F397587
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 206 | 295 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10526132|Ga0163162_105261322 |
| Length | 299 |
| Sequence | MSFEQGGPAATTRWQGGLAVTPAHAGRADEVATGDGGGGRVTEFVRLEVDGGVGTIRLDRPPMNAISRAVGDELRSVAAEATARDDVRAVIVYGGEKVFAAGADVKEMASLTYAEMAPIARSVSAGLGALAGIPKPTVAAITGYALGGGLEVVLTCDRRIAADNATLGVPEILLGIIPGGGGTQRLARLVGPARAKDMVYTGRFVRADEALAIGLVDELVPAADVYARARAYVEPFAHGPALAYAAAKKAIDGGLDVDLRTGLDIESDQFAGLFATDDQRIGMASFVEHGPGKAQFTGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 3 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 4 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 5 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 6 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 7 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 8 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 123 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 124 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 128 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 129 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 130 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 131 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 139 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 140 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 141 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 142 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 146 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 149 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 161 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 164 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 190 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 191 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 192 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 198 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 199 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 200 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 201 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 202 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 203 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 205 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 206 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.38 |
| Metatranscriptomes | 0.66 |
| Isolates | 2.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.61 |
| Nodule | 0 |
| Rhizoplane | 6.91 |
| Rhizosphere | 83.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100367312 | 3300005329 | Bacteria | 1370 |
| 2 | Ga0070670_100173445 | 3300005331 | Bacteria | 1871 |
| 3 | Ga0070680_100092772 | 3300005336 | Bacteria | 2501 |
| 4 | Ga0070680_100173565 | 3300005336 | Bacteria | 1815 |
| 5 | Ga0070682_100022600 | 3300005337 | Bacteria | 3727 |
| 6 | Ga0068868_100236811 | 3300005338 | Bacteria | 1533 |
| 7 | Ga0068868_100496980 | 3300005338 | Bacteria | 1068 |
| 8 | Ga0070691_10156806 | 3300005341 | Bacteria | 1171 |
| 9 | Ga0070687_100073237 | 3300005343 | Bacteria | 1846 |
| 10 | Ga0070661_100048024 | 3300005344 | Bacteria | 3124 |
| 11 | Ga0070692_10005752 | 3300005345 | Bacteria | 5325 |
| 12 | Ga0070668_100001660 | 3300005347 | Bacteria | 16146 |
| 13 | Ga0070669_100116699 | 3300005353 | Bacteria | 2032 |
| 14 | Ga0070675_100064529 | 3300005354 | Bacteria | 3027 |
| 15 | Ga0070674_100144277 | 3300005356 | Bacteria | 1790 |
| 16 | Ga0070673_100037863 | 3300005364 | Bacteria | 3679 |
| 17 | Ga0070659_100014601 | 3300005366 | Bacteria | 5872 |
| 18 | Ga0070659_100040425 | 3300005366 | Bacteria | 3644 |
| 19 | Ga0070714_100070621 | 3300005435 | Bacteria | 3019 |
| 20 | Ga0070714_100245433 | 3300005435 | Bacteria | 1654 |
| 21 | Ga0070701_10014104 | 3300005438 | Bacteria | 3655 |
| 22 | Ga0070700_100021918 | 3300005441 | Bacteria | 3718 |
| 23 | Ga0070663_100151044 | 3300005455 | Bacteria | 1781 |
| 24 | Ga0070681_10061384 | 3300005458 | Bacteria | 3734 |
| 25 | Ga0070681_10100373 | 3300005458 | Bacteria | 2840 |
| 26 | Ga0068867_100009302 | 3300005459 | Bacteria | 6931 |
| 27 | Ga0070685_10422447 | 3300005466 | Bacteria | 928 |
| 28 | Ga0070706_100698069 | 3300005467 | Bacteria | 941 |
| 29 | Ga0070679_100465652 | 3300005530 | Bacteria | 1208 |
| 30 | Ga0070684_100021214 | 3300005535 | Bacteria | 5400 |
| 31 | Ga0070684_100086671 | 3300005535 | Bacteria | 2779 |
| 32 | Ga0070684_100229369 | 3300005535 | Bacteria | 1695 |
| 33 | Ga0068853_100171336 | 3300005539 | Bacteria | 1964 |
| 34 | Ga0070672_100010075 | 3300005543 | Bacteria | 6543 |
| 35 | Ga0070686_100069836 | 3300005544 | Bacteria | 2295 |
| 36 | Ga0070665_100231440 | 3300005548 | Bacteria | 1848 |
| 37 | Ga0070664_100015036 | 3300005564 | Bacteria | 6317 |
| 38 | Ga0068857_100244141 | 3300005577 | Bacteria | 1645 |
| 39 | Ga0068854_100042222 | 3300005578 | Bacteria | 3227 |
| 40 | Ga0068856_100407091 | 3300005614 | Bacteria | 1380 |
| 41 | Ga0070702_100335843 | 3300005615 | Bacteria | 1058 |
| 42 | Ga0068852_100050000 | 3300005616 | Bacteria | 3579 |
| 43 | Ga0068859_100185139 | 3300005617 | Bacteria | 2166 |
| 44 | Ga0068864_100183366 | 3300005618 | Bacteria | 1915 |
| 45 | Ga0068864_100276962 | 3300005618 | Bacteria | 1565 |
| 46 | Ga0068866_10029247 | 3300005718 | Bacteria | 2633 |
| 47 | Ga0068870_10015852 | 3300005840 | Bacteria | 3586 |
| 48 | Ga0068870_10250317 | 3300005840 | Bacteria | 1098 |
| 49 | Ga0068863_100023016 | 3300005841 | Bacteria | 5955 |
| 50 | Ga0068860_100288546 | 3300005843 | Bacteria | 1605 |
| 51 | Ga0081455_10000018 | 3300005937 | Bacteria | 173683 |
| 52 | Ga0070717_10097125 | 3300006028 | Bacteria | 2496 |
| 53 | Ga0075365_10171074 | 3300006038 | Bacteria | 1516 |
| 54 | Ga0075368_10004514 | 3300006042 | Bacteria | 4727 |
| 55 | Ga0075363_100010506 | 3300006048 | Bacteria | 4401 |
| 56 | Ga0075367_10072372 | 3300006178 | Bacteria | 2075 |
| 57 | Ga0075428_100069121 | 3300006844 | Bacteria | 3863 |
| 58 | Ga0075430_100000172 | 3300006846 | Bacteria | 42600 |
| 59 | Ga0075430_100011555 | 3300006846 | Bacteria | 7507 |
| 60 | Ga0075431_100048735 | 3300006847 | Bacteria | 4369 |
| 61 | Ga0075431_100283322 | 3300006847 | Bacteria | 1678 |
| 62 | Ga0075431_100399286 | 3300006847 | Bacteria | 1376 |
| 63 | Ga0075433_10390604 | 3300006852 | Bacteria | 1228 |
| 64 | Ga0075429_100020736 | 3300006880 | Bacteria | 5705 |
| 65 | Ga0075429_100038767 | 3300006880 | Bacteria | 4148 |
| 66 | Ga0068865_100001007 | 3300006881 | Bacteria | 16180 |
| 67 | Ga0097620_100185137 | 3300006931 | Bacteria | 2166 |
| 68 | Ga0111539_10189555 | 3300009094 | Bacteria | 2400 |
| 69 | Ga0105245_10044697 | 3300009098 | Bacteria | 3954 |
| 70 | Ga0105245_10077377 | 3300009098 | Bacteria | 3033 |
| 71 | Ga0114129_10000056 | 3300009147 | Bacteria | 99329 |
| 72 | Ga0114129_10001688 | 3300009147 | Bacteria | 30106 |
| 73 | Ga0114129_10052886 | 3300009147 | Bacteria | 5699 |
| 74 | Ga0114129_10223237 | 3300009147 | Bacteria | 2541 |
| 75 | Ga0105243_10023226 | 3300009148 | Bacteria | 4720 |
| 76 | Ga0105242_10416479 | 3300009176 | Bacteria | 1258 |
| 77 | Ga0105248_10014374 | 3300009177 | Bacteria | 8712 |
| 78 | Ga0105248_10092568 | 3300009177 | Bacteria | 3405 |
| 79 | Ga0105238_10204432 | 3300009551 | Bacteria | 1951 |
| 80 | Ga0105249_10016947 | 3300009553 | Bacteria | 6464 |
| 81 | Ga0105249_10178046 | 3300009553 | Bacteria | 2067 |
| 82 | Ga0105239_10246444 | 3300010375 | Bacteria | 2006 |
| 83 | Ga0157371_10007167 | 3300013102 | Bacteria | 9058 |
| 84 | Ga0157371_10220231 | 3300013102 | Bacteria | 1363 |
| 85 | Ga0157369_10002337 | 3300013105 | Bacteria | 22828 |
| 86 | Ga0157369_10005679 | 3300013105 | Bacteria | 14496 |
| 87 | Ga0163162_10526132 | 3300013306 | Bacteria | 1312 |
| 88 | Ga0157372_10047529 | 3300013307 | Bacteria | 4769 |
| 89 | Ga0157375_10067162 | 3300013308 | Bacteria | 3582 |
| 90 | Ga0163163_10035229 | 3300014325 | Bacteria | 4855 |
| 91 | Ga0163163_10502645 | 3300014325 | Bacteria | 1274 |
| 92 | Ga0157380_10045220 | 3300014326 | Bacteria | 3454 |
| 93 | Ga0157377_10023451 | 3300014745 | Bacteria | 3271 |
| 94 | Ga0163161_10310242 | 3300017792 | Bacteria | 1244 |
| 95 | Ga0206353_12064211 | 3300020082 | Bacteria | 1326 |
| 96 | Ga0213875_10000097 | 3300021388 | Bacteria | 101618 |
| 97 | Ga0224712_10113681 | 3300022467 | Bacteria | 1164 |
| 98 | Ga0207688_10008385 | 3300025901 | Bacteria | 5621 |
| 99 | Ga0207688_10222301 | 3300025901 | Bacteria | 1138 |
| 100 | Ga0207647_10138957 | 3300025904 | Bacteria | 1424 |
| 101 | Ga0207643_10007206 | 3300025908 | Bacteria | 5970 |
| 102 | Ga0207705_10004774 | 3300025909 | Bacteria | 10205 |
| 103 | Ga0207705_10033518 | 3300025909 | Bacteria | 3670 |
| 104 | Ga0207707_10129264 | 3300025912 | Bacteria | 2209 |
| 105 | Ga0207707_10386463 | 3300025912 | Bacteria | 1203 |
| 106 | Ga0207660_10129494 | 3300025917 | Bacteria | 1919 |
| 107 | Ga0207662_10064507 | 3300025918 | Bacteria | 2204 |
| 108 | Ga0207657_10128467 | 3300025919 | Bacteria | 2079 |
| 109 | Ga0207657_10180823 | 3300025919 | Bacteria | 1705 |
| 110 | Ga0207649_10116944 | 3300025920 | Bacteria | 1791 |
| 111 | Ga0207652_10019949 | 3300025921 | Bacteria | 5520 |
| 112 | Ga0207652_10116078 | 3300025921 | Bacteria | 2378 |
| 113 | Ga0207681_10112624 | 3300025923 | Bacteria | 1982 |
| 114 | Ga0207694_10098678 | 3300025924 | Bacteria | 2313 |
| 115 | Ga0207687_10079422 | 3300025927 | Bacteria | 2366 |
| 116 | Ga0207687_10095217 | 3300025927 | Bacteria | 2180 |
| 117 | Ga0207664_10125923 | 3300025929 | Bacteria | 2151 |
| 118 | Ga0207664_10269582 | 3300025929 | Bacteria | 1491 |
| 119 | Ga0207690_10000222 | 3300025932 | Bacteria | 42867 |
| 120 | Ga0207690_10026297 | 3300025932 | Bacteria | 3663 |
| 121 | Ga0207690_10034927 | 3300025932 | Bacteria | 3242 |
| 122 | Ga0207690_10048308 | 3300025932 | Bacteria | 2829 |
| 123 | Ga0207709_10028352 | 3300025935 | Bacteria | 3237 |
| 124 | Ga0207669_10003700 | 3300025937 | Bacteria | 6652 |
| 125 | Ga0207691_10003397 | 3300025940 | Bacteria | 15481 |
| 126 | Ga0207711_10262910 | 3300025941 | Bacteria | 1586 |
| 127 | Ga0207689_10152740 | 3300025942 | Bacteria | 1903 |
| 128 | Ga0207661_10032212 | 3300025944 | Bacteria | 4058 |
| 129 | Ga0207661_10095263 | 3300025944 | Bacteria | 2488 |
| 130 | Ga0207661_10535502 | 3300025944 | Bacteria | 1072 |
| 131 | Ga0207667_10289485 | 3300025949 | Bacteria | 1674 |
| 132 | Ga0207712_10021181 | 3300025961 | Bacteria | 4265 |
| 133 | Ga0207668_10007375 | 3300025972 | Bacteria | 6536 |
| 134 | Ga0207640_10074685 | 3300025981 | Bacteria | 2295 |
| 135 | Ga0207658_10171215 | 3300025986 | Bacteria | 1789 |
| 136 | Ga0207639_10131204 | 3300026041 | Bacteria | 2074 |
| 137 | Ga0207678_10242171 | 3300026067 | Bacteria | 1545 |
| 138 | Ga0207708_10000180 | 3300026075 | Bacteria | 49555 |
| 139 | Ga0207641_10026907 | 3300026088 | Bacteria | 4749 |
| 140 | Ga0207648_10005348 | 3300026089 | Bacteria | 12943 |
| 141 | Ga0207648_10346843 | 3300026089 | Bacteria | 1338 |
| 142 | Ga0207676_10114459 | 3300026095 | Bacteria | 2263 |
| 143 | Ga0207674_10016918 | 3300026116 | Bacteria | 7964 |
| 144 | Ga0207675_100006710 | 3300026118 | Bacteria | 10882 |
| 145 | Ga0207683_10348799 | 3300026121 | Bacteria | 1358 |
| 146 | Ga0207698_10324524 | 3300026142 | Bacteria | 1443 |
| 147 | Ga0268265_10039794 | 3300028380 | Bacteria | 3467 |
| 148 | Ga0268264_10241664 | 3300028381 | Bacteria | 1673 |
| 149 | Ga0307515_10040352 | 3300028794 | Bacteria | 7384 |
| 150 | Ga0307515_10398800 | 3300028794 | Bacteria | 1002 |
| 151 | Ga0316182_1440866 | 3300030745 | Bacteria | 11079 |
| 152 | Ga0307508_10177656 | 3300031616 | Bacteria | 1732 |
| 153 | Ga0307508_10286002 | 3300031616 | Bacteria | 1242 |
| 154 | Ga0307406_10040163 | 3300031901 | Bacteria | 2908 |
| 155 | Ga0307406_10052351 | 3300031901 | Bacteria | 2596 |
| 156 | Ga0307407_10177107 | 3300031903 | Bacteria | 1410 |
| 157 | Ga0307409_100031403 | 3300031995 | Bacteria | 3833 |
| 158 | Ga0307409_100271503 | 3300031995 | Bacteria | 1562 |
| 159 | Ga0307409_100709961 | 3300031995 | Bacteria | 1006 |
| 160 | Ga0307415_100493061 | 3300032126 | Bacteria | 1069 |
| 161 | Ga0307415_100558199 | 3300032126 | Bacteria | 1012 |
| 162 | Ga0307507_10071798 | 3300033179 | Bacteria | 3126 |
| 163 | Ga0307507_10092110 | 3300033179 | Bacteria | 2590 |
| 164 | Ga0373940_0001863 | 3300035088 | Bacteria | 3959 |
| 165 | Ga0373942_0001291 | 3300035207 | Bacteria | 6556 |
| 166 | Ga0373962_0002388 | 3300035242 | Bacteria | 4476 |
| 167 | Ga0373931_0083300 | 3300035691 | Bacteria | 1769 |
| 168 | Ga0373931_0255052 | 3300035691 | Bacteria | 1068 |
| 169 | Ga0395898_0155351 | 3300037466 | Bacteria | 2188 |
| 170 | Ga0395905_0064826 | 3300037471 | Bacteria | 3420 |
| 171 | Ga0436364_0296067 | 3300037853 | Bacteria | 138817 |
| 172 | Ga0436364_1246252 | 3300037853 | Bacteria | 3091 |
| 173 | Ga0436365_0218752 | 3300039437 | Bacteria | 2787 |
| 174 | Ga0439463_071463 | 3300042016 | Bacteria | 889 |
| 175 | Ga0450900_007692 | 3300042136 | Bacteria | 1333 |
| 176 | Ga0439464_0081326 | 3300042439 | Bacteria | 968 |
| 177 | Ga0466969_0027675 | 3300044656 | Bacteria | 2902 |
| 178 | Ga0466969_0054447 | 3300044656 | Bacteria | 1959 |
| 179 | Ga0466965_0103929 | 3300044683 | Bacteria | 1455 |
| 180 | Ga0466965_0129042 | 3300044683 | Bacteria | 1310 |
| 181 | Ga0466966_0004593 | 3300044684 | Bacteria | 9097 |
| 182 | Ga0466966_0020375 | 3300044684 | Bacteria | 4361 |
| 183 | Ga0466966_0034700 | 3300044684 | Bacteria | 3261 |
| 184 | Ga0466966_0065143 | 3300044684 | Bacteria | 2292 |
| 185 | Ga0466961_0023170 | 3300044693 | Bacteria | 3993 |
| 186 | Ga0466961_0361108 | 3300044693 | Bacteria | 883 |
| 187 | Ga0466963_0011026 | 3300044694 | Bacteria | 5495 |
| 188 | Ga0466963_0038686 | 3300044694 | Bacteria | 3121 |
| 189 | Ga0466963_0045674 | 3300044694 | Bacteria | 2885 |
| 190 | Ga0466971_0011030 | 3300044719 | Bacteria | 3956 |
| 191 | Ga0466971_0067573 | 3300044719 | Bacteria | 1620 |
| 192 | Ga0466971_0138545 | 3300044719 | Bacteria | 1132 |
| 193 | Ga0466970_0134564 | 3300044765 | Bacteria | 1359 |
| 194 | Ga0466957_0016575 | 3300044842 | Bacteria | 4309 |
| 195 | Ga0466960_0245356 | 3300044901 | Bacteria | 993 |
| 196 | Ga0466959_0004629 | 3300045049 | Bacteria | 9249 |
| 197 | Ga0466959_0029690 | 3300045049 | Bacteria | 4051 |
| 198 | Ga0466959_0062668 | 3300045049 | Bacteria | 2701 |
| 199 | Ga0466958_0008909 | 3300045836 | Bacteria | 5575 |
| 200 | Ga0466958_0022683 | 3300045836 | Bacteria | 3680 |
| 201 | Ga0466958_0042354 | 3300045836 | Bacteria | 2742 |
| 202 | Ga0466958_0071462 | 3300045836 | Bacteria | 2125 |
| 203 | Ga0466958_0119322 | 3300045836 | Bacteria | 1650 |
| 204 | Ga0466967_0032405 | 3300045976 | Bacteria | 4413 |
| 205 | Ga0466967_0041283 | 3300045976 | Bacteria | 3977 |
| 206 | Ga0466967_0066800 | 3300045976 | Bacteria | 3205 |
| 207 | Ga0466967_0067507 | 3300045976 | Bacteria | 3190 |
| 208 | Ga0466967_0299194 | 3300045976 | Bacteria | 1548 |
| 209 | Ga0466967_0410422 | 3300045976 | Bacteria | 1319 |
| 210 | Ga0466967_0491383 | 3300045976 | Bacteria | 1203 |
| 211 | Ga0495629_0330564 | 3300046459 | Bacteria | 1041 |
| 212 | Ga0495594_0035922 | 3300046499 | Bacteria | 2701 |
| 213 | Ga0495645_0090468 | 3300046543 | Bacteria | 2187 |
| 214 | Ga0495600_0141153 | 3300046809 | Bacteria | 1563 |
| 215 | Ga0495675_0057486 | 3300047444 | Bacteria | 2466 |
| 216 | Ga0496104_0071003 | 3300048907 | Bacteria | 3311 |
| 217 | Ga0496105_0213585 | 3300048908 | Bacteria | 1572 |
| 218 | Ga0496105_0337433 | 3300048908 | Bacteria | 1206 |
| 219 | Ga0496106_0552023 | 3300048909 | Bacteria | 924 |
| 220 | Ga0496108_0043561 | 3300048911 | Bacteria | 3749 |
| 221 | Ga0496108_0164254 | 3300048911 | Bacteria | 1920 |
| 222 | Ga0496109_0416073 | 3300048912 | Bacteria | 1270 |
| 223 | Ga0496110_0010868 | 3300048913 | Bacteria | 7421 |
| 224 | Ga0496110_0192211 | 3300048913 | Bacteria | 1853 |
| 225 | Ga0496110_0206664 | 3300048913 | Bacteria | 1784 |
| 226 | Ga0496110_0332151 | 3300048913 | Bacteria | 1385 |
| 227 | Ga0496111_0026028 | 3300048914 | Bacteria | 4129 |
| 228 | Ga0496111_0180780 | 3300048914 | Bacteria | 1568 |
| 229 | Ga0496111_0624047 | 3300048914 | Bacteria | 788 |
| 230 | Ga0496112_0007675 | 3300048915 | Bacteria | 9598 |
| 231 | Ga0496112_0023624 | 3300048915 | Bacteria | 5878 |
| 232 | Ga0496112_0048557 | 3300048915 | Bacteria | 4161 |
| 233 | Ga0496113_0338981 | 3300048916 | Bacteria | 1206 |
| 234 | Ga0496113_0647040 | 3300048916 | Bacteria | 845 |
| 235 | Ga0496114_0029242 | 3300048917 | Bacteria | 4527 |
| 236 | Ga0496114_0060827 | 3300048917 | Bacteria | 3157 |
| 237 | Ga0501031_0028500 | 3300049568 | Bacteria | 3640 |
| 238 | Ga0501031_0407676 | 3300049568 | Bacteria | 879 |
| 239 | Ga0501032_0018027 | 3300049569 | Bacteria | 4952 |
| 240 | Ga0501032_0063608 | 3300049569 | Bacteria | 2470 |
| 241 | Ga0501032_0123250 | 3300049569 | Bacteria | 1713 |
| 242 | Ga0501033_0026729 | 3300049570 | Bacteria | 4342 |
| 243 | Ga0501034_0048470 | 3300049571 | Bacteria | 4287 |
| 244 | Ga0501036_0016896 | 3300049572 | Bacteria | 6095 |
| 245 | Ga0501037_0009658 | 3300049573 | Bacteria | 7081 |
| 246 | Ga0501038_0006027 | 3300049574 | Bacteria | 11218 |
| 247 | Ga0501038_0033639 | 3300049574 | Bacteria | 4514 |
| 248 | Ga0501038_0190645 | 3300049574 | Bacteria | 1650 |
| 249 | Ga0501039_0009483 | 3300049575 | Bacteria | 7421 |
| 250 | Ga0501042_0019938 | 3300049578 | Bacteria | 4664 |
| 251 | Ga0501043_0028595 | 3300049579 | Bacteria | 4376 |
| 252 | Ga0501043_0074860 | 3300049579 | Bacteria | 2660 |
| 253 | Ga0501046_0001938 | 3300049580 | Bacteria | 19639 |
| 254 | Ga0501046_0024257 | 3300049580 | Bacteria | 4978 |
| 255 | Ga0501047_0009441 | 3300049581 | Bacteria | 9215 |
| 256 | Ga0501047_0025976 | 3300049581 | Bacteria | 5631 |
| 257 | Ga0501047_0087083 | 3300049581 | Bacteria | 3001 |
| 258 | Ga0501047_0420109 | 3300049581 | Bacteria | 1168 |
| 259 | Ga0501048_0012779 | 3300049582 | Bacteria | 6242 |
| 260 | Ga0501067_0025266 | 3300049583 | Bacteria | 3292 |
| 261 | Ga0501069_0106741 | 3300049585 | Bacteria | 1592 |
| 262 | Ga0501070_0030630 | 3300049586 | Bacteria | 4508 |
| 263 | Ga0501073_0091602 | 3300049589 | Bacteria | 2113 |
| 264 | Ga0501080_0129594 | 3300049742 | Bacteria | 2335 |
| 265 | Ga0501080_0212831 | 3300049742 | Bacteria | 1771 |
| 266 | Ga0501081_0267415 | 3300049743 | Bacteria | 1250 |
| 267 | Ga0501035_0025992 | 3300049822 | Bacteria | 5363 |
| 268 | Ga0501035_0047119 | 3300049822 | Bacteria | 3871 |
| 269 | Ga0501044_0016208 | 3300049823 | Bacteria | 8011 |
| 270 | Ga0501044_0462105 | 3300049823 | Bacteria | 1174 |
| 271 | nmdc:mga00v17_113521_c1 | 3300050491 | Bacteria | 1720 |
| 272 | nmdc:mga00v17_5542_c1 | 3300050491 | Bacteria | 6653 |
| 273 | nmdc:mga0yw44_266772_c1 | 3300050492 | Bacteria | 1142 |
| 274 | nmdc:mga07m45_59187_c1 | 3300050496 | Bacteria | 2167 |
| 275 | nmdc:mga05p37_171358_c1 | 3300050507 | Bacteria | 2647 |
| 276 | nmdc:mga05p37_720_c1 | 3300050507 | Bacteria | 36593 |
| 277 | nmdc:mga05p37_8792_c1 | 3300050507 | Bacteria | 11934 |
| 278 | nmdc:mga09592_13817_c1 | 3300050508 | Bacteria | 6597 |
| 279 | nmdc:mga09592_438254_c1 | 3300050508 | Bacteria | 1128 |
| 280 | nmdc:mga0qj67_26355_c1 | 3300050509 | Bacteria | 4500 |
| 281 | nmdc:mga0qj67_263_c2 | 3300050509 | Bacteria | 17708 |
| 282 | nmdc:mga06r32_312696_c1 | 3300050510 | Bacteria | 1556 |
| 283 | nmdc:mga06r32_68289_c1 | 3300050510 | Bacteria | 3434 |
| 284 | nmdc:mga08y16_559607_c1 | 3300050511 | Bacteria | 1156 |
| 285 | Ga0500646_0000083 | 3300053090 | Bacteria | 26729 |
| 286 | Ga0500583_0043745 | 3300053092 | Bacteria | 2047 |
| 287 | Ga0500654_046347 | 3300053099 | Bacteria | 2399 |
| 288 | Ga0500594_0056440 | 3300053118 | Bacteria | 1120 |
| 289 | Ga0500568_0003911 | 3300053139 | Bacteria | 8106 |
| 290 | Ga0500588_0011735 | 3300053146 | Bacteria | 2153 |
| 291 | Ga0501084_0357644 | 3300054114 | Bacteria | 1234 |
| 292 | Ga0466962_0007260 | 3300061719 | Bacteria | 5309 |
| 293 | Ga0466962_0030387 | 3300061719 | Bacteria | 2587 |
| 294 | Ga0530510_0046477 | 3300061734 | Bacteria | 3136 |
| 295 | Ga0530510_0065600 | 3300061734 | Bacteria | 2631 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044656 | Ga0466969_0054447 | Ga0466969_0054447_805_1635 | 203 |
| 2 | 3300044684 | Ga0466966_0065143 | Ga0466966_0065143_657_1487 | 203 |
| 3 | 3300044693 | Ga0466961_0023170 | Ga0466961_0023170_692_1522 | 203 |
| 4 | 3300044694 | Ga0466963_0038686 | Ga0466963_0038686_1780_2610 | 203 |
| 5 | 3300044719 | Ga0466971_0067573 | Ga0466971_0067573_622_1452 | 203 |
| 6 | 3300045836 | Ga0466958_0119322 | Ga0466958_0119322_37_867 | 203 |
| 7 | 3300061719 | Ga0466962_0030387 | Ga0466962_0030387_271_1101 | 203 |
| 8 | 3300006847 | Ga0075431_100399286 | Ga0075431_1003992861 | 207 |
| 9 | 3300009147 | Ga0114129_10000056 | Ga0114129_1000005665 | 207 |
| 10 | 3300046499 | Ga0495594_0035922 | Ga0495594_0035922_150_923 | 207 |
| 11 | 3300050507 | nmdc:mga05p37_720_c1 | nmdc:mga05p37_720_c1_26419_27243 | 207 |
| 12 | 3300050510 | nmdc:mga06r32_312696_c1 | nmdc:mga06r32_312696_c1_236_1060 | 207 |
| 13 | 3300046543 | Ga0495645_0090468 | Ga0495645_0090468_172_945 | 209 |
| 14 | 3300046809 | Ga0495600_0141153 | Ga0495600_0141153_763_1536 | 209 |
| 15 | 3300047444 | Ga0495675_0057486 | Ga0495675_0057486_1610_2383 | 209 |
| 16 | 3300035088 | Ga0373940_0001863 | Ga0373940_0001863_3120_3893 | 211 |
| 17 | 3300035207 | Ga0373942_0001291 | Ga0373942_0001291_3674_4447 | 211 |
| 18 | 3300035242 | Ga0373962_0002388 | Ga0373962_0002388_3530_4303 | 211 |
| 19 | 3300031616 | Ga0307508_10177656 | Ga0307508_101776562 | 212 |
| 20 | 3300005347 | Ga0070668_100001660 | Ga0070668_1000016608 | 213 |
| 21 | 3300005467 | Ga0070706_100698069 | Ga0070706_1006980691 | 213 |
| 22 | 3300005617 | Ga0068859_100185139 | Ga0068859_1001851392 | 213 |
| 23 | 3300005843 | Ga0068860_100288546 | Ga0068860_1002885462 | 213 |
| 24 | 3300006931 | Ga0097620_100185137 | Ga0097620_1001851372 | 213 |
| 25 | 3300025972 | Ga0207668_10007375 | Ga0207668_100073757 | 213 |
| 26 | 3300028380 | Ga0268265_10039794 | Ga0268265_100397943 | 213 |
| 27 | 3300028381 | Ga0268264_10241664 | Ga0268264_102416642 | 213 |
| 28 | 3300053090 | Ga0500646_0000083 | Ga0500646_0000083_23728_24435 | 214 |
| 29 | 3300054114 | Ga0501084_0357644 | Ga0501084_0357644_17_724 | 214 |
| 30 | 3300031616 | Ga0307508_10286002 | Ga0307508_102860022 | 216 |
| 31 | 3300026089 | Ga0207648_10346843 | Ga0207648_103468432 | 218 |
| 32 | 3300025986 | Ga0207658_10171215 | Ga0207658_101712152 | 219 |
| 33 | 3300044683 | Ga0466965_0103929 | Ga0466965_0103929_60_836 | 219 |
| 34 | 3300044684 | Ga0466966_0004593 | Ga0466966_0004593_7510_8286 | 219 |
| 35 | 3300044694 | Ga0466963_0011026 | Ga0466963_0011026_3672_4448 | 219 |
| 36 | 3300044719 | Ga0466971_0011030 | Ga0466971_0011030_24_800 | 219 |
| 37 | 3300044842 | Ga0466957_0016575 | Ga0466957_0016575_1670_2446 | 219 |
| 38 | 3300044901 | Ga0466960_0245356 | Ga0466960_0245356_152_928 | 219 |
| 39 | 3300045049 | Ga0466959_0029690 | Ga0466959_0029690_1622_2398 | 219 |
| 40 | 3300045836 | Ga0466958_0022683 | Ga0466958_0022683_716_1492 | 219 |
| 41 | 3300050491 | nmdc:mga00v17_113521_c1 | nmdc:mga00v17_113521_c1_12_740 | 219 |
| 42 | 3300005331 | Ga0070670_100173445 | Ga0070670_1001734453 | 221 |
| 43 | 3300005337 | Ga0070682_100022600 | Ga0070682_1000226003 | 221 |
| 44 | 3300005338 | Ga0068868_100496980 | Ga0068868_1004969801 | 221 |
| 45 | 3300005341 | Ga0070691_10156806 | Ga0070691_101568062 | 221 |
| 46 | 3300005343 | Ga0070687_100073237 | Ga0070687_1000732373 | 221 |
| 47 | 3300005345 | Ga0070692_10005752 | Ga0070692_100057524 | 221 |
| 48 | 3300005353 | Ga0070669_100116699 | Ga0070669_1001166993 | 221 |
| 49 | 3300005354 | Ga0070675_100064529 | Ga0070675_1000645294 | 221 |
| 50 | 3300005356 | Ga0070674_100144277 | Ga0070674_1001442771 | 221 |
| 51 | 3300005364 | Ga0070673_100037863 | Ga0070673_1000378633 | 221 |
| 52 | 3300005366 | Ga0070659_100040425 | Ga0070659_1000404253 | 221 |
| 53 | 3300005438 | Ga0070701_10014104 | Ga0070701_100141041 | 221 |
| 54 | 3300005441 | Ga0070700_100021918 | Ga0070700_1000219183 | 221 |
| 55 | 3300005459 | Ga0068867_100009302 | Ga0068867_1000093027 | 221 |
| 56 | 3300005466 | Ga0070685_10422447 | Ga0070685_104224471 | 221 |
| 57 | 3300005535 | Ga0070684_100229369 | Ga0070684_1002293692 | 221 |
| 58 | 3300005539 | Ga0068853_100171336 | Ga0068853_1001713362 | 221 |
| 59 | 3300005543 | Ga0070672_100010075 | Ga0070672_1000100752 | 221 |
| 60 | 3300005544 | Ga0070686_100069836 | Ga0070686_1000698362 | 221 |
| 61 | 3300005578 | Ga0068854_100042222 | Ga0068854_1000422223 | 221 |
| 62 | 3300005615 | Ga0070702_100335843 | Ga0070702_1003358431 | 221 |
| 63 | 3300005616 | Ga0068852_100050000 | Ga0068852_1000500003 | 221 |
| 64 | 3300005718 | Ga0068866_10029247 | Ga0068866_100292473 | 221 |
| 65 | 3300005840 | Ga0068870_10015852 | Ga0068870_100158522 | 221 |
| 66 | 3300006844 | Ga0075428_100069121 | Ga0075428_1000691212 | 221 |
| 67 | 3300006881 | Ga0068865_100001007 | Ga0068865_1000010078 | 221 |
| 68 | 3300009094 | Ga0111539_10189555 | Ga0111539_101895552 | 221 |
| 69 | 3300009098 | Ga0105245_10077377 | Ga0105245_100773774 | 221 |
| 70 | 3300009148 | Ga0105243_10023226 | Ga0105243_100232263 | 221 |
| 71 | 3300009177 | Ga0105248_10014374 | Ga0105248_100143744 | 221 |
| 72 | 3300009551 | Ga0105238_10204432 | Ga0105238_102044323 | 221 |
| 73 | 3300009553 | Ga0105249_10016947 | Ga0105249_100169474 | 221 |
| 74 | 3300010375 | Ga0105239_10246444 | Ga0105239_102464443 | 221 |
| 75 | 3300013102 | Ga0157371_10220231 | Ga0157371_102202312 | 221 |
| 76 | 3300013307 | Ga0157372_10047529 | Ga0157372_100475293 | 221 |
| 77 | 3300014745 | Ga0157377_10023451 | Ga0157377_100234512 | 221 |
| 78 | 3300025901 | Ga0207688_10008385 | Ga0207688_100083853 | 221 |
| 79 | 3300025908 | Ga0207643_10007206 | Ga0207643_100072063 | 221 |
| 80 | 3300025918 | Ga0207662_10064507 | Ga0207662_100645073 | 221 |
| 81 | 3300025923 | Ga0207681_10112624 | Ga0207681_101126242 | 221 |
| 82 | 3300025924 | Ga0207694_10098678 | Ga0207694_100986783 | 221 |
| 83 | 3300025927 | Ga0207687_10079422 | Ga0207687_100794221 | 221 |
| 84 | 3300025932 | Ga0207690_10048308 | Ga0207690_100483082 | 221 |
| 85 | 3300025935 | Ga0207709_10028352 | Ga0207709_100283523 | 221 |
| 86 | 3300025937 | Ga0207669_10003700 | Ga0207669_100037003 | 221 |
| 87 | 3300025940 | Ga0207691_10003397 | Ga0207691_100033974 | 221 |
| 88 | 3300025941 | Ga0207711_10262910 | Ga0207711_102629102 | 221 |
| 89 | 3300025944 | Ga0207661_10095263 | Ga0207661_100952632 | 221 |
| 90 | 3300025961 | Ga0207712_10021181 | Ga0207712_100211814 | 221 |
| 91 | 3300025981 | Ga0207640_10074685 | Ga0207640_100746852 | 221 |
| 92 | 3300026041 | Ga0207639_10131204 | Ga0207639_101312042 | 221 |
| 93 | 3300026075 | Ga0207708_10000180 | Ga0207708_1000018010 | 221 |
| 94 | 3300026089 | Ga0207648_10005348 | Ga0207648_100053484 | 221 |
| 95 | 3300026118 | Ga0207675_100006710 | Ga0207675_1000067101 | 221 |
| 96 | 3300026121 | Ga0207683_10348799 | Ga0207683_103487992 | 221 |
| 97 | 3300026142 | Ga0207698_10324524 | Ga0207698_103245242 | 221 |
| 98 | 3300035691 | Ga0373931_0255052 | Ga0373931_0255052_52_831 | 221 |
| 99 | 3300048908 | Ga0496105_0337433 | Ga0496105_0337433_43_822 | 221 |
| 100 | 3300048909 | Ga0496106_0552023 | Ga0496106_0552023_42_821 | 221 |
| 101 | 3300048911 | Ga0496108_0043561 | Ga0496108_0043561_873_1652 | 221 |
| 102 | 3300048913 | Ga0496110_0206664 | Ga0496110_0206664_176_955 | 221 |
| 103 | 3300048916 | Ga0496113_0647040 | Ga0496113_0647040_16_795 | 221 |
| 104 | 3300048917 | Ga0496114_0060827 | Ga0496114_0060827_1447_2226 | 221 |
| 105 | 3300049583 | Ga0501067_0025266 | Ga0501067_0025266_2070_2849 | 221 |
| 106 | 3300049585 | Ga0501069_0106741 | Ga0501069_0106741_185_964 | 221 |
| 107 | 3300061734 | Ga0530510_0046477 | Ga0530510_0046477_2277_3056 | 221 |
| 108 | 3300035691 | Ga0373931_0083300 | Ga0373931_0083300_646_1524 | 222 |
| 109 | 3300042136 | Ga0450900_007692 | Ga0450900_007692_351_1130 | 222 |
| 110 | 3300005435 | Ga0070714_100245433 | Ga0070714_1002454332 | 223 |
| 111 | 3300025929 | Ga0207664_10269582 | Ga0207664_102695822 | 223 |
| 112 | 3300048914 | Ga0496111_0624047 | Ga0496111_0624047_19_762 | 224 |
| 113 | 3300044656 | Ga0466969_0027675 | Ga0466969_0027675_710_1489 | 227 |
| 114 | 3300044684 | Ga0466966_0020375 | Ga0466966_0020375_1384_2163 | 227 |
| 115 | 3300044694 | Ga0466963_0045674 | Ga0466963_0045674_614_1393 | 227 |
| 116 | 3300044765 | Ga0466970_0134564 | Ga0466970_0134564_478_1257 | 227 |
| 117 | 3300045049 | Ga0466959_0062668 | Ga0466959_0062668_1691_2470 | 227 |
| 118 | 3300045836 | Ga0466958_0008909 | Ga0466958_0008909_705_1484 | 227 |
| 119 | 3300048911 | Ga0496108_0164254 | Ga0496108_0164254_1126_1905 | 227 |
| 120 | 3300048914 | Ga0496111_0180780 | Ga0496111_0180780_458_1303 | 227 |
| 121 | iso_pu_bacteria | 2675903058 | 2676478464 | 231 |
| 122 | iso_pu_bacteria | 2827628540 | 2827629522 | 231 |
| 123 | 3300025904 | Ga0207647_10138957 | Ga0207647_101389572 | 232 |
| 124 | 3300030745 | Ga0316182_1440866 | Ga0316182_14408669 | 232 |
| 125 | 3300031901 | Ga0307406_10040163 | Ga0307406_100401634 | 232 |
| 126 | 3300045976 | Ga0466967_0410422 | Ga0466967_0410422_229_1092 | 232 |
| 127 | 3300049568 | Ga0501031_0028500 | Ga0501031_0028500_1279_2067 | 232 |
| 128 | 3300049569 | Ga0501032_0018027 | Ga0501032_0018027_1169_1957 | 232 |
| 129 | 3300049569 | Ga0501032_0063608 | Ga0501032_0063608_1007_1795 | 232 |
| 130 | 3300049569 | Ga0501032_0123250 | Ga0501032_0123250_360_1148 | 232 |
| 131 | 3300049570 | Ga0501033_0026729 | Ga0501033_0026729_862_1650 | 232 |
| 132 | 3300049571 | Ga0501034_0048470 | Ga0501034_0048470_3367_4155 | 232 |
| 133 | 3300049572 | Ga0501036_0016896 | Ga0501036_0016896_288_1076 | 232 |
| 134 | 3300049573 | Ga0501037_0009658 | Ga0501037_0009658_5247_6035 | 232 |
| 135 | 3300049574 | Ga0501038_0006027 | Ga0501038_0006027_7051_7839 | 232 |
| 136 | 3300049574 | Ga0501038_0033639 | Ga0501038_0033639_634_1422 | 232 |
| 137 | 3300049575 | Ga0501039_0009483 | Ga0501039_0009483_1401_2189 | 232 |
| 138 | 3300049578 | Ga0501042_0019938 | Ga0501042_0019938_1662_2450 | 232 |
| 139 | 3300049579 | Ga0501043_0028595 | Ga0501043_0028595_1236_2024 | 232 |
| 140 | 3300049579 | Ga0501043_0074860 | Ga0501043_0074860_820_1608 | 232 |
| 141 | 3300049580 | Ga0501046_0001938 | Ga0501046_0001938_13909_14697 | 232 |
| 142 | 3300049580 | Ga0501046_0024257 | Ga0501046_0024257_578_1366 | 232 |
| 143 | 3300049581 | Ga0501047_0025976 | Ga0501047_0025976_1714_2502 | 232 |
| 144 | 3300049581 | Ga0501047_0420109 | Ga0501047_0420109_252_1040 | 232 |
| 145 | 3300049582 | Ga0501048_0012779 | Ga0501048_0012779_4456_5244 | 232 |
| 146 | 3300049586 | Ga0501070_0030630 | Ga0501070_0030630_2556_3344 | 232 |
| 147 | 3300049589 | Ga0501073_0091602 | Ga0501073_0091602_168_956 | 232 |
| 148 | 3300049742 | Ga0501080_0212831 | Ga0501080_0212831_850_1638 | 232 |
| 149 | 3300049822 | Ga0501035_0025992 | Ga0501035_0025992_4458_5246 | 232 |
| 150 | 3300049822 | Ga0501035_0047119 | Ga0501035_0047119_1932_2720 | 232 |
| 151 | 3300049823 | Ga0501044_0016208 | Ga0501044_0016208_4530_5318 | 232 |
| 152 | 3300049823 | Ga0501044_0462105 | Ga0501044_0462105_129_917 | 232 |
| 153 | iso_pu_bacteria | 2515154155 | 2515853538 | 232 |
| 154 | iso_pu_bacteria | 2773857762 | 2774396886 | 232 |
| 155 | iso_pu_bacteria | 2811994878 | 2812352895 | 232 |
| 156 | iso_pu_bacteria | 2866552031 | 2866555140 | 232 |
| 157 | iso_pu_bacteria | 2891968417 | 2891969587 | 232 |
| 158 | iso_pu_bacteria | 8056207758 | 8056211862 | 232 |
| 159 | 3300028794 | Ga0307515_10398800 | Ga0307515_103988002 | 233 |
| 160 | 3300045976 | Ga0466967_0066800 | Ga0466967_0066800_1658_2437 | 233 |
| 161 | 3300005336 | Ga0070680_100092772 | Ga0070680_1000927723 | 234 |
| 162 | 3300005338 | Ga0068868_100236811 | Ga0068868_1002368112 | 234 |
| 163 | 3300005366 | Ga0070659_100014601 | Ga0070659_1000146013 | 234 |
| 164 | 3300005435 | Ga0070714_100070621 | Ga0070714_1000706213 | 234 |
| 165 | 3300005455 | Ga0070663_100151044 | Ga0070663_1001510442 | 234 |
| 166 | 3300005458 | Ga0070681_10061384 | Ga0070681_100613842 | 234 |
| 167 | 3300005840 | Ga0068870_10250317 | Ga0068870_102503171 | 234 |
| 168 | 3300005937 | Ga0081455_10000018 | Ga0081455_10000018112 | 234 |
| 169 | 3300006028 | Ga0070717_10097125 | Ga0070717_100971252 | 234 |
| 170 | 3300006038 | Ga0075365_10171074 | Ga0075365_101710742 | 234 |
| 171 | 3300006042 | Ga0075368_10004514 | Ga0075368_100045142 | 234 |
| 172 | 3300006048 | Ga0075363_100010506 | Ga0075363_1000105065 | 234 |
| 173 | 3300006178 | Ga0075367_10072372 | Ga0075367_100723723 | 234 |
| 174 | 3300006846 | Ga0075430_100000172 | Ga0075430_10000017225 | 234 |
| 175 | 3300006846 | Ga0075430_100011555 | Ga0075430_1000115554 | 234 |
| 176 | 3300006847 | Ga0075431_100048735 | Ga0075431_1000487355 | 234 |
| 177 | 3300006847 | Ga0075431_100283322 | Ga0075431_1002833222 | 234 |
| 178 | 3300006852 | Ga0075433_10390604 | Ga0075433_103906041 | 234 |
| 179 | 3300006880 | Ga0075429_100020736 | Ga0075429_1000207367 | 234 |
| 180 | 3300006880 | Ga0075429_100038767 | Ga0075429_1000387672 | 234 |
| 181 | 3300009098 | Ga0105245_10044697 | Ga0105245_100446973 | 234 |
| 182 | 3300009147 | Ga0114129_10001688 | Ga0114129_1000168814 | 234 |
| 183 | 3300009147 | Ga0114129_10052886 | Ga0114129_100528863 | 234 |
| 184 | 3300009147 | Ga0114129_10223237 | Ga0114129_102232372 | 234 |
| 185 | 3300009176 | Ga0105242_10416479 | Ga0105242_104164792 | 234 |
| 186 | 3300009553 | Ga0105249_10178046 | Ga0105249_101780463 | 234 |
| 187 | 3300013102 | Ga0157371_10007167 | Ga0157371_100071671 | 234 |
| 188 | 3300013105 | Ga0157369_10005679 | Ga0157369_100056795 | 234 |
| 189 | 3300013306 | Ga0163162_10526132 | Ga0163162_105261322 | 234 |
| 190 | 3300013308 | Ga0157375_10067162 | Ga0157375_100671622 | 234 |
| 191 | 3300014326 | Ga0157380_10045220 | Ga0157380_100452204 | 234 |
| 192 | 3300017792 | Ga0163161_10310242 | Ga0163161_103102422 | 234 |
| 193 | 3300021388 | Ga0213875_10000097 | Ga0213875_1000009716 | 234 |
| 194 | 3300022467 | Ga0224712_10113681 | Ga0224712_101136812 | 234 |
| 195 | 3300025901 | Ga0207688_10222301 | Ga0207688_102223011 | 234 |
| 196 | 3300025909 | Ga0207705_10004774 | Ga0207705_100047747 | 234 |
| 197 | 3300025912 | Ga0207707_10386463 | Ga0207707_103864632 | 234 |
| 198 | 3300025917 | Ga0207660_10129494 | Ga0207660_101294942 | 234 |
| 199 | 3300025919 | Ga0207657_10128467 | Ga0207657_101284672 | 234 |
| 200 | 3300025919 | Ga0207657_10180823 | Ga0207657_101808232 | 234 |
| 201 | 3300025921 | Ga0207652_10019949 | Ga0207652_100199495 | 234 |
| 202 | 3300025927 | Ga0207687_10095217 | Ga0207687_100952173 | 234 |
| 203 | 3300025929 | Ga0207664_10125923 | Ga0207664_101259232 | 234 |
| 204 | 3300025932 | Ga0207690_10000222 | Ga0207690_1000022236 | 234 |
| 205 | 3300025932 | Ga0207690_10026297 | Ga0207690_100262972 | 234 |
| 206 | 3300025942 | Ga0207689_10152740 | Ga0207689_101527402 | 234 |
| 207 | 3300025944 | Ga0207661_10535502 | Ga0207661_105355021 | 234 |
| 208 | 3300025949 | Ga0207667_10289485 | Ga0207667_102894852 | 234 |
| 209 | 3300026067 | Ga0207678_10242171 | Ga0207678_102421712 | 234 |
| 210 | 3300028794 | Ga0307515_10040352 | Ga0307515_100403522 | 234 |
| 211 | 3300031901 | Ga0307406_10052351 | Ga0307406_100523512 | 234 |
| 212 | 3300031903 | Ga0307407_10177107 | Ga0307407_101771072 | 234 |
| 213 | 3300031995 | Ga0307409_100031403 | Ga0307409_1000314034 | 234 |
| 214 | 3300031995 | Ga0307409_100271503 | Ga0307409_1002715032 | 234 |
| 215 | 3300031995 | Ga0307409_100709961 | Ga0307409_1007099611 | 234 |
| 216 | 3300032126 | Ga0307415_100493061 | Ga0307415_1004930611 | 234 |
| 217 | 3300032126 | Ga0307415_100558199 | Ga0307415_1005581991 | 234 |
| 218 | 3300033179 | Ga0307507_10071798 | Ga0307507_100717982 | 234 |
| 219 | 3300033179 | Ga0307507_10092110 | Ga0307507_100921102 | 234 |
| 220 | 3300037466 | Ga0395898_0155351 | Ga0395898_0155351_562_1341 | 234 |
| 221 | 3300037471 | Ga0395905_0064826 | Ga0395905_0064826_1872_2651 | 234 |
| 222 | 3300037853 | Ga0436364_0296067 | Ga0436364_0296067_49107_49898 | 234 |
| 223 | 3300037853 | Ga0436364_1246252 | Ga0436364_1246252_1714_2493 | 234 |
| 224 | 3300039437 | Ga0436365_0218752 | Ga0436365_0218752_1507_2298 | 234 |
| 225 | 3300042016 | Ga0439463_071463 | Ga0439463_071463_50_829 | 234 |
| 226 | 3300042439 | Ga0439464_0081326 | Ga0439464_0081326_66_845 | 234 |
| 227 | 3300044683 | Ga0466965_0129042 | Ga0466965_0129042_163_954 | 234 |
| 228 | 3300044684 | Ga0466966_0034700 | Ga0466966_0034700_513_1292 | 234 |
| 229 | 3300044693 | Ga0466961_0361108 | Ga0466961_0361108_18_797 | 234 |
| 230 | 3300044719 | Ga0466971_0138545 | Ga0466971_0138545_211_990 | 234 |
| 231 | 3300045049 | Ga0466959_0004629 | Ga0466959_0004629_6737_7516 | 234 |
| 232 | 3300045836 | Ga0466958_0042354 | Ga0466958_0042354_679_1458 | 234 |
| 233 | 3300045836 | Ga0466958_0071462 | Ga0466958_0071462_10_789 | 234 |
| 234 | 3300045976 | Ga0466967_0032405 | Ga0466967_0032405_2034_2813 | 234 |
| 235 | 3300045976 | Ga0466967_0041283 | Ga0466967_0041283_1228_2007 | 234 |
| 236 | 3300045976 | Ga0466967_0067507 | Ga0466967_0067507_2000_2779 | 234 |
| 237 | 3300045976 | Ga0466967_0299194 | Ga0466967_0299194_284_1075 | 234 |
| 238 | 3300045976 | Ga0466967_0491383 | Ga0466967_0491383_20_802 | 234 |
| 239 | 3300048907 | Ga0496104_0071003 | Ga0496104_0071003_443_1222 | 234 |
| 240 | 3300048912 | Ga0496109_0416073 | Ga0496109_0416073_56_916 | 234 |
| 241 | 3300048913 | Ga0496110_0010868 | Ga0496110_0010868_2003_2782 | 234 |
| 242 | 3300048913 | Ga0496110_0192211 | Ga0496110_0192211_896_1756 | 234 |
| 243 | 3300048914 | Ga0496111_0026028 | Ga0496111_0026028_1148_1927 | 234 |
| 244 | 3300048917 | Ga0496114_0029242 | Ga0496114_0029242_3319_4098 | 234 |
| 245 | 3300049568 | Ga0501031_0407676 | Ga0501031_0407676_37_816 | 234 |
| 246 | 3300049581 | Ga0501047_0087083 | Ga0501047_0087083_1195_1998 | 234 |
| 247 | 3300049742 | Ga0501080_0129594 | Ga0501080_0129594_357_1160 | 234 |
| 248 | 3300049743 | Ga0501081_0267415 | Ga0501081_0267415_283_1113 | 234 |
| 249 | 3300050491 | nmdc:mga00v17_5542_c1 | nmdc:mga00v17_5542_c1_2176_2967 | 234 |
| 250 | 3300050492 | nmdc:mga0yw44_266772_c1 | nmdc:mga0yw44_266772_c1_37_825 | 234 |
| 251 | 3300050496 | nmdc:mga07m45_59187_c1 | nmdc:mga07m45_59187_c1_800_1591 | 234 |
| 252 | 3300050507 | nmdc:mga05p37_171358_c1 | nmdc:mga05p37_171358_c1_141_914 | 234 |
| 253 | 3300050507 | nmdc:mga05p37_8792_c1 | nmdc:mga05p37_8792_c1_9873_10646 | 234 |
| 254 | 3300050508 | nmdc:mga09592_13817_c1 | nmdc:mga09592_13817_c1_2899_3672 | 234 |
| 255 | 3300050508 | nmdc:mga09592_438254_c1 | nmdc:mga09592_438254_c1_146_919 | 234 |
| 256 | 3300050509 | nmdc:mga0qj67_26355_c1 | nmdc:mga0qj67_26355_c1_3346_4119 | 234 |
| 257 | 3300050509 | nmdc:mga0qj67_263_c2 | nmdc:mga0qj67_263_c2_7138_7911 | 234 |
| 258 | 3300050510 | nmdc:mga06r32_68289_c1 | nmdc:mga06r32_68289_c1_900_1673 | 234 |
| 259 | 3300050511 | nmdc:mga08y16_559607_c1 | nmdc:mga08y16_559607_c1_73_852 | 234 |
| 260 | 3300053092 | Ga0500583_0043745 | Ga0500583_0043745_118_891 | 234 |
| 261 | 3300053099 | Ga0500654_046347 | Ga0500654_046347_1553_2326 | 234 |
| 262 | 3300053118 | Ga0500594_0056440 | Ga0500594_0056440_333_1106 | 234 |
| 263 | 3300053139 | Ga0500568_0003911 | Ga0500568_0003911_328_1107 | 234 |
| 264 | 3300053146 | Ga0500588_0011735 | Ga0500588_0011735_529_1302 | 234 |
| 265 | 3300061719 | Ga0466962_0007260 | Ga0466962_0007260_432_1211 | 234 |
| 266 | iso_pu_bacteria | 2808606439 | 2809198525 | 234 |
| 267 | 3300005329 | Ga0070683_100367312 | Ga0070683_1003673122 | 235 |
| 268 | 3300005336 | Ga0070680_100173565 | Ga0070680_1001735653 | 235 |
| 269 | 3300005344 | Ga0070661_100048024 | Ga0070661_1000480243 | 235 |
| 270 | 3300005458 | Ga0070681_10100373 | Ga0070681_101003732 | 235 |
| 271 | 3300005530 | Ga0070679_100465652 | Ga0070679_1004656521 | 235 |
| 272 | 3300005535 | Ga0070684_100021214 | Ga0070684_1000212145 | 235 |
| 273 | 3300005535 | Ga0070684_100086671 | Ga0070684_1000866712 | 235 |
| 274 | 3300005548 | Ga0070665_100231440 | Ga0070665_1002314401 | 235 |
| 275 | 3300005564 | Ga0070664_100015036 | Ga0070664_1000150362 | 235 |
| 276 | 3300005577 | Ga0068857_100244141 | Ga0068857_1002441412 | 235 |
| 277 | 3300005614 | Ga0068856_100407091 | Ga0068856_1004070912 | 235 |
| 278 | 3300005618 | Ga0068864_100183366 | Ga0068864_1001833663 | 235 |
| 279 | 3300005618 | Ga0068864_100276962 | Ga0068864_1002769622 | 235 |
| 280 | 3300005841 | Ga0068863_100023016 | Ga0068863_1000230165 | 235 |
| 281 | 3300009177 | Ga0105248_10092568 | Ga0105248_100925683 | 235 |
| 282 | 3300013105 | Ga0157369_10002337 | Ga0157369_1000233711 | 235 |
| 283 | 3300014325 | Ga0163163_10035229 | Ga0163163_100352296 | 235 |
| 284 | 3300014325 | Ga0163163_10502645 | Ga0163163_105026452 | 235 |
| 285 | 3300020082 | Ga0206353_12064211 | Ga0206353_120642111 | 235 |
| 286 | 3300025909 | Ga0207705_10033518 | Ga0207705_100335184 | 235 |
| 287 | 3300025912 | Ga0207707_10129264 | Ga0207707_101292643 | 235 |
| 288 | 3300025920 | Ga0207649_10116944 | Ga0207649_101169442 | 235 |
| 289 | 3300025921 | Ga0207652_10116078 | Ga0207652_101160784 | 235 |
| 290 | 3300025932 | Ga0207690_10034927 | Ga0207690_100349272 | 235 |
| 291 | 3300025944 | Ga0207661_10032212 | Ga0207661_100322124 | 235 |
| 292 | 3300026088 | Ga0207641_10026907 | Ga0207641_100269072 | 235 |
| 293 | 3300026095 | Ga0207676_10114459 | Ga0207676_101144592 | 235 |
| 294 | 3300026116 | Ga0207674_10016918 | Ga0207674_100169186 | 235 |
| 295 | 3300046459 | Ga0495629_0330564 | Ga0495629_0330564_12_812 | 235 |
| 296 | 3300048908 | Ga0496105_0213585 | Ga0496105_0213585_364_1140 | 235 |
| 297 | 3300048913 | Ga0496110_0332151 | Ga0496110_0332151_410_1270 | 235 |
| 298 | 3300048915 | Ga0496112_0007675 | Ga0496112_0007675_4409_5185 | 235 |
| 299 | 3300048915 | Ga0496112_0023624 | Ga0496112_0023624_2538_3398 | 235 |
| 300 | 3300048915 | Ga0496112_0048557 | Ga0496112_0048557_1332_2108 | 235 |
| 301 | 3300048916 | Ga0496113_0338981 | Ga0496113_0338981_322_1182 | 235 |
| 302 | 3300049574 | Ga0501038_0190645 | Ga0501038_0190645_29_805 | 235 |
| 303 | 3300049581 | Ga0501047_0009441 | Ga0501047_0009441_2731_3501 | 235 |
| 304 | 3300061734 | Ga0530510_0065600 | Ga0530510_0065600_317_1132 | 235 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lao-assembly1.cif.gz_C | crystal structure of enoyl-coa hydratase from pseudomonas aeruginosa pa01 | 0.9313 | 71 | 192 |
| 3lao-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase from pseudomonas aeruginosa pa01 | 0.9126 | 71 | 192 |
| 4q1i-assembly1.cif.gz_A | structure and mechanism of a dehydratase/decarboxylase enzyme couple involved in polyketide beta-branching | 0.9061 | 64 | 193 |
| 4di1-assembly1.cif.gz_B | crystal structure of enoyl-coa hydratase echa17 from mycobacterium marinum | 0.8963 | 2 | 214 |
| 5z7r-assembly1.cif.gz_A | crystal structure of crotonase from clostridium acetobutylicum | 0.8961 | 1 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P30084_233_289_1.10.12.10 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9809 | 182 | 232 | 1.10.12.10 |
| 2hw5B02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9787 | 182 | 232 | 1.10.12.10 |
| 1mj3E02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9787 | 182 | 232 | 1.10.12.10 |
| 1mj3C02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9785 | 182 | 232 | 1.10.12.10 |
| 2hw5F02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9778 | 182 | 232 | 1.10.12.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3IPN9-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9687 | 50 | 178 |
GO:0006635
GO:0016836 GO:0016853 |
| AF-A0A7W1E3B8-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9678 | 63 | 235 |
GO:0006635
GO:0016836 GO:0016853 |
| AF-T0YY04-F1-model_v4 | Enoyl-CoA hydratase/isomerase | 0.9635 | 45 | 235 |
GO:0006635
GO:0016836 GO:0016853 |
| AF-A0A6B3IPN9-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9614 | 50 | 178 |
GO:0006635
GO:0016836 GO:0016853 |
| AF-A0A067D9Z2-F1-model_v4 | Enoyl-CoA hydratase | 0.9611 | 38 | 173 |
GO:0016836
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar