F397587

General Info

Members Datasets Scaffolds Average Seq Length
304 206 295 253

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10526132|Ga0163162_105261322
Length 299
Sequence MSFEQGGPAATTRWQGGLAVTPAHAGRADEVATGDGGGGRVTEFVRLEVDGGVGTIRLDRPPMNAISRAVGDELRSVAAEATARDDVRAVIVYGGEKVFAAGADVKEMASLTYAEMAPIARSVSAGLGALAGIPKPTVAAITGYALGGGLEVVLTCDRRIAADNATLGVPEILLGIIPGGGGTQRLARLVGPARAKDMVYTGRFVRADEALAIGLVDELVPAADVYARARAYVEPFAHGPALAYAAAKKAIDGGLDVDLRTGLDIESDQFAGLFATDDQRIGMASFVEHGPGKAQFTGR

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
3 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
4 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
5 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
6 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
7 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
8 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
139 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
140 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
198 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
199 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
200 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 0.66
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.61
Nodule 0
Rhizoplane 6.91
Rhizosphere 83.55
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100367312 3300005329 Bacteria 1370
2 Ga0070670_100173445 3300005331 Bacteria 1871
3 Ga0070680_100092772 3300005336 Bacteria 2501
4 Ga0070680_100173565 3300005336 Bacteria 1815
5 Ga0070682_100022600 3300005337 Bacteria 3727
6 Ga0068868_100236811 3300005338 Bacteria 1533
7 Ga0068868_100496980 3300005338 Bacteria 1068
8 Ga0070691_10156806 3300005341 Bacteria 1171
9 Ga0070687_100073237 3300005343 Bacteria 1846
10 Ga0070661_100048024 3300005344 Bacteria 3124
11 Ga0070692_10005752 3300005345 Bacteria 5325
12 Ga0070668_100001660 3300005347 Bacteria 16146
13 Ga0070669_100116699 3300005353 Bacteria 2032
14 Ga0070675_100064529 3300005354 Bacteria 3027
15 Ga0070674_100144277 3300005356 Bacteria 1790
16 Ga0070673_100037863 3300005364 Bacteria 3679
17 Ga0070659_100014601 3300005366 Bacteria 5872
18 Ga0070659_100040425 3300005366 Bacteria 3644
19 Ga0070714_100070621 3300005435 Bacteria 3019
20 Ga0070714_100245433 3300005435 Bacteria 1654
21 Ga0070701_10014104 3300005438 Bacteria 3655
22 Ga0070700_100021918 3300005441 Bacteria 3718
23 Ga0070663_100151044 3300005455 Bacteria 1781
24 Ga0070681_10061384 3300005458 Bacteria 3734
25 Ga0070681_10100373 3300005458 Bacteria 2840
26 Ga0068867_100009302 3300005459 Bacteria 6931
27 Ga0070685_10422447 3300005466 Bacteria 928
28 Ga0070706_100698069 3300005467 Bacteria 941
29 Ga0070679_100465652 3300005530 Bacteria 1208
30 Ga0070684_100021214 3300005535 Bacteria 5400
31 Ga0070684_100086671 3300005535 Bacteria 2779
32 Ga0070684_100229369 3300005535 Bacteria 1695
33 Ga0068853_100171336 3300005539 Bacteria 1964
34 Ga0070672_100010075 3300005543 Bacteria 6543
35 Ga0070686_100069836 3300005544 Bacteria 2295
36 Ga0070665_100231440 3300005548 Bacteria 1848
37 Ga0070664_100015036 3300005564 Bacteria 6317
38 Ga0068857_100244141 3300005577 Bacteria 1645
39 Ga0068854_100042222 3300005578 Bacteria 3227
40 Ga0068856_100407091 3300005614 Bacteria 1380
41 Ga0070702_100335843 3300005615 Bacteria 1058
42 Ga0068852_100050000 3300005616 Bacteria 3579
43 Ga0068859_100185139 3300005617 Bacteria 2166
44 Ga0068864_100183366 3300005618 Bacteria 1915
45 Ga0068864_100276962 3300005618 Bacteria 1565
46 Ga0068866_10029247 3300005718 Bacteria 2633
47 Ga0068870_10015852 3300005840 Bacteria 3586
48 Ga0068870_10250317 3300005840 Bacteria 1098
49 Ga0068863_100023016 3300005841 Bacteria 5955
50 Ga0068860_100288546 3300005843 Bacteria 1605
51 Ga0081455_10000018 3300005937 Bacteria 173683
52 Ga0070717_10097125 3300006028 Bacteria 2496
53 Ga0075365_10171074 3300006038 Bacteria 1516
54 Ga0075368_10004514 3300006042 Bacteria 4727
55 Ga0075363_100010506 3300006048 Bacteria 4401
56 Ga0075367_10072372 3300006178 Bacteria 2075
57 Ga0075428_100069121 3300006844 Bacteria 3863
58 Ga0075430_100000172 3300006846 Bacteria 42600
59 Ga0075430_100011555 3300006846 Bacteria 7507
60 Ga0075431_100048735 3300006847 Bacteria 4369
61 Ga0075431_100283322 3300006847 Bacteria 1678
62 Ga0075431_100399286 3300006847 Bacteria 1376
63 Ga0075433_10390604 3300006852 Bacteria 1228
64 Ga0075429_100020736 3300006880 Bacteria 5705
65 Ga0075429_100038767 3300006880 Bacteria 4148
66 Ga0068865_100001007 3300006881 Bacteria 16180
67 Ga0097620_100185137 3300006931 Bacteria 2166
68 Ga0111539_10189555 3300009094 Bacteria 2400
69 Ga0105245_10044697 3300009098 Bacteria 3954
70 Ga0105245_10077377 3300009098 Bacteria 3033
71 Ga0114129_10000056 3300009147 Bacteria 99329
72 Ga0114129_10001688 3300009147 Bacteria 30106
73 Ga0114129_10052886 3300009147 Bacteria 5699
74 Ga0114129_10223237 3300009147 Bacteria 2541
75 Ga0105243_10023226 3300009148 Bacteria 4720
76 Ga0105242_10416479 3300009176 Bacteria 1258
77 Ga0105248_10014374 3300009177 Bacteria 8712
78 Ga0105248_10092568 3300009177 Bacteria 3405
79 Ga0105238_10204432 3300009551 Bacteria 1951
80 Ga0105249_10016947 3300009553 Bacteria 6464
81 Ga0105249_10178046 3300009553 Bacteria 2067
82 Ga0105239_10246444 3300010375 Bacteria 2006
83 Ga0157371_10007167 3300013102 Bacteria 9058
84 Ga0157371_10220231 3300013102 Bacteria 1363
85 Ga0157369_10002337 3300013105 Bacteria 22828
86 Ga0157369_10005679 3300013105 Bacteria 14496
87 Ga0163162_10526132 3300013306 Bacteria 1312
88 Ga0157372_10047529 3300013307 Bacteria 4769
89 Ga0157375_10067162 3300013308 Bacteria 3582
90 Ga0163163_10035229 3300014325 Bacteria 4855
91 Ga0163163_10502645 3300014325 Bacteria 1274
92 Ga0157380_10045220 3300014326 Bacteria 3454
93 Ga0157377_10023451 3300014745 Bacteria 3271
94 Ga0163161_10310242 3300017792 Bacteria 1244
95 Ga0206353_12064211 3300020082 Bacteria 1326
96 Ga0213875_10000097 3300021388 Bacteria 101618
97 Ga0224712_10113681 3300022467 Bacteria 1164
98 Ga0207688_10008385 3300025901 Bacteria 5621
99 Ga0207688_10222301 3300025901 Bacteria 1138
100 Ga0207647_10138957 3300025904 Bacteria 1424
101 Ga0207643_10007206 3300025908 Bacteria 5970
102 Ga0207705_10004774 3300025909 Bacteria 10205
103 Ga0207705_10033518 3300025909 Bacteria 3670
104 Ga0207707_10129264 3300025912 Bacteria 2209
105 Ga0207707_10386463 3300025912 Bacteria 1203
106 Ga0207660_10129494 3300025917 Bacteria 1919
107 Ga0207662_10064507 3300025918 Bacteria 2204
108 Ga0207657_10128467 3300025919 Bacteria 2079
109 Ga0207657_10180823 3300025919 Bacteria 1705
110 Ga0207649_10116944 3300025920 Bacteria 1791
111 Ga0207652_10019949 3300025921 Bacteria 5520
112 Ga0207652_10116078 3300025921 Bacteria 2378
113 Ga0207681_10112624 3300025923 Bacteria 1982
114 Ga0207694_10098678 3300025924 Bacteria 2313
115 Ga0207687_10079422 3300025927 Bacteria 2366
116 Ga0207687_10095217 3300025927 Bacteria 2180
117 Ga0207664_10125923 3300025929 Bacteria 2151
118 Ga0207664_10269582 3300025929 Bacteria 1491
119 Ga0207690_10000222 3300025932 Bacteria 42867
120 Ga0207690_10026297 3300025932 Bacteria 3663
121 Ga0207690_10034927 3300025932 Bacteria 3242
122 Ga0207690_10048308 3300025932 Bacteria 2829
123 Ga0207709_10028352 3300025935 Bacteria 3237
124 Ga0207669_10003700 3300025937 Bacteria 6652
125 Ga0207691_10003397 3300025940 Bacteria 15481
126 Ga0207711_10262910 3300025941 Bacteria 1586
127 Ga0207689_10152740 3300025942 Bacteria 1903
128 Ga0207661_10032212 3300025944 Bacteria 4058
129 Ga0207661_10095263 3300025944 Bacteria 2488
130 Ga0207661_10535502 3300025944 Bacteria 1072
131 Ga0207667_10289485 3300025949 Bacteria 1674
132 Ga0207712_10021181 3300025961 Bacteria 4265
133 Ga0207668_10007375 3300025972 Bacteria 6536
134 Ga0207640_10074685 3300025981 Bacteria 2295
135 Ga0207658_10171215 3300025986 Bacteria 1789
136 Ga0207639_10131204 3300026041 Bacteria 2074
137 Ga0207678_10242171 3300026067 Bacteria 1545
138 Ga0207708_10000180 3300026075 Bacteria 49555
139 Ga0207641_10026907 3300026088 Bacteria 4749
140 Ga0207648_10005348 3300026089 Bacteria 12943
141 Ga0207648_10346843 3300026089 Bacteria 1338
142 Ga0207676_10114459 3300026095 Bacteria 2263
143 Ga0207674_10016918 3300026116 Bacteria 7964
144 Ga0207675_100006710 3300026118 Bacteria 10882
145 Ga0207683_10348799 3300026121 Bacteria 1358
146 Ga0207698_10324524 3300026142 Bacteria 1443
147 Ga0268265_10039794 3300028380 Bacteria 3467
148 Ga0268264_10241664 3300028381 Bacteria 1673
149 Ga0307515_10040352 3300028794 Bacteria 7384
150 Ga0307515_10398800 3300028794 Bacteria 1002
151 Ga0316182_1440866 3300030745 Bacteria 11079
152 Ga0307508_10177656 3300031616 Bacteria 1732
153 Ga0307508_10286002 3300031616 Bacteria 1242
154 Ga0307406_10040163 3300031901 Bacteria 2908
155 Ga0307406_10052351 3300031901 Bacteria 2596
156 Ga0307407_10177107 3300031903 Bacteria 1410
157 Ga0307409_100031403 3300031995 Bacteria 3833
158 Ga0307409_100271503 3300031995 Bacteria 1562
159 Ga0307409_100709961 3300031995 Bacteria 1006
160 Ga0307415_100493061 3300032126 Bacteria 1069
161 Ga0307415_100558199 3300032126 Bacteria 1012
162 Ga0307507_10071798 3300033179 Bacteria 3126
163 Ga0307507_10092110 3300033179 Bacteria 2590
164 Ga0373940_0001863 3300035088 Bacteria 3959
165 Ga0373942_0001291 3300035207 Bacteria 6556
166 Ga0373962_0002388 3300035242 Bacteria 4476
167 Ga0373931_0083300 3300035691 Bacteria 1769
168 Ga0373931_0255052 3300035691 Bacteria 1068
169 Ga0395898_0155351 3300037466 Bacteria 2188
170 Ga0395905_0064826 3300037471 Bacteria 3420
171 Ga0436364_0296067 3300037853 Bacteria 138817
172 Ga0436364_1246252 3300037853 Bacteria 3091
173 Ga0436365_0218752 3300039437 Bacteria 2787
174 Ga0439463_071463 3300042016 Bacteria 889
175 Ga0450900_007692 3300042136 Bacteria 1333
176 Ga0439464_0081326 3300042439 Bacteria 968
177 Ga0466969_0027675 3300044656 Bacteria 2902
178 Ga0466969_0054447 3300044656 Bacteria 1959
179 Ga0466965_0103929 3300044683 Bacteria 1455
180 Ga0466965_0129042 3300044683 Bacteria 1310
181 Ga0466966_0004593 3300044684 Bacteria 9097
182 Ga0466966_0020375 3300044684 Bacteria 4361
183 Ga0466966_0034700 3300044684 Bacteria 3261
184 Ga0466966_0065143 3300044684 Bacteria 2292
185 Ga0466961_0023170 3300044693 Bacteria 3993
186 Ga0466961_0361108 3300044693 Bacteria 883
187 Ga0466963_0011026 3300044694 Bacteria 5495
188 Ga0466963_0038686 3300044694 Bacteria 3121
189 Ga0466963_0045674 3300044694 Bacteria 2885
190 Ga0466971_0011030 3300044719 Bacteria 3956
191 Ga0466971_0067573 3300044719 Bacteria 1620
192 Ga0466971_0138545 3300044719 Bacteria 1132
193 Ga0466970_0134564 3300044765 Bacteria 1359
194 Ga0466957_0016575 3300044842 Bacteria 4309
195 Ga0466960_0245356 3300044901 Bacteria 993
196 Ga0466959_0004629 3300045049 Bacteria 9249
197 Ga0466959_0029690 3300045049 Bacteria 4051
198 Ga0466959_0062668 3300045049 Bacteria 2701
199 Ga0466958_0008909 3300045836 Bacteria 5575
200 Ga0466958_0022683 3300045836 Bacteria 3680
201 Ga0466958_0042354 3300045836 Bacteria 2742
202 Ga0466958_0071462 3300045836 Bacteria 2125
203 Ga0466958_0119322 3300045836 Bacteria 1650
204 Ga0466967_0032405 3300045976 Bacteria 4413
205 Ga0466967_0041283 3300045976 Bacteria 3977
206 Ga0466967_0066800 3300045976 Bacteria 3205
207 Ga0466967_0067507 3300045976 Bacteria 3190
208 Ga0466967_0299194 3300045976 Bacteria 1548
209 Ga0466967_0410422 3300045976 Bacteria 1319
210 Ga0466967_0491383 3300045976 Bacteria 1203
211 Ga0495629_0330564 3300046459 Bacteria 1041
212 Ga0495594_0035922 3300046499 Bacteria 2701
213 Ga0495645_0090468 3300046543 Bacteria 2187
214 Ga0495600_0141153 3300046809 Bacteria 1563
215 Ga0495675_0057486 3300047444 Bacteria 2466
216 Ga0496104_0071003 3300048907 Bacteria 3311
217 Ga0496105_0213585 3300048908 Bacteria 1572
218 Ga0496105_0337433 3300048908 Bacteria 1206
219 Ga0496106_0552023 3300048909 Bacteria 924
220 Ga0496108_0043561 3300048911 Bacteria 3749
221 Ga0496108_0164254 3300048911 Bacteria 1920
222 Ga0496109_0416073 3300048912 Bacteria 1270
223 Ga0496110_0010868 3300048913 Bacteria 7421
224 Ga0496110_0192211 3300048913 Bacteria 1853
225 Ga0496110_0206664 3300048913 Bacteria 1784
226 Ga0496110_0332151 3300048913 Bacteria 1385
227 Ga0496111_0026028 3300048914 Bacteria 4129
228 Ga0496111_0180780 3300048914 Bacteria 1568
229 Ga0496111_0624047 3300048914 Bacteria 788
230 Ga0496112_0007675 3300048915 Bacteria 9598
231 Ga0496112_0023624 3300048915 Bacteria 5878
232 Ga0496112_0048557 3300048915 Bacteria 4161
233 Ga0496113_0338981 3300048916 Bacteria 1206
234 Ga0496113_0647040 3300048916 Bacteria 845
235 Ga0496114_0029242 3300048917 Bacteria 4527
236 Ga0496114_0060827 3300048917 Bacteria 3157
237 Ga0501031_0028500 3300049568 Bacteria 3640
238 Ga0501031_0407676 3300049568 Bacteria 879
239 Ga0501032_0018027 3300049569 Bacteria 4952
240 Ga0501032_0063608 3300049569 Bacteria 2470
241 Ga0501032_0123250 3300049569 Bacteria 1713
242 Ga0501033_0026729 3300049570 Bacteria 4342
243 Ga0501034_0048470 3300049571 Bacteria 4287
244 Ga0501036_0016896 3300049572 Bacteria 6095
245 Ga0501037_0009658 3300049573 Bacteria 7081
246 Ga0501038_0006027 3300049574 Bacteria 11218
247 Ga0501038_0033639 3300049574 Bacteria 4514
248 Ga0501038_0190645 3300049574 Bacteria 1650
249 Ga0501039_0009483 3300049575 Bacteria 7421
250 Ga0501042_0019938 3300049578 Bacteria 4664
251 Ga0501043_0028595 3300049579 Bacteria 4376
252 Ga0501043_0074860 3300049579 Bacteria 2660
253 Ga0501046_0001938 3300049580 Bacteria 19639
254 Ga0501046_0024257 3300049580 Bacteria 4978
255 Ga0501047_0009441 3300049581 Bacteria 9215
256 Ga0501047_0025976 3300049581 Bacteria 5631
257 Ga0501047_0087083 3300049581 Bacteria 3001
258 Ga0501047_0420109 3300049581 Bacteria 1168
259 Ga0501048_0012779 3300049582 Bacteria 6242
260 Ga0501067_0025266 3300049583 Bacteria 3292
261 Ga0501069_0106741 3300049585 Bacteria 1592
262 Ga0501070_0030630 3300049586 Bacteria 4508
263 Ga0501073_0091602 3300049589 Bacteria 2113
264 Ga0501080_0129594 3300049742 Bacteria 2335
265 Ga0501080_0212831 3300049742 Bacteria 1771
266 Ga0501081_0267415 3300049743 Bacteria 1250
267 Ga0501035_0025992 3300049822 Bacteria 5363
268 Ga0501035_0047119 3300049822 Bacteria 3871
269 Ga0501044_0016208 3300049823 Bacteria 8011
270 Ga0501044_0462105 3300049823 Bacteria 1174
271 nmdc:mga00v17_113521_c1 3300050491 Bacteria 1720
272 nmdc:mga00v17_5542_c1 3300050491 Bacteria 6653
273 nmdc:mga0yw44_266772_c1 3300050492 Bacteria 1142
274 nmdc:mga07m45_59187_c1 3300050496 Bacteria 2167
275 nmdc:mga05p37_171358_c1 3300050507 Bacteria 2647
276 nmdc:mga05p37_720_c1 3300050507 Bacteria 36593
277 nmdc:mga05p37_8792_c1 3300050507 Bacteria 11934
278 nmdc:mga09592_13817_c1 3300050508 Bacteria 6597
279 nmdc:mga09592_438254_c1 3300050508 Bacteria 1128
280 nmdc:mga0qj67_26355_c1 3300050509 Bacteria 4500
281 nmdc:mga0qj67_263_c2 3300050509 Bacteria 17708
282 nmdc:mga06r32_312696_c1 3300050510 Bacteria 1556
283 nmdc:mga06r32_68289_c1 3300050510 Bacteria 3434
284 nmdc:mga08y16_559607_c1 3300050511 Bacteria 1156
285 Ga0500646_0000083 3300053090 Bacteria 26729
286 Ga0500583_0043745 3300053092 Bacteria 2047
287 Ga0500654_046347 3300053099 Bacteria 2399
288 Ga0500594_0056440 3300053118 Bacteria 1120
289 Ga0500568_0003911 3300053139 Bacteria 8106
290 Ga0500588_0011735 3300053146 Bacteria 2153
291 Ga0501084_0357644 3300054114 Bacteria 1234
292 Ga0466962_0007260 3300061719 Bacteria 5309
293 Ga0466962_0030387 3300061719 Bacteria 2587
294 Ga0530510_0046477 3300061734 Bacteria 3136
295 Ga0530510_0065600 3300061734 Bacteria 2631

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0054447 Ga0466969_0054447_805_1635 203
2 3300044684 Ga0466966_0065143 Ga0466966_0065143_657_1487 203
3 3300044693 Ga0466961_0023170 Ga0466961_0023170_692_1522 203
4 3300044694 Ga0466963_0038686 Ga0466963_0038686_1780_2610 203
5 3300044719 Ga0466971_0067573 Ga0466971_0067573_622_1452 203
6 3300045836 Ga0466958_0119322 Ga0466958_0119322_37_867 203
7 3300061719 Ga0466962_0030387 Ga0466962_0030387_271_1101 203
8 3300006847 Ga0075431_100399286 Ga0075431_1003992861 207
9 3300009147 Ga0114129_10000056 Ga0114129_1000005665 207
10 3300046499 Ga0495594_0035922 Ga0495594_0035922_150_923 207
11 3300050507 nmdc:mga05p37_720_c1 nmdc:mga05p37_720_c1_26419_27243 207
12 3300050510 nmdc:mga06r32_312696_c1 nmdc:mga06r32_312696_c1_236_1060 207
13 3300046543 Ga0495645_0090468 Ga0495645_0090468_172_945 209
14 3300046809 Ga0495600_0141153 Ga0495600_0141153_763_1536 209
15 3300047444 Ga0495675_0057486 Ga0495675_0057486_1610_2383 209
16 3300035088 Ga0373940_0001863 Ga0373940_0001863_3120_3893 211
17 3300035207 Ga0373942_0001291 Ga0373942_0001291_3674_4447 211
18 3300035242 Ga0373962_0002388 Ga0373962_0002388_3530_4303 211
19 3300031616 Ga0307508_10177656 Ga0307508_101776562 212
20 3300005347 Ga0070668_100001660 Ga0070668_1000016608 213
21 3300005467 Ga0070706_100698069 Ga0070706_1006980691 213
22 3300005617 Ga0068859_100185139 Ga0068859_1001851392 213
23 3300005843 Ga0068860_100288546 Ga0068860_1002885462 213
24 3300006931 Ga0097620_100185137 Ga0097620_1001851372 213
25 3300025972 Ga0207668_10007375 Ga0207668_100073757 213
26 3300028380 Ga0268265_10039794 Ga0268265_100397943 213
27 3300028381 Ga0268264_10241664 Ga0268264_102416642 213
28 3300053090 Ga0500646_0000083 Ga0500646_0000083_23728_24435 214
29 3300054114 Ga0501084_0357644 Ga0501084_0357644_17_724 214
30 3300031616 Ga0307508_10286002 Ga0307508_102860022 216
31 3300026089 Ga0207648_10346843 Ga0207648_103468432 218
32 3300025986 Ga0207658_10171215 Ga0207658_101712152 219
33 3300044683 Ga0466965_0103929 Ga0466965_0103929_60_836 219
34 3300044684 Ga0466966_0004593 Ga0466966_0004593_7510_8286 219
35 3300044694 Ga0466963_0011026 Ga0466963_0011026_3672_4448 219
36 3300044719 Ga0466971_0011030 Ga0466971_0011030_24_800 219
37 3300044842 Ga0466957_0016575 Ga0466957_0016575_1670_2446 219
38 3300044901 Ga0466960_0245356 Ga0466960_0245356_152_928 219
39 3300045049 Ga0466959_0029690 Ga0466959_0029690_1622_2398 219
40 3300045836 Ga0466958_0022683 Ga0466958_0022683_716_1492 219
41 3300050491 nmdc:mga00v17_113521_c1 nmdc:mga00v17_113521_c1_12_740 219
42 3300005331 Ga0070670_100173445 Ga0070670_1001734453 221
43 3300005337 Ga0070682_100022600 Ga0070682_1000226003 221
44 3300005338 Ga0068868_100496980 Ga0068868_1004969801 221
45 3300005341 Ga0070691_10156806 Ga0070691_101568062 221
46 3300005343 Ga0070687_100073237 Ga0070687_1000732373 221
47 3300005345 Ga0070692_10005752 Ga0070692_100057524 221
48 3300005353 Ga0070669_100116699 Ga0070669_1001166993 221
49 3300005354 Ga0070675_100064529 Ga0070675_1000645294 221
50 3300005356 Ga0070674_100144277 Ga0070674_1001442771 221
51 3300005364 Ga0070673_100037863 Ga0070673_1000378633 221
52 3300005366 Ga0070659_100040425 Ga0070659_1000404253 221
53 3300005438 Ga0070701_10014104 Ga0070701_100141041 221
54 3300005441 Ga0070700_100021918 Ga0070700_1000219183 221
55 3300005459 Ga0068867_100009302 Ga0068867_1000093027 221
56 3300005466 Ga0070685_10422447 Ga0070685_104224471 221
57 3300005535 Ga0070684_100229369 Ga0070684_1002293692 221
58 3300005539 Ga0068853_100171336 Ga0068853_1001713362 221
59 3300005543 Ga0070672_100010075 Ga0070672_1000100752 221
60 3300005544 Ga0070686_100069836 Ga0070686_1000698362 221
61 3300005578 Ga0068854_100042222 Ga0068854_1000422223 221
62 3300005615 Ga0070702_100335843 Ga0070702_1003358431 221
63 3300005616 Ga0068852_100050000 Ga0068852_1000500003 221
64 3300005718 Ga0068866_10029247 Ga0068866_100292473 221
65 3300005840 Ga0068870_10015852 Ga0068870_100158522 221
66 3300006844 Ga0075428_100069121 Ga0075428_1000691212 221
67 3300006881 Ga0068865_100001007 Ga0068865_1000010078 221
68 3300009094 Ga0111539_10189555 Ga0111539_101895552 221
69 3300009098 Ga0105245_10077377 Ga0105245_100773774 221
70 3300009148 Ga0105243_10023226 Ga0105243_100232263 221
71 3300009177 Ga0105248_10014374 Ga0105248_100143744 221
72 3300009551 Ga0105238_10204432 Ga0105238_102044323 221
73 3300009553 Ga0105249_10016947 Ga0105249_100169474 221
74 3300010375 Ga0105239_10246444 Ga0105239_102464443 221
75 3300013102 Ga0157371_10220231 Ga0157371_102202312 221
76 3300013307 Ga0157372_10047529 Ga0157372_100475293 221
77 3300014745 Ga0157377_10023451 Ga0157377_100234512 221
78 3300025901 Ga0207688_10008385 Ga0207688_100083853 221
79 3300025908 Ga0207643_10007206 Ga0207643_100072063 221
80 3300025918 Ga0207662_10064507 Ga0207662_100645073 221
81 3300025923 Ga0207681_10112624 Ga0207681_101126242 221
82 3300025924 Ga0207694_10098678 Ga0207694_100986783 221
83 3300025927 Ga0207687_10079422 Ga0207687_100794221 221
84 3300025932 Ga0207690_10048308 Ga0207690_100483082 221
85 3300025935 Ga0207709_10028352 Ga0207709_100283523 221
86 3300025937 Ga0207669_10003700 Ga0207669_100037003 221
87 3300025940 Ga0207691_10003397 Ga0207691_100033974 221
88 3300025941 Ga0207711_10262910 Ga0207711_102629102 221
89 3300025944 Ga0207661_10095263 Ga0207661_100952632 221
90 3300025961 Ga0207712_10021181 Ga0207712_100211814 221
91 3300025981 Ga0207640_10074685 Ga0207640_100746852 221
92 3300026041 Ga0207639_10131204 Ga0207639_101312042 221
93 3300026075 Ga0207708_10000180 Ga0207708_1000018010 221
94 3300026089 Ga0207648_10005348 Ga0207648_100053484 221
95 3300026118 Ga0207675_100006710 Ga0207675_1000067101 221
96 3300026121 Ga0207683_10348799 Ga0207683_103487992 221
97 3300026142 Ga0207698_10324524 Ga0207698_103245242 221
98 3300035691 Ga0373931_0255052 Ga0373931_0255052_52_831 221
99 3300048908 Ga0496105_0337433 Ga0496105_0337433_43_822 221
100 3300048909 Ga0496106_0552023 Ga0496106_0552023_42_821 221
101 3300048911 Ga0496108_0043561 Ga0496108_0043561_873_1652 221
102 3300048913 Ga0496110_0206664 Ga0496110_0206664_176_955 221
103 3300048916 Ga0496113_0647040 Ga0496113_0647040_16_795 221
104 3300048917 Ga0496114_0060827 Ga0496114_0060827_1447_2226 221
105 3300049583 Ga0501067_0025266 Ga0501067_0025266_2070_2849 221
106 3300049585 Ga0501069_0106741 Ga0501069_0106741_185_964 221
107 3300061734 Ga0530510_0046477 Ga0530510_0046477_2277_3056 221
108 3300035691 Ga0373931_0083300 Ga0373931_0083300_646_1524 222
109 3300042136 Ga0450900_007692 Ga0450900_007692_351_1130 222
110 3300005435 Ga0070714_100245433 Ga0070714_1002454332 223
111 3300025929 Ga0207664_10269582 Ga0207664_102695822 223
112 3300048914 Ga0496111_0624047 Ga0496111_0624047_19_762 224
113 3300044656 Ga0466969_0027675 Ga0466969_0027675_710_1489 227
114 3300044684 Ga0466966_0020375 Ga0466966_0020375_1384_2163 227
115 3300044694 Ga0466963_0045674 Ga0466963_0045674_614_1393 227
116 3300044765 Ga0466970_0134564 Ga0466970_0134564_478_1257 227
117 3300045049 Ga0466959_0062668 Ga0466959_0062668_1691_2470 227
118 3300045836 Ga0466958_0008909 Ga0466958_0008909_705_1484 227
119 3300048911 Ga0496108_0164254 Ga0496108_0164254_1126_1905 227
120 3300048914 Ga0496111_0180780 Ga0496111_0180780_458_1303 227
121 iso_pu_bacteria 2675903058 2676478464 231
122 iso_pu_bacteria 2827628540 2827629522 231
123 3300025904 Ga0207647_10138957 Ga0207647_101389572 232
124 3300030745 Ga0316182_1440866 Ga0316182_14408669 232
125 3300031901 Ga0307406_10040163 Ga0307406_100401634 232
126 3300045976 Ga0466967_0410422 Ga0466967_0410422_229_1092 232
127 3300049568 Ga0501031_0028500 Ga0501031_0028500_1279_2067 232
128 3300049569 Ga0501032_0018027 Ga0501032_0018027_1169_1957 232
129 3300049569 Ga0501032_0063608 Ga0501032_0063608_1007_1795 232
130 3300049569 Ga0501032_0123250 Ga0501032_0123250_360_1148 232
131 3300049570 Ga0501033_0026729 Ga0501033_0026729_862_1650 232
132 3300049571 Ga0501034_0048470 Ga0501034_0048470_3367_4155 232
133 3300049572 Ga0501036_0016896 Ga0501036_0016896_288_1076 232
134 3300049573 Ga0501037_0009658 Ga0501037_0009658_5247_6035 232
135 3300049574 Ga0501038_0006027 Ga0501038_0006027_7051_7839 232
136 3300049574 Ga0501038_0033639 Ga0501038_0033639_634_1422 232
137 3300049575 Ga0501039_0009483 Ga0501039_0009483_1401_2189 232
138 3300049578 Ga0501042_0019938 Ga0501042_0019938_1662_2450 232
139 3300049579 Ga0501043_0028595 Ga0501043_0028595_1236_2024 232
140 3300049579 Ga0501043_0074860 Ga0501043_0074860_820_1608 232
141 3300049580 Ga0501046_0001938 Ga0501046_0001938_13909_14697 232
142 3300049580 Ga0501046_0024257 Ga0501046_0024257_578_1366 232
143 3300049581 Ga0501047_0025976 Ga0501047_0025976_1714_2502 232
144 3300049581 Ga0501047_0420109 Ga0501047_0420109_252_1040 232
145 3300049582 Ga0501048_0012779 Ga0501048_0012779_4456_5244 232
146 3300049586 Ga0501070_0030630 Ga0501070_0030630_2556_3344 232
147 3300049589 Ga0501073_0091602 Ga0501073_0091602_168_956 232
148 3300049742 Ga0501080_0212831 Ga0501080_0212831_850_1638 232
149 3300049822 Ga0501035_0025992 Ga0501035_0025992_4458_5246 232
150 3300049822 Ga0501035_0047119 Ga0501035_0047119_1932_2720 232
151 3300049823 Ga0501044_0016208 Ga0501044_0016208_4530_5318 232
152 3300049823 Ga0501044_0462105 Ga0501044_0462105_129_917 232
153 iso_pu_bacteria 2515154155 2515853538 232
154 iso_pu_bacteria 2773857762 2774396886 232
155 iso_pu_bacteria 2811994878 2812352895 232
156 iso_pu_bacteria 2866552031 2866555140 232
157 iso_pu_bacteria 2891968417 2891969587 232
158 iso_pu_bacteria 8056207758 8056211862 232
159 3300028794 Ga0307515_10398800 Ga0307515_103988002 233
160 3300045976 Ga0466967_0066800 Ga0466967_0066800_1658_2437 233
161 3300005336 Ga0070680_100092772 Ga0070680_1000927723 234
162 3300005338 Ga0068868_100236811 Ga0068868_1002368112 234
163 3300005366 Ga0070659_100014601 Ga0070659_1000146013 234
164 3300005435 Ga0070714_100070621 Ga0070714_1000706213 234
165 3300005455 Ga0070663_100151044 Ga0070663_1001510442 234
166 3300005458 Ga0070681_10061384 Ga0070681_100613842 234
167 3300005840 Ga0068870_10250317 Ga0068870_102503171 234
168 3300005937 Ga0081455_10000018 Ga0081455_10000018112 234
169 3300006028 Ga0070717_10097125 Ga0070717_100971252 234
170 3300006038 Ga0075365_10171074 Ga0075365_101710742 234
171 3300006042 Ga0075368_10004514 Ga0075368_100045142 234
172 3300006048 Ga0075363_100010506 Ga0075363_1000105065 234
173 3300006178 Ga0075367_10072372 Ga0075367_100723723 234
174 3300006846 Ga0075430_100000172 Ga0075430_10000017225 234
175 3300006846 Ga0075430_100011555 Ga0075430_1000115554 234
176 3300006847 Ga0075431_100048735 Ga0075431_1000487355 234
177 3300006847 Ga0075431_100283322 Ga0075431_1002833222 234
178 3300006852 Ga0075433_10390604 Ga0075433_103906041 234
179 3300006880 Ga0075429_100020736 Ga0075429_1000207367 234
180 3300006880 Ga0075429_100038767 Ga0075429_1000387672 234
181 3300009098 Ga0105245_10044697 Ga0105245_100446973 234
182 3300009147 Ga0114129_10001688 Ga0114129_1000168814 234
183 3300009147 Ga0114129_10052886 Ga0114129_100528863 234
184 3300009147 Ga0114129_10223237 Ga0114129_102232372 234
185 3300009176 Ga0105242_10416479 Ga0105242_104164792 234
186 3300009553 Ga0105249_10178046 Ga0105249_101780463 234
187 3300013102 Ga0157371_10007167 Ga0157371_100071671 234
188 3300013105 Ga0157369_10005679 Ga0157369_100056795 234
189 3300013306 Ga0163162_10526132 Ga0163162_105261322 234
190 3300013308 Ga0157375_10067162 Ga0157375_100671622 234
191 3300014326 Ga0157380_10045220 Ga0157380_100452204 234
192 3300017792 Ga0163161_10310242 Ga0163161_103102422 234
193 3300021388 Ga0213875_10000097 Ga0213875_1000009716 234
194 3300022467 Ga0224712_10113681 Ga0224712_101136812 234
195 3300025901 Ga0207688_10222301 Ga0207688_102223011 234
196 3300025909 Ga0207705_10004774 Ga0207705_100047747 234
197 3300025912 Ga0207707_10386463 Ga0207707_103864632 234
198 3300025917 Ga0207660_10129494 Ga0207660_101294942 234
199 3300025919 Ga0207657_10128467 Ga0207657_101284672 234
200 3300025919 Ga0207657_10180823 Ga0207657_101808232 234
201 3300025921 Ga0207652_10019949 Ga0207652_100199495 234
202 3300025927 Ga0207687_10095217 Ga0207687_100952173 234
203 3300025929 Ga0207664_10125923 Ga0207664_101259232 234
204 3300025932 Ga0207690_10000222 Ga0207690_1000022236 234
205 3300025932 Ga0207690_10026297 Ga0207690_100262972 234
206 3300025942 Ga0207689_10152740 Ga0207689_101527402 234
207 3300025944 Ga0207661_10535502 Ga0207661_105355021 234
208 3300025949 Ga0207667_10289485 Ga0207667_102894852 234
209 3300026067 Ga0207678_10242171 Ga0207678_102421712 234
210 3300028794 Ga0307515_10040352 Ga0307515_100403522 234
211 3300031901 Ga0307406_10052351 Ga0307406_100523512 234
212 3300031903 Ga0307407_10177107 Ga0307407_101771072 234
213 3300031995 Ga0307409_100031403 Ga0307409_1000314034 234
214 3300031995 Ga0307409_100271503 Ga0307409_1002715032 234
215 3300031995 Ga0307409_100709961 Ga0307409_1007099611 234
216 3300032126 Ga0307415_100493061 Ga0307415_1004930611 234
217 3300032126 Ga0307415_100558199 Ga0307415_1005581991 234
218 3300033179 Ga0307507_10071798 Ga0307507_100717982 234
219 3300033179 Ga0307507_10092110 Ga0307507_100921102 234
220 3300037466 Ga0395898_0155351 Ga0395898_0155351_562_1341 234
221 3300037471 Ga0395905_0064826 Ga0395905_0064826_1872_2651 234
222 3300037853 Ga0436364_0296067 Ga0436364_0296067_49107_49898 234
223 3300037853 Ga0436364_1246252 Ga0436364_1246252_1714_2493 234
224 3300039437 Ga0436365_0218752 Ga0436365_0218752_1507_2298 234
225 3300042016 Ga0439463_071463 Ga0439463_071463_50_829 234
226 3300042439 Ga0439464_0081326 Ga0439464_0081326_66_845 234
227 3300044683 Ga0466965_0129042 Ga0466965_0129042_163_954 234
228 3300044684 Ga0466966_0034700 Ga0466966_0034700_513_1292 234
229 3300044693 Ga0466961_0361108 Ga0466961_0361108_18_797 234
230 3300044719 Ga0466971_0138545 Ga0466971_0138545_211_990 234
231 3300045049 Ga0466959_0004629 Ga0466959_0004629_6737_7516 234
232 3300045836 Ga0466958_0042354 Ga0466958_0042354_679_1458 234
233 3300045836 Ga0466958_0071462 Ga0466958_0071462_10_789 234
234 3300045976 Ga0466967_0032405 Ga0466967_0032405_2034_2813 234
235 3300045976 Ga0466967_0041283 Ga0466967_0041283_1228_2007 234
236 3300045976 Ga0466967_0067507 Ga0466967_0067507_2000_2779 234
237 3300045976 Ga0466967_0299194 Ga0466967_0299194_284_1075 234
238 3300045976 Ga0466967_0491383 Ga0466967_0491383_20_802 234
239 3300048907 Ga0496104_0071003 Ga0496104_0071003_443_1222 234
240 3300048912 Ga0496109_0416073 Ga0496109_0416073_56_916 234
241 3300048913 Ga0496110_0010868 Ga0496110_0010868_2003_2782 234
242 3300048913 Ga0496110_0192211 Ga0496110_0192211_896_1756 234
243 3300048914 Ga0496111_0026028 Ga0496111_0026028_1148_1927 234
244 3300048917 Ga0496114_0029242 Ga0496114_0029242_3319_4098 234
245 3300049568 Ga0501031_0407676 Ga0501031_0407676_37_816 234
246 3300049581 Ga0501047_0087083 Ga0501047_0087083_1195_1998 234
247 3300049742 Ga0501080_0129594 Ga0501080_0129594_357_1160 234
248 3300049743 Ga0501081_0267415 Ga0501081_0267415_283_1113 234
249 3300050491 nmdc:mga00v17_5542_c1 nmdc:mga00v17_5542_c1_2176_2967 234
250 3300050492 nmdc:mga0yw44_266772_c1 nmdc:mga0yw44_266772_c1_37_825 234
251 3300050496 nmdc:mga07m45_59187_c1 nmdc:mga07m45_59187_c1_800_1591 234
252 3300050507 nmdc:mga05p37_171358_c1 nmdc:mga05p37_171358_c1_141_914 234
253 3300050507 nmdc:mga05p37_8792_c1 nmdc:mga05p37_8792_c1_9873_10646 234
254 3300050508 nmdc:mga09592_13817_c1 nmdc:mga09592_13817_c1_2899_3672 234
255 3300050508 nmdc:mga09592_438254_c1 nmdc:mga09592_438254_c1_146_919 234
256 3300050509 nmdc:mga0qj67_26355_c1 nmdc:mga0qj67_26355_c1_3346_4119 234
257 3300050509 nmdc:mga0qj67_263_c2 nmdc:mga0qj67_263_c2_7138_7911 234
258 3300050510 nmdc:mga06r32_68289_c1 nmdc:mga06r32_68289_c1_900_1673 234
259 3300050511 nmdc:mga08y16_559607_c1 nmdc:mga08y16_559607_c1_73_852 234
260 3300053092 Ga0500583_0043745 Ga0500583_0043745_118_891 234
261 3300053099 Ga0500654_046347 Ga0500654_046347_1553_2326 234
262 3300053118 Ga0500594_0056440 Ga0500594_0056440_333_1106 234
263 3300053139 Ga0500568_0003911 Ga0500568_0003911_328_1107 234
264 3300053146 Ga0500588_0011735 Ga0500588_0011735_529_1302 234
265 3300061719 Ga0466962_0007260 Ga0466962_0007260_432_1211 234
266 iso_pu_bacteria 2808606439 2809198525 234
267 3300005329 Ga0070683_100367312 Ga0070683_1003673122 235
268 3300005336 Ga0070680_100173565 Ga0070680_1001735653 235
269 3300005344 Ga0070661_100048024 Ga0070661_1000480243 235
270 3300005458 Ga0070681_10100373 Ga0070681_101003732 235
271 3300005530 Ga0070679_100465652 Ga0070679_1004656521 235
272 3300005535 Ga0070684_100021214 Ga0070684_1000212145 235
273 3300005535 Ga0070684_100086671 Ga0070684_1000866712 235
274 3300005548 Ga0070665_100231440 Ga0070665_1002314401 235
275 3300005564 Ga0070664_100015036 Ga0070664_1000150362 235
276 3300005577 Ga0068857_100244141 Ga0068857_1002441412 235
277 3300005614 Ga0068856_100407091 Ga0068856_1004070912 235
278 3300005618 Ga0068864_100183366 Ga0068864_1001833663 235
279 3300005618 Ga0068864_100276962 Ga0068864_1002769622 235
280 3300005841 Ga0068863_100023016 Ga0068863_1000230165 235
281 3300009177 Ga0105248_10092568 Ga0105248_100925683 235
282 3300013105 Ga0157369_10002337 Ga0157369_1000233711 235
283 3300014325 Ga0163163_10035229 Ga0163163_100352296 235
284 3300014325 Ga0163163_10502645 Ga0163163_105026452 235
285 3300020082 Ga0206353_12064211 Ga0206353_120642111 235
286 3300025909 Ga0207705_10033518 Ga0207705_100335184 235
287 3300025912 Ga0207707_10129264 Ga0207707_101292643 235
288 3300025920 Ga0207649_10116944 Ga0207649_101169442 235
289 3300025921 Ga0207652_10116078 Ga0207652_101160784 235
290 3300025932 Ga0207690_10034927 Ga0207690_100349272 235
291 3300025944 Ga0207661_10032212 Ga0207661_100322124 235
292 3300026088 Ga0207641_10026907 Ga0207641_100269072 235
293 3300026095 Ga0207676_10114459 Ga0207676_101144592 235
294 3300026116 Ga0207674_10016918 Ga0207674_100169186 235
295 3300046459 Ga0495629_0330564 Ga0495629_0330564_12_812 235
296 3300048908 Ga0496105_0213585 Ga0496105_0213585_364_1140 235
297 3300048913 Ga0496110_0332151 Ga0496110_0332151_410_1270 235
298 3300048915 Ga0496112_0007675 Ga0496112_0007675_4409_5185 235
299 3300048915 Ga0496112_0023624 Ga0496112_0023624_2538_3398 235
300 3300048915 Ga0496112_0048557 Ga0496112_0048557_1332_2108 235
301 3300048916 Ga0496113_0338981 Ga0496113_0338981_322_1182 235
302 3300049574 Ga0501038_0190645 Ga0501038_0190645_29_805 235
303 3300049581 Ga0501047_0009441 Ga0501047_0009441_2731_3501 235
304 3300061734 Ga0530510_0065600 Ga0530510_0065600_317_1132 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

48

299

0.96

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

53

250

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lao-assembly1.cif.gz_C crystal structure of enoyl-coa hydratase from pseudomonas aeruginosa pa01 0.9313 71 192
3lao-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from pseudomonas aeruginosa pa01 0.9126 71 192
4q1i-assembly1.cif.gz_A structure and mechanism of a dehydratase/decarboxylase enzyme couple involved in polyketide beta-branching 0.9061 64 193
4di1-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa17 from mycobacterium marinum 0.8963 2 214
5z7r-assembly1.cif.gz_A crystal structure of crotonase from clostridium acetobutylicum 0.8961 1 229
ID Description Score Start End Superfamily
af_P30084_233_289_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9809 182 232 1.10.12.10
2hw5B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9787 182 232 1.10.12.10
1mj3E02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9787 182 232 1.10.12.10
1mj3C02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9785 182 232 1.10.12.10
2hw5F02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9778 182 232 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A6B3IPN9-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9687 50 178 GO:0006635
GO:0016836
GO:0016853
AF-A0A7W1E3B8-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9678 63 235 GO:0006635
GO:0016836
GO:0016853
AF-T0YY04-F1-model_v4 Enoyl-CoA hydratase/isomerase 0.9635 45 235 GO:0006635
GO:0016836
GO:0016853
AF-A0A6B3IPN9-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9614 50 178 GO:0006635
GO:0016836
GO:0016853
AF-A0A067D9Z2-F1-model_v4 Enoyl-CoA hydratase 0.9611 38 173 GO:0016836

Feature Viewer

pLDDT pTM Quality
88 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map