F397606

General Info

Members Datasets Scaffolds Average Seq Length
304 202 298 540

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10000712|Ga0207647_1000071220
Length 600
Sequence MCRNGREPLQPAIGYYIDGSYRKIGLGSQTRHDERRLRRLLICFNVSGRRAVESVGRHREDRLTTLPSRDRSYDVPGTKLDFDAVVIGAGVCGLYQLYRLRQLGLRVRAFDDASGVGGTWFWNRYPGARFDSEPEILKDWDXXENFAGQPEIERYLNFVADKLDLRRDIRFDSHVQSAHYQEDTRSWRVTLDDGQSFTARFLVTAIGVLSAPTLPRIEGIERFKGEAHHPARWPDAPISFEGKRVAVIGTGSTGVQIIQEAAKTAAQLTVYQRTPNWCAPLHNSKISIEEMEAIRARYPEIMARCQETPGCFIHGPDPRSVFDVTAEEREAFFEKRYSEPGFGIWHGNFRDVLTDKDANAFMSDFMARKIRERVKDPVTAEKLIPKNHGFGTRRVPLETRYYEVYNQPNVTLIDVNETPIERITPKGIKSSDGERPFDIIVYASGFDAIAGPFDRIDFRGIGGQRLKDVWSNGPQTFLGVLVTGFPNLMMVMGPHGGLGNFTRFAEYNADWVTDLIAYARQRGSTRIEATPAGTMRWTDHVMEMSKILLSNQIDSWMTGVNKNVEGKSVRKVMRYGGGFPQYKEQCDAVAAATYNELSFS

Samples

Sample ID Description Type Environment
1 2643221615 Nocardioides sp. Root224 Isolate Unclassified
2 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
3 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
4 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
5 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
198 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 0.33
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 1.32
Rhizosphere 93.42
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10001128 3300001990 Bacteria 9398
2 JGI25406J46586_10001454 3300003203 Bacteria 11164
3 JGI25406J46586_10001745 3300003203 Bacteria 10228
4 Ga0070676_10001297 3300005328 Bacteria 12573
5 Ga0070676_10005502 3300005328 Bacteria 6745
6 Ga0070670_100003444 3300005331 Bacteria 13132
7 Ga0068869_100003296 3300005334 Bacteria 9861
8 Ga0068869_100084190 3300005334 Bacteria 2380
9 Ga0070680_100008254 3300005336 Bacteria 7965
10 Ga0070682_100000343 3300005337 Bacteria 32035
11 Ga0070660_100000092 3300005339 Bacteria 54311
12 Ga0070689_100109940 3300005340 Bacteria 2191
13 Ga0070661_100001263 3300005344 Bacteria 17772
14 Ga0070692_10003454 3300005345 Bacteria 6407
15 Ga0070692_10042937 3300005345 Bacteria 2324
16 Ga0070671_100111618 3300005355 Bacteria 2296
17 Ga0070659_100001617 3300005366 Bacteria 16235
18 Ga0070709_10016813 3300005434 Bacteria 4185
19 Ga0070714_100005196 3300005435 Bacteria 9904
20 Ga0070714_100090241 3300005435 Bacteria 2684
21 Ga0070713_100013166 3300005436 Bacteria 6097
22 Ga0070713_100072111 3300005436 Bacteria 2920
23 Ga0070713_100088313 3300005436 Bacteria 2660
24 Ga0070710_10001645 3300005437 Bacteria 10558
25 Ga0070710_10002009 3300005437 Bacteria 9626
26 Ga0070711_100012187 3300005439 Bacteria 5367
27 Ga0070705_100000097 3300005440 Bacteria 49136
28 Ga0070694_100000924 3300005444 Bacteria 16595
29 Ga0070678_100014771 3300005456 Bacteria 4939
30 Ga0070662_100112870 3300005457 Bacteria 2073
31 Ga0070681_10004953 3300005458 Bacteria 12806
32 Ga0070707_100071095 3300005468 Bacteria 3352
33 Ga0070698_100140567 3300005471 Bacteria 2366
34 Ga0070698_100177218 3300005471 Bacteria 2071
35 Ga0070679_100001488 3300005530 Bacteria 20798
36 Ga0070684_100008034 3300005535 Bacteria 8237
37 Ga0068853_100001921 3300005539 Bacteria 15321
38 Ga0070695_100000513 3300005545 Bacteria 20335
39 Ga0070695_100006802 3300005545 Bacteria 6769
40 Ga0070696_100000765 3300005546 Bacteria 20608
41 Ga0070693_100001256 3300005547 Bacteria 11477
42 Ga0070693_100040433 3300005547 Bacteria 2618
43 Ga0070704_100001309 3300005549 Bacteria 13167
44 Ga0070704_100116597 3300005549 Bacteria 2042
45 Ga0068855_100001162 3300005563 Bacteria 32633
46 Ga0070664_100002879 3300005564 Bacteria 13942
47 Ga0068857_100011504 3300005577 Bacteria 7699
48 Ga0068854_100001418 3300005578 Bacteria 14479
49 Ga0068856_100000860 3300005614 Bacteria 32585
50 Ga0068856_100034518 3300005614 Bacteria 4954
51 Ga0070702_100050287 3300005615 Bacteria 2380
52 Ga0068859_100004735 3300005617 Bacteria 13821
53 Ga0068861_100008590 3300005719 Bacteria 7027
54 Ga0068861_100071009 3300005719 Bacteria 2698
55 Ga0068870_10000394 3300005840 Bacteria 16447
56 Ga0068858_100055954 3300005842 Bacteria 3646
57 Ga0068860_100022396 3300005843 Bacteria 6112
58 Ga0068860_100075372 3300005843 Bacteria 3209
59 Ga0068862_100020781 3300005844 Bacteria 5484
60 Ga0068862_100027537 3300005844 Bacteria 4784
61 Ga0068862_100103706 3300005844 Bacteria 2491
62 Ga0081455_10004309 3300005937 Bacteria 16020
63 Ga0081538_10016428 3300005981 Bacteria 5676
64 Ga0081538_10016494 3300005981 Bacteria 5659
65 Ga0081540_1001368 3300005983 Bacteria 21161
66 Ga0081540_1010642 3300005983 Bacteria 6206
67 Ga0081539_10000115 3300005985 Bacteria 188623
68 Ga0081539_10001086 3300005985 Bacteria 49435
69 Ga0081539_10001753 3300005985 Bacteria 34603
70 Ga0081539_10006498 3300005985 Bacteria 11179
71 Ga0070717_10003766 3300006028 Bacteria 10893
72 Ga0070717_10191935 3300006028 Bacteria 1785
73 Ga0070716_100005084 3300006173 Bacteria 6348
74 Ga0070712_100004596 3300006175 Bacteria 8524
75 Ga0070712_100072970 3300006175 Bacteria 2460
76 Ga0075428_100000280 3300006844 Bacteria 50009
77 Ga0075428_100019351 3300006844 Bacteria 7535
78 Ga0075428_100036944 3300006844 Bacteria 5379
79 Ga0075428_100081987 3300006844 Bacteria 3519
80 Ga0075430_100005496 3300006846 Bacteria 10709
81 Ga0075430_100012470 3300006846 Bacteria 7233
82 Ga0075430_100064658 3300006846 Bacteria 3073
83 Ga0075431_100003356 3300006847 Bacteria 15519
84 Ga0075431_100016923 3300006847 Bacteria 7404
85 Ga0075431_100167340 3300006847 Bacteria 2259
86 Ga0075431_100190177 3300006847 Bacteria 2103
87 Ga0075433_10044575 3300006852 Bacteria 3854
88 Ga0075433_10077182 3300006852 Bacteria 2934
89 Ga0075433_10212313 3300006852 Bacteria 1720
90 Ga0075434_100024024 3300006871 Bacteria 5953
91 Ga0075434_100026718 3300006871 Bacteria 5659
92 Ga0075429_100021238 3300006880 Bacteria 5628
93 Ga0075429_100048473 3300006880 Bacteria 3694
94 Ga0075429_100135697 3300006880 Bacteria 2153
95 Ga0075436_100016162 3300006914 Bacteria 5110
96 Ga0097620_100004736 3300006931 Bacteria 13821
97 Ga0099795_10000188 3300007788 Bacteria 10401
98 Ga0105240_10007117 3300009093 Bacteria 16296
99 Ga0105240_10007442 3300009093 Bacteria 15899
100 Ga0111539_10003699 3300009094 Bacteria 20108
101 Ga0111539_10015391 3300009094 Bacteria 9519
102 Ga0111539_10023514 3300009094 Bacteria 7572
103 Ga0111539_10062048 3300009094 Bacteria 4426
104 Ga0111539_10110207 3300009094 Bacteria 3230
105 Ga0114129_10002995 3300009147 Bacteria 23658
106 Ga0114129_10160208 3300009147 Bacteria 3075
107 Ga0105241_10003287 3300009174 Bacteria 12027
108 Ga0105248_10058745 3300009177 Bacteria 4319
109 Ga0105248_10276290 3300009177 Bacteria 1891
110 Ga0105238_10001598 3300009551 Bacteria 22700
111 Ga0105238_10003529 3300009551 Bacteria 15588
112 Ga0105249_10015747 3300009553 Bacteria 6697
113 Ga0099796_10000365 3300010159 Bacteria 7371
114 Ga0099796_10018952 3300010159 Bacteria 2077
115 Ga0105239_10004729 3300010375 Bacteria 16165
116 Ga0105239_10335483 3300010375 Bacteria 1706
117 Ga0157373_10000370 3300013100 Bacteria 36005
118 Ga0157371_10067421 3300013102 Bacteria 2533
119 Ga0157372_10002599 3300013307 Bacteria 19547
120 Ga0182008_10030656 3300014497 Bacteria 2710
121 Ga0157377_10025085 3300014745 Bacteria 3177
122 Ga0213875_10001557 3300021388 Bacteria 14689
123 Ga0247553_100090 3300023672 Bacteria 2423
124 Ga0207653_10021020 3300025885 Bacteria 2069
125 Ga0207692_10012664 3300025898 Bacteria 3630
126 Ga0207647_10000712 3300025904 Bacteria 26107
127 Ga0207699_10071262 3300025906 Bacteria 2125
128 Ga0207645_10001568 3300025907 Bacteria 18651
129 Ga0207645_10020875 3300025907 Bacteria 4279
130 Ga0207654_10002909 3300025911 Bacteria 8679
131 Ga0207707_10000234 3300025912 Bacteria 59924
132 Ga0207695_10001998 3300025913 Bacteria 31500
133 Ga0207695_10026222 3300025913 Bacteria 6506
134 Ga0207693_10006216 3300025915 Bacteria 9907
135 Ga0207693_10009563 3300025915 Bacteria 7896
136 Ga0207663_10011835 3300025916 Bacteria 4697
137 Ga0207663_10018838 3300025916 Bacteria 3877
138 Ga0207657_10000419 3300025919 Bacteria 45112
139 Ga0207649_10002254 3300025920 Bacteria 10884
140 Ga0207652_10000306 3300025921 Bacteria 50379
141 Ga0207681_10019538 3300025923 Bacteria 4282
142 Ga0207694_10000157 3300025924 Bacteria 70076
143 Ga0207700_10012220 3300025928 Bacteria 5525
144 Ga0207700_10172287 3300025928 Bacteria 1806
145 Ga0207664_10154041 3300025929 Bacteria 1955
146 Ga0207690_10000501 3300025932 Bacteria 25361
147 Ga0207706_10007170 3300025933 Bacteria 10311
148 Ga0207706_10010100 3300025933 Bacteria 8646
149 Ga0207665_10007834 3300025939 Bacteria 7052
150 Ga0207691_10081848 3300025940 Bacteria 2901
151 Ga0207711_10093442 3300025941 Bacteria 2649
152 Ga0207689_10000138 3300025942 Bacteria 62632
153 Ga0207689_10173636 3300025942 Bacteria 1777
154 Ga0207679_10000570 3300025945 Bacteria 24782
155 Ga0207667_10005122 3300025949 Bacteria 16007
156 Ga0207667_10012877 3300025949 Bacteria 9609
157 Ga0207667_10030838 3300025949 Bacteria 5794
158 Ga0207712_10021720 3300025961 Bacteria 4217
159 Ga0207712_10029217 3300025961 Bacteria 3695
160 Ga0207712_10070823 3300025961 Bacteria 2506
161 Ga0207668_10118277 3300025972 Bacteria 2002
162 Ga0207668_10127231 3300025972 Bacteria 1940
163 Ga0207640_10001802 3300025981 Bacteria 11497
164 Ga0207658_10119085 3300025986 Bacteria 2102
165 Ga0207677_10099243 3300026023 Bacteria 2138
166 Ga0207703_10157787 3300026035 Bacteria 1985
167 Ga0207639_10001579 3300026041 Bacteria 15291
168 Ga0207702_10000002 3300026078 Bacteria 491507
169 Ga0207702_10001221 3300026078 Bacteria 26047
170 Ga0207702_10150255 3300026078 Unclassified 2118
171 Ga0207648_10192104 3300026089 Bacteria 1810
172 Ga0207676_10018348 3300026095 Bacteria 5085
173 Ga0207674_10000315 3300026116 Bacteria 61743
174 Ga0207675_100015919 3300026118 Bacteria 7014
175 Ga0207675_100106881 3300026118 Bacteria 2638
176 Ga0207683_10045989 3300026121 Bacteria 3818
177 Ga0207698_10017060 3300026142 Bacteria 4916
178 Ga0209971_1007964 3300027682 Bacteria 2515
179 Ga0207428_10008668 3300027907 Bacteria 9183
180 Ga0268265_10001613 3300028380 Bacteria 18609
181 Ga0268264_10017569 3300028381 Bacteria 5857
182 Ga0265340_10032666 3300031247 Bacteria 2597
183 Ga0307408_100003757 3300031548 Bacteria 10334
184 Ga0316576_10058535 3300031727 Bacteria 2819
185 Ga0307409_100021911 3300031995 Bacteria 4393
186 Ga0307416_100010360 3300032002 Bacteria 6153
187 Ga0373952_0009808 3300035092 Bacteria 1841
188 Ga0373953_0004441 3300035117 Bacteria 4472
189 Ga0373933_0005179 3300035724 Bacteria 7118
190 Ga0373933_0012135 3300035724 Bacteria 4758
191 Ga0373933_0047169 3300035724 Bacteria 2561
192 Ga0373937_0003534 3300036401 Bacteria 13156
193 Ga0373937_0013648 3300036401 Bacteria 7158
194 Ga0373937_0049709 3300036401 Bacteria 3839
195 Ga0373937_0126410 3300036401 Bacteria 2385
196 Ga0316584_0009648 3300036712 Bacteria 6713
197 Ga0373925_0000894 3300037068 Bacteria 27236
198 Ga0373925_0011096 3300037068 Bacteria 6540
199 Ga0436364_0078005 3300037853 Bacteria 20431
200 Ga0436364_0347143 3300037853 Bacteria 2846
201 Ga0436364_0524879 3300037853 Bacteria 2040
202 Ga0436364_1245271 3300037853 Bacteria 49699
203 Ga0436360_0087002 3300039438 Bacteria 1530
204 Ga0436360_1355627 3300039438 Bacteria 7003
205 Ga0436363_1562559 3300039450 Bacteria 2046
206 Ga0436362_0491404 3300039453 Bacteria 2912
207 Ga0439448_0007839 3300042005 Bacteria 3105
208 Ga0450889_000946 3300042144 Bacteria 3084
209 Ga0439458_0002654 3300042157 Bacteria 4314
210 Ga0451577_0004522 3300042876 Bacteria 14641
211 Ga0451577_0005255 3300042876 Bacteria 13309
212 Ga0453683_0009606 3300044673 Bacteria 6451
213 Ga0453684_0008673 3300044712 Bacteria 18089
214 Ga0453684_0093315 3300044712 Bacteria 3708
215 Ga0451576_0007348 3300045051 Bacteria 13206
216 Ga0451576_0047432 3300045051 Bacteria 4517
217 Ga0451576_0161213 3300045051 Bacteria 2341
218 Ga0495603_0019161 3300046455 Bacteria 4143
219 Ga0495651_0016445 3300046462 Bacteria 5730
220 Ga0495651_0078160 3300046462 Bacteria 2503
221 Ga0495664_0017320 3300046477 Bacteria 4117
222 Ga0495608_0009481 3300046511 Bacteria 6801
223 Ga0495618_0051214 3300046514 Bacteria 2609
224 Ga0495586_0018603 3300046535 Bacteria 3699
225 Ga0495587_0003769 3300046536 Bacteria 10057
226 Ga0495645_0009645 3300046543 Bacteria 6751
227 Ga0495645_0096633 3300046543 Bacteria 2105
228 Ga0495667_0055808 3300046559 Bacteria 2598
229 Ga0495635_0058438 3300046663 Bacteria 2653
230 Ga0495613_0001955 3300046689 Bacteria 15642
231 Ga0495600_0018357 3300046809 Bacteria 4457
232 Ga0495674_0025756 3300047319 Bacteria 5387
233 Ga0495674_0053408 3300047319 Bacteria 3552
234 Ga0495680_0017320 3300047322 Bacteria 6157
235 Ga0495680_0033919 3300047322 Bacteria 4129
236 Ga0495680_0065069 3300047322 Bacteria 2794
237 Ga0495684_0053576 3300047471 Bacteria 3078
238 Ga0495602_0001301 3300048088 Bacteria 24610
239 Ga0495602_0090333 3300048088 Bacteria 2544
240 Ga0496106_0140844 3300048909 Bacteria 1897
241 Ga0496108_0129009 3300048911 Bacteria 2173
242 Ga0496112_0129763 3300048915 Bacteria 2492
243 Ga0496115_0144835 3300048918 Bacteria 1960
244 Ga0496120_0024665 3300048923 Bacteria 3745
245 Ga0501039_0016754 3300049575 Bacteria 5616
246 Ga0501040_0003245 3300049576 Bacteria 10513
247 Ga0501041_0001618 3300049577 Bacteria 12566
248 Ga0501042_0000025 3300049578 Bacteria 48562
249 Ga0501046_0000526 3300049580 Bacteria 37973
250 Ga0501047_0189031 3300049581 Bacteria 1924
251 Ga0501048_0040674 3300049582 Bacteria 3330
252 Ga0501071_0098681 3300049587 Bacteria 2152
253 Ga0501072_0011861 3300049588 Bacteria 6658
254 Ga0501074_0001414 3300049590 Bacteria 15973
255 Ga0501074_0040765 3300049590 Bacteria 3362
256 Ga0501075_0020096 3300049591 Bacteria 4851
257 Ga0501076_0001997 3300049592 Bacteria 13950
258 Ga0501077_0014086 3300049593 Bacteria 5016
259 Ga0501077_0028587 3300049593 Bacteria 3544
260 Ga0501079_0004979 3300049741 Bacteria 9848
261 Ga0501079_0012128 3300049741 Bacteria 6580
262 Ga0501081_0008819 3300049743 Bacteria 6554
263 Ga0501035_0114974 3300049822 Bacteria 2356
264 Ga0501045_0000034 3300049824 Bacteria 58823
265 nmdc:mga03683_14326_c1 3300050489 Bacteria 2932
266 nmdc:mga06z11_6489_c1 3300050494 Bacteria 2708
267 nmdc:mga05p37_362757_c1 3300050507 Bacteria 1703
268 nmdc:mga05p37_4900_c1 3300050507 Bacteria 15675
269 nmdc:mga05p37_50224_c1 3300050507 Bacteria 5129
270 nmdc:mga09592_28268_c1 3300050508 Bacteria 4658
271 nmdc:mga09592_40849_c1 3300050508 Bacteria 3898
272 nmdc:mga0qj67_3817_c1 3300050509 Bacteria 10886
273 nmdc:mga0qj67_871_c1 3300050509 Bacteria 20675
274 nmdc:mga06r32_18132_c1 3300050510 Bacteria 6439
275 nmdc:mga06r32_4812_c1 3300050510 Bacteria 12154
276 nmdc:mga06r32_4966_c1 3300050510 Bacteria 11989
277 nmdc:mga08y16_17240_c1 3300050511 Bacteria 7603
278 nmdc:mga08y16_4217_c1 3300050511 Bacteria 14996
279 nmdc:mga08y16_51268_c1 3300050511 Bacteria 4317
280 nmdc:mga08y16_99402_c1 3300050511 Bacteria 3029
281 nmdc:mga0n895_33808_c1 3300050512 Bacteria 4915
282 nmdc:mga0n895_87672_c1 3300050512 Bacteria 3110
283 nmdc:mga0a205_28551_c1 3300050515 Bacteria 4192
284 nmdc:mga0a205_38502_c1 3300050515 Bacteria 4601
285 Ga0495595_0009199 3300053084 Bacteria 4080
286 Ga0495595_0037345 3300053084 Bacteria 2208
287 Ga0495619_0008260 3300053085 Bacteria 6586
288 Ga0495619_0032895 3300053085 Bacteria 3366
289 Ga0495619_0034557 3300053085 Bacteria 3287
290 Ga0495619_0046629 3300053085 Bacteria 2850
291 Ga0500595_001424 3300053119 Bacteria 12843
292 Ga0500638_002564 3300053162 Bacteria 6391
293 Ga0500637_0000020 3300053178 Bacteria 63918
294 Ga0501084_0028072 3300054114 Bacteria 4703
295 Ga0501082_0004032 3300060353 Bacteria 12819
296 Ga0501082_0054233 3300060353 Bacteria 3456
297 Ga0530510_0021952 3300061734 Bacteria 4544
298 Ga0530510_0028006 3300061734 Bacteria 4040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0078160 Ga0495651_0078160_1089_2492 441
2 3300050507 nmdc:mga05p37_362757_c1 nmdc:mga05p37_362757_c1_26_1423 457
3 3300046559 Ga0495667_0055808 Ga0495667_0055808_598_1986 461
4 3300053085 Ga0495619_0032895 Ga0495619_0032895_1221_2702 481
5 3300037853 Ga0436364_0524879 Ga0436364_0524879_40_1530 487
6 3300005844 Ga0068862_100103706 Ga0068862_1001037061 490
7 3300039438 Ga0436360_0087002 Ga0436360_0087002_11_1516 492
8 3300027682 Ga0209971_1007964 Ga0209971_10079642 496
9 3300003203 JGI25406J46586_10001454 JGI25406J46586_100014545 519
10 3300005985 Ga0081539_10000115 Ga0081539_1000011583 519
11 3300005471 Ga0070698_100140567 Ga0070698_1001405672 521
12 3300006028 Ga0070717_10191935 Ga0070717_101919351 521
13 3300006844 Ga0075428_100036944 Ga0075428_1000369443 521
14 3300006852 Ga0075433_10044575 Ga0075433_100445752 521
15 3300006871 Ga0075434_100024024 Ga0075434_1000240243 521
16 3300009094 Ga0111539_10003699 Ga0111539_1000369911 521
17 3300013102 Ga0157371_10067421 Ga0157371_100674212 521
18 3300042876 Ga0451577_0004522 Ga0451577_0004522_8676_10268 521
19 3300044673 Ga0453683_0009606 Ga0453683_0009606_1405_2997 521
20 3300044712 Ga0453684_0008673 Ga0453684_0008673_5897_7489 521
21 3300045051 Ga0451576_0047432 Ga0451576_0047432_744_2336 521
22 3300046535 Ga0495586_0018603 Ga0495586_0018603_247_1845 521
23 3300046689 Ga0495613_0001955 Ga0495613_0001955_332_1930 521
24 3300048909 Ga0496106_0140844 Ga0496106_0140844_39_1631 521
25 3300050512 nmdc:mga0n895_33808_c1 nmdc:mga0n895_33808_c1_152_1744 521
26 3300050515 nmdc:mga0a205_28551_c1 nmdc:mga0a205_28551_c1_822_2414 521
27 3300005435 Ga0070714_100090241 Ga0070714_1000902412 522
28 3300005985 Ga0081539_10001753 Ga0081539_1000175321 522
29 3300005985 Ga0081539_10006498 Ga0081539_100064983 522
30 3300039438 Ga0436360_1355627 Ga0436360_1355627_719_2314 522
31 3300049590 Ga0501074_0040765 Ga0501074_0040765_294_1889 522
32 3300050489 nmdc:mga03683_14326_c1 nmdc:mga03683_14326_c1_1066_2661 522
33 3300050494 nmdc:mga06z11_6489_c1 nmdc:mga06z11_6489_c1_458_2053 522
34 3300006852 Ga0075433_10212313 Ga0075433_102123131 524
35 3300009094 Ga0111539_10062048 Ga0111539_100620483 524
36 3300050511 nmdc:mga08y16_51268_c1 nmdc:mga08y16_51268_c1_774_2375 524
37 3300050512 nmdc:mga0n895_87672_c1 nmdc:mga0n895_87672_c1_229_1830 524
38 3300050515 nmdc:mga0a205_38502_c1 nmdc:mga0a205_38502_c1_1346_2947 524
39 3300003203 JGI25406J46586_10001745 JGI25406J46586_100017458 525
40 3300005985 Ga0081539_10001086 Ga0081539_1000108627 525
41 3300031727 Ga0316576_10058535 Ga0316576_100585351 525
42 iso_pu_bacteria 2883577096 2883578276 525
43 3300036401 Ga0373937_0126410 Ga0373937_0126410_661_2271 526
44 3300037068 Ga0373925_0011096 Ga0373925_0011096_3908_5518 526
45 3300046462 Ga0495651_0016445 Ga0495651_0016445_171_1781 526
46 3300047319 Ga0495674_0053408 Ga0495674_0053408_505_2115 526
47 3300036712 Ga0316584_0009648 Ga0316584_0009648_3177_4823 527
48 3300005345 Ga0070692_10042937 Ga0070692_100429371 528
49 3300005457 Ga0070662_100112870 Ga0070662_1001128701 528
50 3300006844 Ga0075428_100019351 Ga0075428_1000193514 528
51 3300009094 Ga0111539_10015391 Ga0111539_100153913 528
52 3300025933 Ga0207706_10007170 Ga0207706_100071704 528
53 3300025972 Ga0207668_10118277 Ga0207668_101182772 528
54 3300031548 Ga0307408_100003757 Ga0307408_1000037573 528
55 3300032002 Ga0307416_100010360 Ga0307416_1000103604 528
56 3300046455 Ga0495603_0019161 Ga0495603_0019161_1113_2726 528
57 3300046477 Ga0495664_0017320 Ga0495664_0017320_2390_4081 528
58 3300050511 nmdc:mga08y16_4217_c1 nmdc:mga08y16_4217_c1_6770_8383 528
59 3300061734 Ga0530510_0028006 Ga0530510_0028006_1266_2879 528
60 3300031995 Ga0307409_100021911 Ga0307409_1000219114 529
61 iso_pu_bacteria 2894772417 2894776063 529
62 3300037853 Ga0436364_0347143 Ga0436364_0347143_756_2378 530
63 3300053119 Ga0500595_001424 Ga0500595_001424_10026_11783 531
64 3300053162 Ga0500638_002564 Ga0500638_002564_559_2316 531
65 3300053178 Ga0500637_0000020 Ga0500637_0000020_6806_8563 531
66 iso_pu_bacteria 2643221615 2644092557 531
67 iso_pu_bacteria 2643221657 2644323183 531
68 3300049576 Ga0501040_0003245 Ga0501040_0003245_3190_4818 533
69 3300049577 Ga0501041_0001618 Ga0501041_0001618_5934_7562 533
70 3300049578 Ga0501042_0000025 Ga0501042_0000025_25062_26690 533
71 3300049580 Ga0501046_0000526 Ga0501046_0000526_34440_36068 533
72 3300049582 Ga0501048_0040674 Ga0501048_0040674_1483_3111 533
73 3300049590 Ga0501074_0001414 Ga0501074_0001414_10507_12135 533
74 3300049592 Ga0501076_0001997 Ga0501076_0001997_11577_13205 533
75 3300049593 Ga0501077_0014086 Ga0501077_0014086_942_2570 533
76 3300049741 Ga0501079_0004979 Ga0501079_0004979_7797_9425 533
77 3300049822 Ga0501035_0114974 Ga0501035_0114974_564_2192 533
78 3300049824 Ga0501045_0000034 Ga0501045_0000034_32129_33757 533
79 3300060353 Ga0501082_0004032 Ga0501082_0004032_11035_12663 533
80 3300061734 Ga0530510_0021952 Ga0530510_0021952_97_1725 533
81 iso_pu_bacteria 2929199973 2929205384 533
82 iso_pu_bacteria 8055909800 8055914178 533
83 3300045051 Ga0451576_0161213 Ga0451576_0161213_586_2223 534
84 3300049575 Ga0501039_0016754 Ga0501039_0016754_838_2493 534
85 3300049581 Ga0501047_0189031 Ga0501047_0189031_155_1801 534
86 3300049587 Ga0501071_0098681 Ga0501071_0098681_201_1856 534
87 3300060353 Ga0501082_0054233 Ga0501082_0054233_499_2154 534
88 3300009177 Ga0105248_10058745 Ga0105248_100587454 535
89 3300025941 Ga0207711_10093442 Ga0207711_100934422 535
90 3300025942 Ga0207689_10173636 Ga0207689_101736361 535
91 3300025961 Ga0207712_10070823 Ga0207712_100708232 535
92 3300046543 Ga0495645_0009645 Ga0495645_0009645_243_1880 535
93 3300025940 Ga0207691_10081848 Ga0207691_100818482 536
94 3300025972 Ga0207668_10127231 Ga0207668_101272311 536
95 3300025986 Ga0207658_10119085 Ga0207658_101190851 536
96 3300026035 Ga0207703_10157787 Ga0207703_101577871 536
97 3300026089 Ga0207648_10192104 Ga0207648_101921041 536
98 3300031247 Ga0265340_10032666 Ga0265340_100326662 536
99 3300035724 Ga0373933_0047169 Ga0373933_0047169_403_2118 536
100 3300036401 Ga0373937_0013648 Ga0373937_0013648_2628_4343 536
101 3300046511 Ga0495608_0009481 Ga0495608_0009481_5063_6778 536
102 3300046514 Ga0495618_0051214 Ga0495618_0051214_933_2573 536
103 3300046536 Ga0495587_0003769 Ga0495587_0003769_2683_4398 536
104 3300046809 Ga0495600_0018357 Ga0495600_0018357_872_2587 536
105 3300047319 Ga0495674_0025756 Ga0495674_0025756_1318_3033 536
106 3300047322 Ga0495680_0033919 Ga0495680_0033919_1899_3614 536
107 3300048088 Ga0495602_0001301 Ga0495602_0001301_7556_9271 536
108 3300048911 Ga0496108_0129009 Ga0496108_0129009_198_1835 536
109 3300048915 Ga0496112_0129763 Ga0496112_0129763_397_2034 536
110 3300048918 Ga0496115_0144835 Ga0496115_0144835_46_1683 536
111 3300005328 Ga0070676_10001297 Ga0070676_100012975 537
112 3300005328 Ga0070676_10005502 Ga0070676_100055025 537
113 3300005331 Ga0070670_100003444 Ga0070670_1000034447 537
114 3300005334 Ga0068869_100003296 Ga0068869_1000032964 537
115 3300005334 Ga0068869_100084190 Ga0068869_1000841902 537
116 3300005336 Ga0070680_100008254 Ga0070680_1000082547 537
117 3300005337 Ga0070682_100000343 Ga0070682_10000034315 537
118 3300005339 Ga0070660_100000092 Ga0070660_10000009229 537
119 3300005340 Ga0070689_100109940 Ga0070689_1001099402 537
120 3300005344 Ga0070661_100001263 Ga0070661_10000126315 537
121 3300005345 Ga0070692_10003454 Ga0070692_100034543 537
122 3300005366 Ga0070659_100001617 Ga0070659_1000016176 537
123 3300005434 Ga0070709_10016813 Ga0070709_100168132 537
124 3300005435 Ga0070714_100005196 Ga0070714_1000051966 537
125 3300005436 Ga0070713_100013166 Ga0070713_1000131663 537
126 3300005436 Ga0070713_100072111 Ga0070713_1000721112 537
127 3300005436 Ga0070713_100088313 Ga0070713_1000883132 537
128 3300005437 Ga0070710_10001645 Ga0070710_100016453 537
129 3300005437 Ga0070710_10002009 Ga0070710_100020095 537
130 3300005439 Ga0070711_100012187 Ga0070711_1000121874 537
131 3300005440 Ga0070705_100000097 Ga0070705_10000009710 537
132 3300005444 Ga0070694_100000924 Ga0070694_1000009246 537
133 3300005456 Ga0070678_100014771 Ga0070678_1000147716 537
134 3300005458 Ga0070681_10004953 Ga0070681_100049536 537
135 3300005468 Ga0070707_100071095 Ga0070707_1000710952 537
136 3300005471 Ga0070698_100177218 Ga0070698_1001772181 537
137 3300005530 Ga0070679_100001488 Ga0070679_10000148811 537
138 3300005535 Ga0070684_100008034 Ga0070684_1000080343 537
139 3300005539 Ga0068853_100001921 Ga0068853_1000019213 537
140 3300005545 Ga0070695_100000513 Ga0070695_10000051310 537
141 3300005545 Ga0070695_100006802 Ga0070695_1000068024 537
142 3300005546 Ga0070696_100000765 Ga0070696_10000076510 537
143 3300005547 Ga0070693_100001256 Ga0070693_1000012568 537
144 3300005547 Ga0070693_100040433 Ga0070693_1000404332 537
145 3300005549 Ga0070704_100001309 Ga0070704_10000130910 537
146 3300005549 Ga0070704_100116597 Ga0070704_1001165972 537
147 3300005563 Ga0068855_100001162 Ga0068855_10000116217 537
148 3300005564 Ga0070664_100002879 Ga0070664_1000028794 537
149 3300005577 Ga0068857_100011504 Ga0068857_1000115042 537
150 3300005578 Ga0068854_100001418 Ga0068854_10000141812 537
151 3300005614 Ga0068856_100000860 Ga0068856_10000086021 537
152 3300005614 Ga0068856_100034518 Ga0068856_1000345182 537
153 3300005615 Ga0070702_100050287 Ga0070702_1000502872 537
154 3300005617 Ga0068859_100004735 Ga0068859_1000047353 537
155 3300005719 Ga0068861_100008590 Ga0068861_1000085903 537
156 3300005719 Ga0068861_100071009 Ga0068861_1000710092 537
157 3300005840 Ga0068870_10000394 Ga0068870_1000039410 537
158 3300005842 Ga0068858_100055954 Ga0068858_1000559542 537
159 3300005843 Ga0068860_100022396 Ga0068860_1000223965 537
160 3300005843 Ga0068860_100075372 Ga0068860_1000753723 537
161 3300005844 Ga0068862_100020781 Ga0068862_1000207814 537
162 3300005844 Ga0068862_100027537 Ga0068862_1000275372 537
163 3300005937 Ga0081455_10004309 Ga0081455_1000430919 537
164 3300005981 Ga0081538_10016428 Ga0081538_100164286 537
165 3300005981 Ga0081538_10016494 Ga0081538_100164944 537
166 3300005983 Ga0081540_1001368 Ga0081540_100136812 537
167 3300005983 Ga0081540_1010642 Ga0081540_10106423 537
168 3300006028 Ga0070717_10003766 Ga0070717_1000376612 537
169 3300006173 Ga0070716_100005084 Ga0070716_1000050844 537
170 3300006175 Ga0070712_100004596 Ga0070712_1000045967 537
171 3300006175 Ga0070712_100072970 Ga0070712_1000729702 537
172 3300006844 Ga0075428_100081987 Ga0075428_1000819874 537
173 3300006846 Ga0075430_100005496 Ga0075430_1000054967 537
174 3300006846 Ga0075430_100012470 Ga0075430_1000124702 537
175 3300006846 Ga0075430_100064658 Ga0075430_1000646582 537
176 3300006847 Ga0075431_100003356 Ga0075431_1000033569 537
177 3300006847 Ga0075431_100016923 Ga0075431_1000169239 537
178 3300006847 Ga0075431_100190177 Ga0075431_1001901771 537
179 3300006852 Ga0075433_10077182 Ga0075433_100771821 537
180 3300006871 Ga0075434_100026718 Ga0075434_1000267183 537
181 3300006880 Ga0075429_100048473 Ga0075429_1000484732 537
182 3300006880 Ga0075429_100135697 Ga0075429_1001356971 537
183 3300006914 Ga0075436_100016162 Ga0075436_1000161623 537
184 3300006931 Ga0097620_100004736 Ga0097620_10000473612 537
185 3300007788 Ga0099795_10000188 Ga0099795_100001886 537
186 3300009147 Ga0114129_10160208 Ga0114129_101602082 537
187 3300009177 Ga0105248_10276290 Ga0105248_102762902 537
188 3300009553 Ga0105249_10015747 Ga0105249_100157472 537
189 3300010159 Ga0099796_10000365 Ga0099796_100003655 537
190 3300010375 Ga0105239_10335483 Ga0105239_103354831 537
191 3300013100 Ga0157373_10000370 Ga0157373_1000037031 537
192 3300013307 Ga0157372_10002599 Ga0157372_1000259912 537
193 3300014497 Ga0182008_10030656 Ga0182008_100306562 537
194 3300014745 Ga0157377_10025085 Ga0157377_100250852 537
195 3300021388 Ga0213875_10001557 Ga0213875_100015574 537
196 3300023672 Ga0247553_100090 Ga0247553_1000901 537
197 3300025885 Ga0207653_10021020 Ga0207653_100210202 537
198 3300025898 Ga0207692_10012664 Ga0207692_100126643 537
199 3300025906 Ga0207699_10071262 Ga0207699_100712622 537
200 3300025907 Ga0207645_10001568 Ga0207645_1000156810 537
201 3300025907 Ga0207645_10020875 Ga0207645_100208752 537
202 3300025912 Ga0207707_10000234 Ga0207707_1000023434 537
203 3300025915 Ga0207693_10006216 Ga0207693_100062164 537
204 3300025915 Ga0207693_10009563 Ga0207693_100095635 537
205 3300025916 Ga0207663_10011835 Ga0207663_100118352 537
206 3300025916 Ga0207663_10018838 Ga0207663_100188382 537
207 3300025919 Ga0207657_10000419 Ga0207657_1000041922 537
208 3300025920 Ga0207649_10002254 Ga0207649_100022548 537
209 3300025921 Ga0207652_10000306 Ga0207652_1000030610 537
210 3300025923 Ga0207681_10019538 Ga0207681_100195382 537
211 3300025928 Ga0207700_10012220 Ga0207700_100122205 537
212 3300025928 Ga0207700_10172287 Ga0207700_101722871 537
213 3300025929 Ga0207664_10154041 Ga0207664_101540412 537
214 3300025932 Ga0207690_10000501 Ga0207690_1000050117 537
215 3300025933 Ga0207706_10010100 Ga0207706_100101003 537
216 3300025939 Ga0207665_10007834 Ga0207665_100078342 537
217 3300025942 Ga0207689_10000138 Ga0207689_1000013853 537
218 3300025945 Ga0207679_10000570 Ga0207679_100005707 537
219 3300025949 Ga0207667_10005122 Ga0207667_100051225 537
220 3300025961 Ga0207712_10021720 Ga0207712_100217202 537
221 3300025961 Ga0207712_10029217 Ga0207712_100292173 537
222 3300025981 Ga0207640_10001802 Ga0207640_100018026 537
223 3300026023 Ga0207677_10099243 Ga0207677_100992432 537
224 3300026041 Ga0207639_10001579 Ga0207639_1000157910 537
225 3300026078 Ga0207702_10001221 Ga0207702_1000122117 537
226 3300026095 Ga0207676_10018348 Ga0207676_100183484 537
227 3300026116 Ga0207674_10000315 Ga0207674_1000031529 537
228 3300026118 Ga0207675_100015919 Ga0207675_1000159194 537
229 3300026118 Ga0207675_100106881 Ga0207675_1001068812 537
230 3300026121 Ga0207683_10045989 Ga0207683_100459892 537
231 3300028380 Ga0268265_10001613 Ga0268265_100016139 537
232 3300028381 Ga0268264_10017569 Ga0268264_100175692 537
233 3300035092 Ga0373952_0009808 Ga0373952_0009808_76_1716 537
234 3300035117 Ga0373953_0004441 Ga0373953_0004441_480_2120 537
235 3300035724 Ga0373933_0005179 Ga0373933_0005179_3683_5326 537
236 3300035724 Ga0373933_0012135 Ga0373933_0012135_1399_3042 537
237 3300036401 Ga0373937_0003534 Ga0373937_0003534_4041_5684 537
238 3300036401 Ga0373937_0049709 Ga0373937_0049709_1606_3249 537
239 3300037853 Ga0436364_0078005 Ga0436364_0078005_9372_11015 537
240 3300037853 Ga0436364_1245271 Ga0436364_1245271_16777_18417 537
241 3300039450 Ga0436363_1562559 Ga0436363_1562559_188_1831 537
242 3300042005 Ga0439448_0007839 Ga0439448_0007839_983_2623 537
243 3300042144 Ga0450889_000946 Ga0450889_000946_754_2394 537
244 3300042157 Ga0439458_0002654 Ga0439458_0002654_2128_3768 537
245 3300044712 Ga0453684_0093315 Ga0453684_0093315_1326_2966 537
246 3300045051 Ga0451576_0007348 Ga0451576_0007348_759_2399 537
247 3300046543 Ga0495645_0096633 Ga0495645_0096633_274_1917 537
248 3300046663 Ga0495635_0058438 Ga0495635_0058438_845_2488 537
249 3300047322 Ga0495680_0017320 Ga0495680_0017320_3555_5198 537
250 3300047322 Ga0495680_0065069 Ga0495680_0065069_1034_2677 537
251 3300047471 Ga0495684_0053576 Ga0495684_0053576_468_2111 537
252 3300048088 Ga0495602_0090333 Ga0495602_0090333_213_1856 537
253 3300049588 Ga0501072_0011861 Ga0501072_0011861_1019_2659 537
254 3300049591 Ga0501075_0020096 Ga0501075_0020096_1378_3018 537
255 3300049593 Ga0501077_0028587 Ga0501077_0028587_1229_2869 537
256 3300049741 Ga0501079_0012128 Ga0501079_0012128_3461_5101 537
257 3300049743 Ga0501081_0008819 Ga0501081_0008819_3866_5506 537
258 3300050507 nmdc:mga05p37_4900_c1 nmdc:mga05p37_4900_c1_10757_12397 537
259 3300050507 nmdc:mga05p37_50224_c1 nmdc:mga05p37_50224_c1_3399_5039 537
260 3300050508 nmdc:mga09592_28268_c1 nmdc:mga09592_28268_c1_636_2276 537
261 3300050509 nmdc:mga0qj67_3817_c1 nmdc:mga0qj67_3817_c1_7445_9085 537
262 3300050509 nmdc:mga0qj67_871_c1 nmdc:mga0qj67_871_c1_15354_16994 537
263 3300050510 nmdc:mga06r32_18132_c1 nmdc:mga06r32_18132_c1_680_2320 537
264 3300050510 nmdc:mga06r32_4812_c1 nmdc:mga06r32_4812_c1_7150_8790 537
265 3300050510 nmdc:mga06r32_4966_c1 nmdc:mga06r32_4966_c1_7543_9183 537
266 3300053084 Ga0495595_0009199 Ga0495595_0009199_1377_3020 537
267 3300053084 Ga0495595_0037345 Ga0495595_0037345_130_1773 537
268 3300053085 Ga0495619_0008260 Ga0495619_0008260_3692_5332 537
269 3300053085 Ga0495619_0034557 Ga0495619_0034557_984_2624 537
270 3300053085 Ga0495619_0046629 Ga0495619_0046629_942_2612 537
271 3300054114 Ga0501084_0028072 Ga0501084_0028072_179_1819 537
272 3300006844 Ga0075428_100000280 Ga0075428_10000028022 538
273 3300006847 Ga0075431_100167340 Ga0075431_1001673402 538
274 3300006880 Ga0075429_100021238 Ga0075429_1000212387 538
275 3300009093 Ga0105240_10007117 Ga0105240_100071179 538
276 3300009093 Ga0105240_10007442 Ga0105240_100074429 538
277 3300009094 Ga0111539_10023514 Ga0111539_100235142 538
278 3300009147 Ga0114129_10002995 Ga0114129_1000299517 538
279 3300009174 Ga0105241_10003287 Ga0105241_100032871 538
280 3300009551 Ga0105238_10001598 Ga0105238_1000159821 538
281 3300009551 Ga0105238_10003529 Ga0105238_100035297 538
282 3300010375 Ga0105239_10004729 Ga0105239_100047298 538
283 3300025911 Ga0207654_10002909 Ga0207654_100029096 538
284 3300025913 Ga0207695_10001998 Ga0207695_1000199810 538
285 3300025924 Ga0207694_10000157 Ga0207694_100001577 538
286 3300025949 Ga0207667_10030838 Ga0207667_100308381 538
287 3300026078 Ga0207702_10000002 Ga0207702_10000002263 538
288 3300026142 Ga0207698_10017060 Ga0207698_100170604 538
289 3300027907 Ga0207428_10008668 Ga0207428_100086687 538
290 3300037068 Ga0373925_0000894 Ga0373925_0000894_20241_21923 538
291 3300048923 Ga0496120_0024665 Ga0496120_0024665_960_2606 538
292 3300050508 nmdc:mga09592_40849_c1 nmdc:mga09592_40849_c1_307_1959 538
293 3300050511 nmdc:mga08y16_17240_c1 nmdc:mga08y16_17240_c1_4741_6393 538
294 3300050511 nmdc:mga08y16_99402_c1 nmdc:mga08y16_99402_c1_552_2195 538
295 3300005355 Ga0070671_100111618 Ga0070671_1001116182 539
296 3300009094 Ga0111539_10110207 Ga0111539_101102072 540
297 3300042876 Ga0451577_0005255 Ga0451577_0005255_4007_5656 540
298 3300025913 Ga0207695_10026222 Ga0207695_100262224 549
299 3300039453 Ga0436362_0491404 Ga0436362_0491404_773_2455 549
300 3300010159 Ga0099796_10018952 Ga0099796_100189521 551
301 3300001990 JGI24737J22298_10001128 JGI24737J22298_100011283 600
302 3300025904 Ga0207647_10000712 Ga0207647_1000071220 600
303 3300025949 Ga0207667_10012877 Ga0207667_100128776 600
304 3300026078 Ga0207702_10150255 Ga0207702_101502551 600

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

86

154

0.94

PF00743

FMO-like

Flavin-binding monooxygenase-like

83

291

0.81

PF13434

Lys_Orn_oxgnase

L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase

137

302

0.8

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

85

304

0.72

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

82

331

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m10-assembly1.cif.gz_A crystal structure of cyclohexanone monooxygenase from thermocrispum municipale in the oxidised state with a bound nicotinamide. 0.953 80 596
7v8s-assembly1.cif.gz_B crystal structure of cyclohexanone monooxygenase from t. municipale mutant l437t complexed with nadp+ and fad in space group of p1211 0.9527 80 596
2ylx-assembly1.cif.gz_A snapshots of enzymatic baeyer-villiger catalysis: oxygen activation and intermediate stabilization: asp66ala mutant in complex with nadp and mes 0.949 82 597
4d04-assembly1.cif.gz_A structure of the cys65asp mutant of phenylacetone monooxygenase: reduced state 0.9483 82 597
2ym1-assembly1.cif.gz_A snapshots of enzymatic baeyer-villiger catalysis: oxygen activation and intermediate stabilization: arg337lys mutant in complex with nadp 0.9483 82 597
ID Description Score Start End Superfamily
af_Q9W5B5_23_112_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9061 170 196 3.30.2020.30
af_A0A1D6L6Q7_40_321_3.90.660.10 Alpha Beta;Alpha-Beta Complex;Polyamine Oxidase; Chain A, domain 2; 0.9029 168 194 3.90.660.10
2ylxA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8967 82 597 3.50.50.60
2ylxA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.882 82 597 3.50.50.60
5j60D02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8813 238 270 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A179EVQ0-F1-model_v4 Dimethylaniline monooxygenase 0.978 153 574 GO:0004499
GO:0050660
GO:0050661
AF-A0A3B9J6V3-F1-model_v4 Cyclohexanone monooxygenase 0.9773 261 597 GO:0016709
AF-A0A1H8WI81-F1-model_v4 Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD 0.9732 80 597 GO:0004499
GO:0050660
GO:0050661
AF-A0A6J7EX48-F1-model_v4 Unannotated protein 0.9689 314 597 GO:0016491
AF-A0A3B9AE70-F1-model_v4 Cyclohexanone monooxygenase 0.9674 278 597 GO:0004497

Feature Viewer

pLDDT pTM Quality
83.26 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map