 Ga0105241_10308288 3300009174 Bacteria 1361
45 Ga0105241_11216510 3300009174 Bacteria 714
46 Ga0105248_10316743 3300009177 Bacteria 1757
47 Ga0105237_10229882 3300009545 Bacteria 1855
48 Ga0105238_10330421 3300009551 Bacteria 1511
49 Ga0105238_10509652 3300009551 Bacteria 1205
50 Ga0105033_103065 3300009986 Bacteria 1397
51 Ga0099796_10009409 3300010159 Bacteria 2645
52 Ga0105239_10014449 3300010375 Bacteria 8761
53 Ga0105246_10374871 3300011119 Bacteria 1174
54 Ga0157315_1022708 3300012508 Bacteria 677
55 Ga0157369_10048997 3300013105 Bacteria 4581
56 Ga0157374_11227127 3300013296 Bacteria 771
57 Ga0157378_10273636 3300013297 Bacteria 1625
58 Ga0163162_10530945 3300013306 Bacteria 1306
59 Ga0157375_10134073 3300013308 Bacteria 2598
60 Ga0157375_10989995 3300013308 Bacteria 981
61 Ga0163163_10186512 3300014325 Bacteria 2122
62 Ga0157380_10069144 3300014326 Bacteria 2848
63 Ga0157380_10317624 3300014326 Bacteria 1443
64 Ga0157379_10419941 3300014968 Bacteria 1231
65 Ga0157376_10212871 3300014969 Bacteria 1785
66 Ga0157376_10401442 3300014969 Bacteria 1326
67 Ga0214542_1000024 3300021321 Bacteria 191218
68 Ga0214545_1000011 3300021324 Bacteria 190550
69 Ga0214543_1000033 3300021327 Bacteria 190419
70 Ga0213876_10007651 3300021384 Bacteria 5867
71 Ga0228598_1040196 3300024227 Bacteria 923
72 Ga0209758_1025789 3300025297 Bacteria 2567
73 Ga0209758_1091107 3300025297 Bacteria 893
74 Ga0207682_10003948 3300025893 Bacteria 6320
75 Ga0207710_10117190 3300025900 Bacteria 1269
76 Ga0207680_10544740 3300025903 Bacteria 828
77 Ga0207671_10171472 3300025914 Bacteria 1685
78 Ga0207663_10038259 3300025916 Bacteria 2898
79 Ga0207649_10593727 3300025920 Bacteria 851
80 Ga0207694_10303566 3300025924 Bacteria 1315
81 Ga0207709_10784191 3300025935 Bacteria 768
82 Ga0207669_10015872 3300025937 Bacteria 3810
83 Ga0207669_11319797 3300025937 Unclassified 613
84 Ga0207691_10011683 3300025940 Bacteria 8432
85 Ga0207667_10652992 3300025949 Bacteria 1057
86 Ga0207712_10076025 3300025961 Bacteria 2429
87 Ga0207639_10078938 3300026041 Bacteria 2600
88 Ga0207678_10028231 3300026067 Bacteria 4900
89 Ga0207678_10691325 3300026067 Bacteria 897
90 Ga0207648_10013191 3300026089 Bacteria 7701
91 Ga0207676_10657962 3300026095 Bacteria 1012
92 Ga0207683_10007852 3300026121 Bacteria 9131
93 Ga0209389_1000025 3300027296 Bacteria 149588
94 Ga0209589_1000018 3300027357 Bacteria 192614
95 Ga0209489_100026 3300027361 Bacteria 192614
96 Ga0209489_100030 3300027361 Bacteria 185999
97 Ga0209700_100035 3300027363 Bacteria 192614
98 Ga0265320_10013630 3300031240 Bacteria 4664
99 Ga0265325_10035504 3300031241 Bacteria 2647
100 Ga0265339_10002576 3300031249 Bacteria 12919
101 Ga0265316_10190648 3300031344 Bacteria 1523
102 Ga0265313_10001715 3300031595 Bacteria 20184
103 Ga0265314_10042063 3300031711 Bacteria 3263
104 Ga0265342_10001457 3300031712 Bacteria 22030
105 Ga0307510_10109725 3300033180 Bacteria 2507
106 Ga0315911_1000011 3300033442 Bacteria 264678
107 Ga0373958_0026490 3300034819 Bacteria 1111
108 Ga0373945_0365499 3300035116 Bacteria 628
109 Ga0373956_0114615 3300035119 Bacteria 1256
110 Ga0373960_0030982 3300035121 Bacteria 1493
111 Ga0373943_0035999 3300035170 Bacteria 2369
112 Ga0373946_0270760 3300035171 Bacteria 833
113 Ga0373935_0209980 3300035692 Bacteria 1349
114 Ga0373935_0577731 3300035692 Bacteria 821
115 Ga0373927_0034443 3300035695 Bacteria 3294
116 Ga0373947_0133217 3300035725 Bacteria 1588
117 Ga0373947_0320395 3300035725 Bacteria 1037
118 Ga0373937_0560102 3300036401 Bacteria 1086
119 Ga0373925_0346497 3300037068 Bacteria 1206
120 Ga0373925_0376337 3300037068 Bacteria 1156
121 Ga0395899_0083436 3300037312 Bacteria 2324
122 Ga0395900_0552588 3300037418 Bacteria 1096
123 Ga0395898_0069971 3300037466 Bacteria 3394
124 Ga0395898_0085456 3300037466 Bacteria 3041
125 Ga0436364_0192984 3300037853 Bacteria 1090
126 Ga0436364_0369009 3300037853 Bacteria 1975
127 Ga0395901_0100187 3300038443 Bacteria 3038
128 Ga0436365_0414414 3300039437 Bacteria 44510
129 Ga0451837_1293914 3300041494 Bacteria 1760
130 Ga0439459_0043953 3300042438 Bacteria 959
131 Ga0466972_0002534 3300044658 Bacteria 9036
132 Ga0466967_0731917 3300045976 Bacteria 981
133 Ga0495592_0553293 3300046454 Bacteria 707
134 Ga0495603_0223215 3300046455 Bacteria 1087
135 Ga0495638_0151419 3300046460 Bacteria 1345
136 Ga0495651_0482173 3300046462 Bacteria 796
137 Ga0495582_0366403 3300046473 Bacteria 830
138 Ga0495582_0441958 3300046473 Bacteria 751
139 Ga0495664_0030332 3300046477 Bacteria 3167
140 Ga0495664_0272966 3300046477 Bacteria 1022
141 Ga0495608_0048831 3300046511 Bacteria 2811
142 Ga0495608_0185022 3300046511 Bacteria 1317
143 Ga0495620_0049813 3300046515 Bacteria 1790
144 Ga0495628_0756479 3300046516 Bacteria 682
145 Ga0495630_0339150 3300046517 Bacteria 1150
146 Ga0495643_0110020 3300046522 Bacteria 1402
147 Ga0495665_0318623 3300046531 Bacteria 794
148 Ga0495640_0143657 3300046533 Bacteria 1537
149 Ga0495587_0017570 3300046536 Bacteria 4443
150 Ga0495645_0133172 3300046543 Bacteria 1740
151 Ga0495667_0035184 3300046559 Bacteria 3348
152 Ga0495625_0144701 3300046660 Bacteria 1601
153 Ga0495625_0263281 3300046660 Bacteria 1115
154 Ga0495588_0031259 3300046674 Bacteria 2679
155 Ga0495588_0132689 3300046674 Bacteria 1314
156 Ga0495657_0003319 3300046675 Bacteria 13189
157 Ga0495657_0031975 3300046675 Bacteria 3675
158 Ga0495599_0379907 3300046678 Bacteria 843
159 Ga0495646_0024452 3300046680 Bacteria 3804
160 Ga0495647_0300262 3300046681 Bacteria 724
161 Ga0495600_0019260 3300046809 Bacteria 4357
162 Ga0495604_0006608 3300047317 Bacteria 9190
163 Ga0495676_0095052 3300047321 Bacteria 2219
164 Ga0495680_0017781 3300047322 Bacteria 6052
165 Ga0495680_0055364 3300047322 Bacteria 3077
166 Ga0495675_0063461 3300047444 Bacteria 2337
167 Ga0495684_0080447 3300047471 Bacteria 2474
168 Ga0495615_0169443 3300048090 Bacteria 660
169 Ga0496100_0013566 3300048903 Bacteria 4705
170 Ga0496101_0006632 3300048904 Bacteria 7460
171 Ga0496101_0011826 3300048904 Bacteria 5806
172 Ga0496101_0061566 3300048904 Bacteria 2726
173 Ga0496101_0510535 3300048904 Bacteria 950
174 Ga0496102_0022964 3300048905 Bacteria 5534
175 Ga0496102_0191925 3300048905 Bacteria 1925
176 Ga0496104_0079521 3300048907 Bacteria 3125
177 Ga0496104_0324227 3300048907 Bacteria 1453
178 Ga0496105_0006080 3300048908 Bacteria 9238
179 Ga0496105_0023579 3300048908 Bacteria 4992
180 Ga0496105_0152651 3300048908 Bacteria 1898
181 Ga0496105_0742237 3300048908 Bacteria 750
182 Ga0496107_0004548 3300048910 Bacteria 9395
183 Ga0496107_0069651 3300048910 Bacteria 2554
184 Ga0496107_0108530 3300048910 Bacteria 2038
185 Ga0496107_0160142 3300048910 Bacteria 1668
186 Ga0496108_0168702 3300048911 Bacteria 1893
187 Ga0496108_0268829 3300048911 Bacteria 1484
188 Ga0496109_0242428 3300048912 Bacteria 1697
189 Ga0496110_0021939 3300048913 Bacteria 5415
190 Ga0496110_0435750 3300048913 Bacteria 1194
191 Ga0496111_0024946 3300048914 Bacteria 4217
192 Ga0496112_0013587 3300048915 Bacteria 7524
193 Ga0496112_0044645 3300048915 Bacteria 4343
194 Ga0496112_0129813 3300048915 Bacteria 2491
195 Ga0496112_0136004 3300048915 Bacteria 2428
196 Ga0496113_0145743 3300048916 Bacteria 1865
197 Ga0496113_0590823 3300048916 Bacteria 889
198 Ga0496114_0001745 3300048917 Bacteria 16511
199 Ga0496114_0029721 3300048917 Bacteria 4493
200 Ga0496114_0134452 3300048917 Bacteria 2138
201 Ga0496114_0145177 3300048917 Bacteria 2056
202 Ga0496114_0825763 3300048917 Bacteria 806
203 Ga0496115_0012274 3300048918 Bacteria 6442
204 Ga0496115_0131464 3300048918 Bacteria 2063
205 Ga0496115_0981081 3300048918 Bacteria 647
206 Ga0496116_0114547 3300048919 Bacteria 1575
207 Ga0496119_0073609 3300048922 Bacteria 1992
208 Ga0496121_0001006 3300048924 Bacteria 50348
209 Ga0496121_0038007 3300048924 Bacteria 4270
210 Ga0496126_0133327 3300048929 Bacteria 2144
211 Ga0496126_0899842 3300048929 Bacteria 671
212 Ga0501036_0316207 3300049572 Bacteria 1305
213 Ga0501073_0081075 3300049589 Bacteria 2257
214 nmdc:mga0yw44_198865_c1 3300050492 Bacteria 1323
215 nmdc:mga09592_172239_c1 3300050508 Bacteria 1872
216 Ga0495601_0140562 3300053077 Bacteria 1575
217 Ga0495595_0049606 3300053084 Bacteria 1942
218 Ga0495619_0164536 3300053085 Bacteria 1533
219 Ga0500578_0168615 3300053086 Bacteria 1355
220 Ga0500646_0067694 3300053090 Bacteria 1065
221 Ga0500651_0110711 3300053093 Bacteria 1676
222 Ga0500555_001886 3300053103 Bacteria 6226
223 Ga0500556_0015769 3300053104 Bacteria 2338
224 Ga0500562_003691 3300053108 Bacteria 3847
225 Ga0500592_020104 3300053116 Bacteria 1075
226 Ga0500652_163358 3300053131 Bacteria 919
227 Ga0500658_0145631 3300053134 Bacteria 1065
228 Ga0500568_0036892 3300053139 Bacteria 1986
229 Ga0500590_253520 3300053148 Bacteria 697
230 Ga0500622_0061934 3300053156 Bacteria 1906
231 Ga0500638_099723 3300053162 Bacteria 1356
232 Ga0500599_000613 3300053736 Bacteria 3785
233 Ga0500601_000367 3300053737 Bacteria 8121
234 2513858223 2513237137 Bacteria 9558895
235 2517893888 2517572143 Bacteria 9484767
236 2524537854 2524023228 Bacteria 10118060
237 2528849657 2528768022 Bacteria 10457665
238 2617379003 2617270741 Bacteria 8201522
239 2671122880 2667528175 Bacteria 7532676
240 2788437512 2786546940 Bacteria 6396474
241 2824606215 2824600985 Bacteria 8488197
242 2824609803 2824609381 Bacteria 8672835
243 2824657686 2824653114 Bacteria 8493680
244 2824668732 2824661429 Bacteria 9877870
245 2824708354 2824704595 Bacteria 9667483
246 2824749996 2824746037 Bacteria 7911610
247 2824758937 2824753945 Bacteria 9787441
248 2824766113 2824763712 Bacteria 9792355
249 2844317678 2844315083 Bacteria 8138177
250 2857509899 2857509624 Bacteria 7472071
251 2879089667 2879083081 Bacteria 8587928
252 2881365724 2881364244 Bacteria 7710352
253 2881670919 2881665667 Bacteria 8175609
254 2885382464 2885374607 Bacteria 8927485
255 2888422991 2888419890 Bacteria 7857137
256 2904693465 2904690495 Bacteria 9412302
257 2904700692
258 2904718535 2904711408 Bacteria 9771557
259 2906610776
260 2906634795 2906626472 Bacteria 8826946
261 2906646653 2906643746 Bacteria 8722424
262 2908761790 2908756301 Bacteria 8864324
263 2908778657 2908775508 Bacteria 8092255
264 2922375560
265 2929616297 2929615660 Bacteria 9193770
266 2929625041 2929624759 Bacteria 9339455
267 2932787037 2932784394 Bacteria 9704911
268 2932832373 2932828146 Bacteria 9745859
269 2933578419 2933577622 Bacteria 9116884
270 2935619081 2935616580 Bacteria 9032984
271 2935643100 2935638405 Bacteria 10015038
272 2935669727 2935665750 Bacteria 9571747
273 2935677133 2935675223 Bacteria 9928132
274 2935693168 2935684952 Bacteria 9590419
275 2935695337 2935694250 Bacteria 9291695
276 2935709554 2935703347 Bacteria 10242284
277 2935719776 2935713505 Bacteria 9608509
278 2935729457 2935722832 Bacteria 9608746
279 2935739659 2935732158 Bacteria 9706831
280 2935748697 2935741537 Bacteria 9707219
281 2935756716 2935750917 Bacteria 9590372
282 2935807249 2935801545 Bacteria 9301974
283 2935812385 2935810662 Bacteria 9401221
284 2935832755 2935827899 Bacteria 10038562
285 2935839164 2935837841 Bacteria 9454360
286 2935857446 2935855204 Bacteria 9035059
287 2935864978 2935864058 Bacteria 9784707
288 2935876756 2935873716 Bacteria 9632195
289 2935999632 2935992306 Bacteria 9802711
290 2936008346 2936002035 Bacteria 9362176
291 2936038978 2936037263 Bacteria 9446081
292 2940562630 2940556831 Bacteria 9590747
293 2941539854 2941538514 Bacteria 9402094
294 3005589389 3005587118 Bacteria 7794411
295 8006942680 8006933436 Bacteria 10410654
296 8006982407 8006973647 Bacteria 10679141
297 8016515171 8016511872 Bacteria 9921665
298 8016590782 8016583857 Bacteria 10421953
299 8017061283 8017057580 Bacteria 10023680
300 8019580754 8019576017 Bacteria 10049540
301 8019588485 8019586578 Bacteria 10212056
302 8019602851 8019597564 Bacteria 10041141
303 8019615704 8019608314 Bacteria 10042931
304 8055747943 8055742211 Bacteria 9226248
305 Ga0081540_1111920
306 JGI25404J52841_10048861
307 Ga0070690_100392046
308 Ga0070670_100509727
309 Ga0070661_100222082
310 Ga0070671_100466729
311 Ga0070673_100028843
312 Ga0070688_100013163
313 Ga0070713_100974149
314 Ga0070663_100022795
315 Ga0070678_100025693
316 Ga0070706_100093833
317 Ga0070698_101050188
318 Ga0070699_100245248
319 Ga0068853_100138858
320 Ga0070672_100077983
321 Ga0068855_100776422
322 Ga0068856_100414649
323 Ga0068852_100485247
324 Ga0068858_100406449
325 Ga0081455_10002712
326 Ga0081455_10509796
327 Ga0081540_1017894
328 Ga0081540_1060133
329 Ga0075365_10186796
330 Ga0075367_10161896
331 Ga0068871_100440979
332 Ga0068865_100074849
333 Ga0099824_1022493
334 Ga0099824_1023475
335 Ga0099822_1011696
336 Ga0099822_1081312
337 Ga0105240_10063664
338 Ga0111539_10345914
339 Ga0111539_10461407
340 Ga0105245_10170522
341 Ga0105247_10113590
342 Ga0105247_10130299
343 Ga0114129_12719969
344 Ga0105243_10124766
345 Ga0105243_10200877
346 Ga0105243_11765876
347 Ga0105241_10043010
348 Ga0105241_10308288
349 Ga0105241_11216510
350 Ga0105248_10316743
351 Ga0105237_10229882
352 Ga0105238_10330421
353 Ga0105238_10509652
354 Ga0105033_103065
355 Ga0099796_10009409
356 Ga0105239_10014449
357 Ga0105246_10374871
358 Ga0157315_1022708
359 Ga0157369_10048997
360 Ga0157374_11227127
361 Ga0157378_10273636
362 Ga0163162_10530945
363 Ga0157375_10134073
364 Ga0157375_10989995
365 Ga0163163_10186512
366 Ga0157380_10069144
367 Ga0157380_10317624
368 Ga0157379_10419941
369 Ga0157376_10212871
370 Ga0157376_10401442
371 Ga0214542_1000024
372 Ga0214545_1000011
373 Ga0214543_1000033
374 Ga0213876_10007651
375 Ga0228598_1040196
376 Ga0209758_1025789
377 Ga0209758_1091107
378 Ga0207682_10003948
379 Ga0207710_10117190
380 Ga0207680_10544740
381 Ga0207671_10171472
382 Ga0207663_10038259
383 Ga0207649_10593727
384 Ga0207694_10303566
385 Ga0207709_10784191
386 Ga0207669_10015872
387 Ga0207669_11319797
388 Ga0207691_10011683
389 Ga0207667_10652992
390 Ga0207712_10076025
391 Ga0207639_10078938
392 Ga0207678_10028231
393 Ga0207678_10691325
394 Ga0207648_10013191
395 Ga0207676_10657962
396 Ga0207683_10007852
397 Ga0209389_1000025
398 Ga0209589_1000018
399 Ga0209489_100026
400 Ga0209489_100030
401 Ga0209700_100035
402 Ga0265320_10013630
403 Ga0265325_10035504
404 Ga0265339_10002576
405 Ga0265316_10190648
406 Ga0265313_10001715
407 Ga0265314_10042063
408 Ga0265342_10001457
409 Ga0307510_10109725
410 Ga0315911_1000011
411 Ga0373958_0026490
412 Ga0373945_0365499
413 Ga0373956_0114615
414 Ga0373960_0030982
415 Ga0373943_0035999
416 Ga0373946_0270760
417 Ga0373935_0209980
418 Ga0373935_0577731
419 Ga0373927_0034443
420 Ga0373947_0133217
421 Ga0373947_0320395
422 Ga0373937_0560102
423 Ga0373925_0346497
424 Ga0373925_0376337
425 Ga0395899_0083436
426 Ga0395900_0552588
427 Ga0395898_0069971
428 Ga0395898_0085456
429 Ga0436364_0192984
430 Ga0436364_0369009
431 Ga0395901_0100187
432 Ga0436365_0414414
433 Ga0451837_1293914
434 Ga0439459_0043953
435 Ga0466972_0002534
436 Ga0466967_0731917
437 Ga0495592_0553293
438 Ga0495603_0223215
439 Ga0495638_0151419
440 Ga0495651_0482173
441 Ga0495582_0366403
442 Ga0495582_0441958
443 Ga0495664_0030332
444 Ga0495664_0272966
445 Ga0495608_0048831
446 Ga0495608_0185022
447 Ga0495620_0049813
448 Ga0495628_0756479
449 Ga0495630_0339150
450 Ga0495643_0110020
451 Ga0495665_0318623
452 Ga0495640_0143657
453 Ga0495587_0017570
454 Ga0495645_0133172
455 Ga0495667_0035184
456 Ga0495625_0144701
457 Ga0495625_0263281
458 Ga0495588_0031259
459 Ga0495588_0132689
460 Ga0495657_0003319
461 Ga0495657_0031975
462 Ga0495599_0379907
463 Ga0495646_0024452
464 Ga0495647_0300262
465 Ga0495600_0019260
466 Ga0495604_0006608
467 Ga0495676_0095052
468 Ga0495680_0017781
469 Ga0495680_0055364
470 Ga0495675_0063461
471 Ga0495684_0080447
472 Ga0495615_0169443
473 Ga0496100_0013566
474 Ga0496101_0006632
475 Ga0496101_0011826
476 Ga0496101_0061566
477 Ga0496101_0510535
478 Ga0496102_0022964
479 Ga0496102_0191925
480 Ga0496104_0079521
481 Ga0496104_0324227
482 Ga0496105_0006080
483 Ga0496105_0023579
484 Ga0496105_0152651
485 Ga0496105_0742237
486 Ga0496107_0004548
487 Ga0496107_0069651
488 Ga0496107_0108530
489 Ga0496107_0160142
490 Ga0496108_0168702
491 Ga0496108_0268829
492 Ga0496109_0242428
493 Ga0496110_0021939
494 Ga0496110_0435750
495 Ga0496111_0024946
496 Ga0496112_0013587
497 Ga0496112_0044645
498 Ga0496112_0129813
499 Ga0496112_0136004
500 Ga0496113_0145743
501 Ga0496113_0590823
502 Ga0496114_0001745
503 Ga0496114_0029721
504 Ga0496114_0134452
505 Ga0496114_0145177
506 Ga0496114_0825763
507 Ga0496115_0012274
508 Ga0496115_0131464
509 Ga0496115_0981081
510 Ga0496116_0114547
511 Ga0496119_0073609
512 Ga0496121_0001006
513 Ga0496121_0038007
514 Ga0496126_0133327
515 Ga0496126_0899842
516 Ga0501036_0316207
517 Ga0501073_0081075
518 nmdc:mga0yw44_198865_c1
519 nmdc:mga09592_172239_c1
520 Ga0495601_0140562
521 Ga0495595_0049606
522 Ga0495619_0164536
523 Ga0500578_0168615
524 Ga0500646_0067694
525 Ga0500651_0110711
526 Ga0500555_001886
527 Ga0500556_0015769
528 Ga0500562_003691
529 Ga0500592_020104
530 Ga0500652_163358
531 Ga0500658_0145631
532 Ga0500568_0036892
533 Ga0500590_253520
534 Ga0500622_0061934
535 Ga0500638_099723
536 Ga0500599_000613
537 Ga0500601_000367
538 2513858223
539 2517893888
540 2524537854
541 2528849657
542 2617379003
543 2671122880
544 2788437512
545 2824606215
546 2824609803
547 2824657686
548 2824668732
549 2824708354
550 2824749996
551 2824758937
552 2824766113
553 2844317678
554 2857509899
555 2879089667
556 2881365724
557 2881670919
558 2885382464
559 2888422991
560 2904693465
561 2904700692
562 2904718535
563 2906610776
564 2906634795
565 2906646653
566 2908761790
567 2908778657
568 2922375560
569 2929616297
570 2929625041
571 2932787037
572 2932832373
573 2933578419
574 2935619081
575 2935643100
576 2935669727
577 2935677133
578 2935693168
579 2935695337
580 2935709554
581 2935719776
582 2935729457
583 2935739659
584 2935748697
585 2935756716
586 2935807249
587 2935812385
588 2935832755
589 2935839164
590 2935857446
591 2935864978
592 2935876756
593 2935999632
594 2936008346
595 2936038978
596 2940562630
597 2941539854
598 3005589389
599 8006942680
600 8006982407
601 8016515171
602 8016590782
603 8017061283
604 8019580754
605 8019588485
606 8019602851
607 8019615704
608 8055747943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01661

Macro

Macro domain

27

138

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cb3-assembly1.cif.gz_A structural insights into the mechanism of escherichia coli ymdb 0.9696 11 173
5cms-assembly2.cif.gz_A structural insights into the mechanism of escherichia coli ymdb 0.9681 11 175
5cb5-assembly10.cif.gz_I structural insights into the mechanism of escherichia coli ymdb 0.9666 11 175
4iqy-assembly1.cif.gz_A crystal structure of the human protein-proximal adp-ribosyl-hydrolase macrod2 0.9576 11 177
6y4y-assembly1.cif.gz_A the crystal structure of human macrod2 in space group p41212 0.9572 11 177
ID Description Score Start End Superfamily
5cb5C00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9667 11 175 3.40.220.10
af_Q3UYG8_4_243_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9551 11 176 3.40.220.10
af_Q4DQ03_1_267_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9541 11 174 3.40.220.10
af_F6PBM1_89_319_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9532 11 176 3.40.220.10
af_Q460N5_783_978_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9481 1 174 3.40.220.10
ID Description Score Start End GO Terms
AF-A0A662AKW8-F1-model_v4 RNase III inhibitor 0.9873 14 117 GO:0019213
AF-A0A1C3H235-F1-model_v4 COG2110, Macro domain, possibly ADP-ribose binding module 0.9837 11 174 GO:0061463
AF-A0A5E8CQW6-F1-model_v4 Appr-1-p processing protein 0.9828 14 114 GO:0019213
AF-A0A8A7CYP3-F1-model_v4 deleted 0.9819 1 174
AF-A0A3M2DJI8-F1-model_v4 O-acetyl-ADP-ribose deacetylase 0.9818 11 174

Map