F397642

General Info

Members Datasets Scaffolds Average Seq Length
304 148 608 158

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10139574|Ga0265338_101395742
Length 170
Sequence MALIGSKMIIALATDHAGFTQAAELEEYLKSLGYGCRSFGPKTLDPQDDYPDFIKPAAKAVASGECQKGIILGGSGQGEAMAANRVHGVRCAVFYGPAVPRRVVDAEGRTSHDPYEIVRLSRQHNDANMLSLAARFVSFKDMKQVIKLWLDTPFSDESRHQRRIKELDEL

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
147 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
148 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 0
Rhizosphere 96.38
Stem 0
Stem Tuber 0
Unclassified 17.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10139574 3300028800 Unclassified 1900
2 Ga0065712_10250567 3300005290 Unclassified 918
3 Ga0065715_10152739 3300005293 Unclassified 1710
4 Ga0070658_10072089 3300005327 Bacteria 2830
5 Ga0070683_100167041 3300005329 Bacteria 2088
6 Ga0070683_101202777 3300005329 Unclassified 728
7 Ga0070660_100000565 3300005339 Bacteria 24858
8 Ga0070674_100875533 3300005356 Bacteria 781
9 Ga0070673_101034304 3300005364 Unclassified 766
10 Ga0070688_101180121 3300005365 Bacteria 614
11 Ga0070667_100558679 3300005367 Unclassified 1052
12 Ga0070714_100000374 3300005435 Bacteria 33426
13 Ga0070714_100014460 3300005435 Bacteria 6340
14 Ga0070705_100159283 3300005440 Bacteria 1507
15 Ga0070694_100431375 3300005444 Bacteria 1037
16 Ga0070708_100021994 3300005445 Bacteria 5405
17 Ga0070708_100031588 3300005445 Bacteria 4585
18 Ga0070708_100059770 3300005445 Unclassified 3399
19 Ga0070708_100479620 3300005445 Bacteria 1173
20 Ga0070708_100797640 3300005445 Bacteria 888
21 Ga0070681_10172057 3300005458 Bacteria 2088
22 Ga0070706_100353653 3300005467 Unclassified 1369
23 Ga0070706_100486102 3300005467 Bacteria 1149
24 Ga0070707_100012728 3300005468 Bacteria 7853
25 Ga0070707_100056316 3300005468 Bacteria 3771
26 Ga0070707_100402162 3300005468 Bacteria 1329
27 Ga0070707_100496239 3300005468 Bacteria 1182
28 Ga0070698_100008134 3300005471 Bacteria 11337
29 Ga0070698_100055513 3300005471 Unclassified 4016
30 Ga0070698_100523158 3300005471 Bacteria 1125
31 Ga0070699_100188166 3300005518 Bacteria 1833
32 Ga0070699_101688277 3300005518 Unclassified 580
33 Ga0070679_100000652 3300005530 Bacteria 29531
34 Ga0070679_100000876 3300005530 Bacteria 26140
35 Ga0070679_100117587 3300005530 Unclassified 2643
36 Ga0070679_100311006 3300005530 Bacteria 1525
37 Ga0070679_100499687 3300005530 Unclassified 1160
38 Ga0070679_101016071 3300005530 Unclassified 773
39 Ga0070684_100091583 3300005535 Bacteria 2705
40 Ga0070684_101451018 3300005535 Unclassified 646
41 Ga0070697_100004034 3300005536 Bacteria 11263
42 Ga0070697_100984233 3300005536 Bacteria 749
43 Ga0068853_100029637 3300005539 Bacteria 4616
44 Ga0070686_100086588 3300005544 Bacteria 2086
45 Ga0070686_100136287 3300005544 Bacteria 1704
46 Ga0070696_100494161 3300005546 Bacteria 972
47 Ga0068855_100011595 3300005563 Bacteria 10648
48 Ga0068855_100016848 3300005563 Bacteria 8791
49 Ga0068855_100054831 3300005563 Bacteria 4685
50 Ga0068855_100137462 3300005563 Bacteria 2787
51 Ga0068855_100383926 3300005563 Bacteria 1542
52 Ga0068857_100004295 3300005577 Bacteria 12019
53 Ga0068857_100045243 3300005577 Bacteria 3904
54 Ga0068857_100131698 3300005577 Bacteria 2255
55 Ga0068856_100037200 3300005614 Unclassified 4775
56 Ga0068856_100053736 3300005614 Unclassified 3972
57 Ga0068852_100000001 3300005616 Bacteria 716526
58 Ga0068852_100059093 3300005616 Bacteria 3324
59 Ga0068861_100367854 3300005719 Bacteria 1266
60 Ga0068858_100035290 3300005842 Bacteria 4639
61 Ga0068860_100256173 3300005843 Bacteria 1705
62 Ga0081539_10001746 3300005985 Bacteria 34691
63 Ga0070717_10003528 3300006028 Bacteria 11213
64 Ga0070717_10021890 3300006028 Bacteria 5043
65 Ga0070717_10141295 3300006028 Bacteria 2077
66 Ga0075365_10029697 3300006038 Bacteria 3497
67 Ga0075364_10567702 3300006051 Bacteria 775
68 Ga0070716_100081028 3300006173 Unclassified 1937
69 Ga0075366_10000044 3300006195 Bacteria 45021
70 Ga0075366_10354867 3300006195 Bacteria 900
71 Ga0075436_100028465 3300006914 Unclassified 3844
72 Ga0105240_10013363 3300009093 Bacteria 11278
73 Ga0105240_10064650 3300009093 Bacteria 4545
74 Ga0105240_10289760 3300009093 Bacteria 1877
75 Ga0105245_10000001 3300009098 Bacteria 939270
76 Ga0105245_10048498 3300009098 Bacteria 3799
77 Ga0105245_10086634 3300009098 Bacteria 2873
78 Ga0105241_10023216 3300009174 Bacteria 4599
79 Ga0105241_10253580 3300009174 Bacteria 1493
80 Ga0105241_10380755 3300009174 Bacteria 1233
81 Ga0105241_10910055 3300009174 Bacteria 817
82 Ga0105237_10000002 3300009545 Bacteria 702357
83 Ga0105238_10003523 3300009551 Bacteria 15595
84 Ga0105238_10038386 3300009551 Bacteria 4864
85 Ga0105238_10160480 3300009551 Bacteria 2224
86 Ga0105238_11074049 3300009551 Unclassified 827
87 Ga0105239_10004097 3300010375 Bacteria 17527
88 Ga0105239_11334434 3300010375 Unclassified 828
89 Ga0157370_10617294 3300013104 Bacteria 992
90 Ga0157370_10836093 3300013104 Unclassified 837
91 Ga0157369_10136313 3300013105 Bacteria 2599
92 Ga0157369_10152376 3300013105 Bacteria 2443
93 Ga0157369_10180338 3300013105 Bacteria 2222
94 Ga0157369_10194668 3300013105 Bacteria 2129
95 Ga0157369_10305663 3300013105 Bacteria 1654
96 Ga0157378_10062734 3300013297 Bacteria 3319
97 Ga0157378_10081209 3300013297 Bacteria 2930
98 Ga0163162_10500196 3300013306 Bacteria 1346
99 Ga0157372_10432924 3300013307 Bacteria 1533
100 Ga0157379_10248204 3300014968 Bacteria 1615
101 Ga0163161_10040972 3300017792 Bacteria 3327
102 Ga0207666_1005428 3300025271 Bacteria 1629
103 Ga0207697_10002964 3300025315 Bacteria 8569
104 Ga0207688_10060689 3300025901 Bacteria 2130
105 Ga0207680_10243705 3300025903 Bacteria 1239
106 Ga0207647_10489286 3300025904 Unclassified 687
107 Ga0207705_10107304 3300025909 Bacteria 2060
108 Ga0207654_10007261 3300025911 Bacteria 5584
109 Ga0207654_10124777 3300025911 Bacteria 1621
110 Ga0207654_10398304 3300025911 Bacteria 956
111 Ga0207654_10735958 3300025911 Bacteria 710
112 Ga0207707_10046886 3300025912 Bacteria 3764
113 Ga0207695_10085923 3300025913 Bacteria 3174
114 Ga0207671_10000008 3300025914 Bacteria 798229
115 Ga0207693_10013742 3300025915 Bacteria 6522
116 Ga0207693_10141902 3300025915 Bacteria 1888
117 Ga0207663_10130086 3300025916 Bacteria 1738
118 Ga0207660_10001756 3300025917 Bacteria 14531
119 Ga0207662_10003795 3300025918 Bacteria 7838
120 Ga0207657_10000309 3300025919 Bacteria 51811
121 Ga0207652_10000906 3300025921 Bacteria 28011
122 Ga0207652_10004857 3300025921 Bacteria 10886
123 Ga0207652_10251815 3300025921 Bacteria 1593
124 Ga0207652_10382836 3300025921 Bacteria 1269
125 Ga0207652_10496524 3300025921 Unclassified 1099
126 Ga0207652_10865105 3300025921 Unclassified 800
127 Ga0207646_10014338 3300025922 Bacteria 7532
128 Ga0207646_10043209 3300025922 Bacteria 4048
129 Ga0207646_10116601 3300025922 Unclassified 2398
130 Ga0207646_10123370 3300025922 Unclassified 2328
131 Ga0207646_10211255 3300025922 Bacteria 1752
132 Ga0207646_10243830 3300025922 Bacteria 1623
133 Ga0207681_10014846 3300025923 Bacteria 4850
134 Ga0207694_10000890 3300025924 Bacteria 26483
135 Ga0207694_10074130 3300025924 Bacteria 2664
136 Ga0207687_10000030 3300025927 Bacteria 155548
137 Ga0207664_10000269 3300025929 Bacteria 39220
138 Ga0207664_10257825 3300025929 Bacteria 1524
139 Ga0207664_11002019 3300025929 Unclassified 749
140 Ga0207706_10011823 3300025933 Bacteria 7949
141 Ga0207670_10069921 3300025936 Bacteria 2423
142 Ga0207691_10270795 3300025940 Bacteria 1462
143 Ga0207689_10256121 3300025942 Unclassified 1447
144 Ga0207661_10336417 3300025944 Unclassified 1360
145 Ga0207661_10432235 3300025944 Bacteria 1197
146 Ga0207667_10002118 3300025949 Bacteria 24862
147 Ga0207667_10006467 3300025949 Bacteria 14176
148 Ga0207667_10021272 3300025949 Bacteria 7190
149 Ga0207667_10140042 3300025949 Bacteria 2491
150 Ga0207667_10367933 3300025949 Bacteria 1465
151 Ga0207712_10029860 3300025961 Bacteria 3661
152 Ga0207668_10200820 3300025972 Unclassified 1587
153 Ga0207658_10032506 3300025986 Bacteria 3713
154 Ga0207658_10529778 3300025986 Unclassified 1052
155 Ga0207677_10016569 3300026023 Bacteria 4370
156 Ga0207703_10033671 3300026035 Bacteria 4064
157 Ga0207702_10087897 3300026078 Unclassified 2714
158 Ga0207702_10237360 3300026078 Unclassified 1706
159 Ga0207648_10513420 3300026089 Bacteria 1097
160 Ga0207674_10008732 3300026116 Bacteria 11666
161 Ga0207674_10011447 3300026116 Bacteria 9968
162 Ga0207674_10057197 3300026116 Bacteria 3954
163 Ga0207675_100199074 3300026118 Bacteria 1924
164 Ga0207698_10000001 3300026142 Bacteria 625389
165 Ga0207698_10735489 3300026142 Unclassified 984
166 Ga0268265_10063717 3300028380 Bacteria 2837
167 Ga0268264_10233173 3300028381 Bacteria 1701
168 Ga0265337_1000001 3300028556 Bacteria 140973
169 Ga0265337_1001897 3300028556 Bacteria 9949
170 Ga0265337_1001932 3300028556 Bacteria 9853
171 Ga0265337_1002922 3300028556 Bacteria 7591
172 Ga0265337_1005837 3300028556 Unclassified 4825
173 Ga0265326_10000303 3300028558 Bacteria 21740
174 Ga0265326_10001540 3300028558 Bacteria 8064
175 Ga0265326_10004220 3300028558 Unclassified 4629
176 Ga0265326_10037183 3300028558 Unclassified 1384
177 Ga0265326_10050454 3300028558 Bacteria 1178
178 Ga0265319_1008118 3300028563 Bacteria 4634
179 Ga0265319_1030009 3300028563 Bacteria 1904
180 Ga0265334_10000049 3300028573 Bacteria 89091
181 Ga0265334_10003511 3300028573 Bacteria 7110
182 Ga0265334_10004026 3300028573 Bacteria 6596
183 Ga0265334_10025136 3300028573 Bacteria 2412
184 Ga0265334_10038813 3300028573 Bacteria 1871
185 Ga0265334_10095985 3300028573 Unclassified 1077
186 Ga0265318_10003578 3300028577 Bacteria 7775
187 Ga0265318_10011506 3300028577 Bacteria 3806
188 Ga0265318_10116134 3300028577 Bacteria 983
189 Ga0265323_10005117 3300028653 Bacteria 5589
190 Ga0265322_10001961 3300028654 Bacteria 6509
191 Ga0265322_10083645 3300028654 Bacteria 906
192 Ga0265336_10000047 3300028666 Bacteria 123576
193 Ga0265336_10002635 3300028666 Bacteria 7288
194 Ga0265336_10002777 3300028666 Bacteria 7074
195 Ga0265336_10005536 3300028666 Bacteria 4651
196 Ga0265338_10000003 3300028800 Bacteria 733923
197 Ga0265338_10000039 3300028800 Bacteria 236135
198 Ga0265338_10000054 3300028800 Bacteria 207383
199 Ga0265338_10000178 3300028800 Bacteria 118345
200 Ga0265338_10000482 3300028800 Bacteria 71209
201 Ga0265338_10002389 3300028800 Bacteria 28280
202 Ga0265338_10013060 3300028800 Bacteria 9413
203 Ga0265338_10030929 3300028800 Bacteria 5259
204 Ga0265338_10076270 3300028800 Bacteria 2840
205 Ga0265338_10090631 3300028800 Unclassified 2530
206 Ga0265338_10100438 3300028800 Bacteria 2360
207 Ga0265338_10149692 3300028800 Unclassified 1815
208 Ga0265338_10182989 3300028800 Bacteria 1595
209 Ga0265338_10242244 3300028800 Unclassified 1335
210 Ga0265338_10350161 3300028800 Unclassified 1062
211 Ga0265324_10011104 3300029957 Unclassified 3444
212 Ga0265324_10023814 3300029957 Bacteria 2178
213 Ga0265324_10025215 3300029957 Bacteria 2108
214 Ga0265330_10009761 3300031235 Bacteria 4547
215 Ga0265330_10081468 3300031235 Bacteria 1394
216 Ga0265332_10003382 3300031238 Bacteria 7722
217 Ga0265332_10174258 3300031238 Bacteria 897
218 Ga0265332_10233944 3300031238 Bacteria 761
219 Ga0265328_10012928 3300031239 Bacteria 3314
220 Ga0265320_10009368 3300031240 Bacteria 5912
221 Ga0265320_10020970 3300031240 Bacteria 3526
222 Ga0265320_10093688 3300031240 Bacteria 1389
223 Ga0265320_10132006 3300031240 Bacteria 1134
224 Ga0265325_10014388 3300031241 Bacteria 4473
225 Ga0265325_10018573 3300031241 Bacteria 3857
226 Ga0265325_10139795 3300031241 Bacteria 1153
227 Ga0265325_10162559 3300031241 Unclassified 1049
228 Ga0265329_10008151 3300031242 Bacteria 3993
229 Ga0265340_10019710 3300031247 Bacteria 3472
230 Ga0265340_10079875 3300031247 Unclassified 1541
231 Ga0265340_10239722 3300031247 Bacteria 809
232 Ga0265339_10052767 3300031249 Bacteria 2213
233 Ga0265339_10059147 3300031249 Bacteria 2067
234 Ga0265331_10003494 3300031250 Bacteria 10117
235 Ga0265327_10017578 3300031251 Bacteria 4479
236 Ga0265327_10033859 3300031251 Bacteria 2841
237 Ga0265327_10067732 3300031251 Bacteria 1797
238 Ga0265327_10070631 3300031251 Bacteria 1749
239 Ga0265327_10157489 3300031251 Unclassified 1051
240 Ga0265316_10050602 3300031344 Bacteria 3266
241 Ga0265316_10085616 3300031344 Bacteria 2411
242 Ga0265316_10279838 3300031344 Bacteria 1219
243 Ga0265316_10348382 3300031344 Bacteria 1072
244 Ga0265313_10005537 3300031595 Bacteria 9258
245 Ga0265313_10007292 3300031595 Bacteria 7591
246 Ga0265313_10034726 3300031595 Bacteria 2546
247 Ga0265313_10074012 3300031595 Bacteria 1562
248 Ga0265313_10128406 3300031595 Bacteria 1100
249 Ga0265313_10334902 3300031595 Bacteria 602
250 Ga0265314_10007161 3300031711 Bacteria 9714
251 Ga0265314_10019396 3300031711 Bacteria 5269
252 Ga0265314_10111998 3300031711 Bacteria 1732
253 Ga0265314_10272428 3300031711 Bacteria 961
254 Ga0265314_10469608 3300031711 Unclassified 667
255 Ga0265342_10005380 3300031712 Bacteria 9777
256 Ga0265342_10215193 3300031712 Bacteria 1037
257 Ga0307406_10116453 3300031901 Bacteria 1849
258 Ga0307409_100091047 3300031995 Bacteria 2498
259 Ga0307411_10120043 3300032005 Bacteria 1900
260 Ga0307415_100023226 3300032126 Bacteria 3845
261 Ga0373944_0135418 3300035089 Unclassified 859
262 Ga0395900_0005281 3300037418 Bacteria 13540
263 Ga0395900_0157148 3300037418 Bacteria 2322
264 Ga0395898_0059724 3300037466 Bacteria 3708
265 Ga0395898_0158574 3300037466 Bacteria 2164
266 Ga0395905_0062800 3300037471 Bacteria 3474
267 Ga0395901_0002456 3300038443 Bacteria 18794
268 Ga0395901_0093963 3300038443 Bacteria 3141
269 Ga0451577_0114423 3300042876 Bacteria 2415
270 Ga0453683_0288198 3300044673 Bacteria 1049
271 Ga0453683_1097914 3300044673 Bacteria 530
272 Ga0453684_0011100 3300044712 Bacteria 15200
273 Ga0453684_0559872 3300044712 Bacteria 1258
274 Ga0451576_0036414 3300045051 Bacteria 5217
275 Ga0451576_0059644 3300045051 Bacteria 3983
276 Ga0466958_0354566 3300045836 Bacteria 945
277 Ga0495628_0028531 3300046516 Bacteria 4533
278 Ga0495674_0717544 3300047319 Unclassified 783
279 Ga0501032_0215077 3300049569 Bacteria 1252
280 Ga0501034_0002581 3300049571 Bacteria 21539
281 Ga0501034_0010282 3300049571 Bacteria 9757
282 Ga0501034_0083345 3300049571 Bacteria 3199
283 Ga0501036_0068508 3300049572 Bacteria 3003
284 Ga0501038_0264351 3300049574 Bacteria 1358
285 Ga0501038_0564584 3300049574 Bacteria 864
286 Ga0501041_0169311 3300049577 Bacteria 1367
287 Ga0501047_0000397 3300049581 Bacteria 48886
288 Ga0501047_0018551 3300049581 Bacteria 6671
289 Ga0501047_0117084 3300049581 Bacteria 2546
290 Ga0501073_0113640 3300049589 Bacteria 1878
291 Ga0501083_0005553 3300049744 Bacteria 8941
292 Ga0501083_0169109 3300049744 Bacteria 1429
293 Ga0501035_0000033 3300049822 Bacteria 175087
294 Ga0501044_0165989 3300049823 Bacteria 2182
295 nmdc:mga0yw44_29003_c1 3300050492 Bacteria 3190
296 nmdc:mga0k408_114_c1 3300050493 Bacteria 39328
297 nmdc:mga08y16_634194_c1 3300050511 Bacteria 1074
298 nmdc:mga08x19_27202_c1 3300050514 Unclassified 3576
299 Ga0495601_0098796 3300053077 Bacteria 1884
300 Ga0500556_0001728 3300053104 Bacteria 8249
301 Ga0500556_0005758 3300053104 Bacteria 3507
302 Ga0500556_0108950 3300053104 Unclassified 1073
303 Ga0500628_167022 3300053129 Unclassified 623
304 Ga0500588_0056581 3300053146 Bacteria 1242
305 Ga0265338_10139574
306 Ga0065712_10250567
307 Ga0065715_10152739
308 Ga0070658_10072089
309 Ga0070683_100167041
310 Ga0070683_101202777
311 Ga0070660_100000565
312 Ga0070674_100875533
313 Ga0070673_101034304
314 Ga0070688_101180121
315 Ga0070667_100558679
316 Ga0070714_100000374
317 Ga0070714_100014460
318 Ga0070705_100159283
319 Ga0070694_100431375
320 Ga0070708_100021994
321 Ga0070708_100031588
322 Ga0070708_100059770
323 Ga0070708_100479620
324 Ga0070708_100797640
325 Ga0070681_10172057
326 Ga0070706_100353653
327 Ga0070706_100486102
328 Ga0070707_100012728
329 Ga0070707_100056316
330 Ga0070707_100402162
331 Ga0070707_100496239
332 Ga0070698_100008134
333 Ga0070698_100055513
334 Ga0070698_100523158
335 Ga0070699_100188166
336 Ga0070699_101688277
337 Ga0070679_100000652
338 Ga0070679_100000876
339 Ga0070679_100117587
340 Ga0070679_100311006
341 Ga0070679_100499687
342 Ga0070679_101016071
343 Ga0070684_100091583
344 Ga0070684_101451018
345 Ga0070697_100004034
346 Ga0070697_100984233
347 Ga0068853_100029637
348 Ga0070686_100086588
349 Ga0070686_100136287
350 Ga0070696_100494161
351 Ga0068855_100011595
352 Ga0068855_100016848
353 Ga0068855_100054831
354 Ga0068855_100137462
355 Ga0068855_100383926
356 Ga0068857_100004295
357 Ga0068857_100045243
358 Ga0068857_100131698
359 Ga0068856_100037200
360 Ga0068856_100053736
361 Ga0068852_100000001
362 Ga0068852_100059093
363 Ga0068861_100367854
364 Ga0068858_100035290
365 Ga0068860_100256173
366 Ga0081539_10001746
367 Ga0070717_10003528
368 Ga0070717_10021890
369 Ga0070717_10141295
370 Ga0075365_10029697
371 Ga0075364_10567702
372 Ga0070716_100081028
373 Ga0075366_10000044
374 Ga0075366_10354867
375 Ga0075436_100028465
376 Ga0105240_10013363
377 Ga0105240_10064650
378 Ga0105240_10289760
379 Ga0105245_10000001
380 Ga0105245_10048498
381 Ga0105245_10086634
382 Ga0105241_10023216
383 Ga0105241_10253580
384 Ga0105241_10380755
385 Ga0105241_10910055
386 Ga0105237_10000002
387 Ga0105238_10003523
388 Ga0105238_10038386
389 Ga0105238_10160480
390 Ga0105238_11074049
391 Ga0105239_10004097
392 Ga0105239_11334434
393 Ga0157370_10617294
394 Ga0157370_10836093
395 Ga0157369_10136313
396 Ga0157369_10152376
397 Ga0157369_10180338
398 Ga0157369_10194668
399 Ga0157369_10305663
400 Ga0157378_10062734
401 Ga0157378_10081209
402 Ga0163162_10500196
403 Ga0157372_10432924
404 Ga0157379_10248204
405 Ga0163161_10040972
406 Ga0207666_1005428
407 Ga0207697_10002964
408 Ga0207688_10060689
409 Ga0207680_10243705
410 Ga0207647_10489286
411 Ga0207705_10107304
412 Ga0207654_10007261
413 Ga0207654_10124777
414 Ga0207654_10398304
415 Ga0207654_10735958
416 Ga0207707_10046886
417 Ga0207695_10085923
418 Ga0207671_10000008
419 Ga0207693_10013742
420 Ga0207693_10141902
421 Ga0207663_10130086
422 Ga0207660_10001756
423 Ga0207662_10003795
424 Ga0207657_10000309
425 Ga0207652_10000906
426 Ga0207652_10004857
427 Ga0207652_10251815
428 Ga0207652_10382836
429 Ga0207652_10496524
430 Ga0207652_10865105
431 Ga0207646_10014338
432 Ga0207646_10043209
433 Ga0207646_10116601
434 Ga0207646_10123370
435 Ga0207646_10211255
436 Ga0207646_10243830
437 Ga0207681_10014846
438 Ga0207694_10000890
439 Ga0207694_10074130
440 Ga0207687_10000030
441 Ga0207664_10000269
442 Ga0207664_10257825
443 Ga0207664_11002019
444 Ga0207706_10011823
445 Ga0207670_10069921
446 Ga0207691_10270795
447 Ga0207689_10256121
448 Ga0207661_10336417
449 Ga0207661_10432235
450 Ga0207667_10002118
451 Ga0207667_10006467
452 Ga0207667_10021272
453 Ga0207667_10140042
454 Ga0207667_10367933
455 Ga0207712_10029860
456 Ga0207668_10200820
457 Ga0207658_10032506
458 Ga0207658_10529778
459 Ga0207677_10016569
460 Ga0207703_10033671
461 Ga0207702_10087897
462 Ga0207702_10237360
463 Ga0207648_10513420
464 Ga0207674_10008732
465 Ga0207674_10011447
466 Ga0207674_10057197
467 Ga0207675_100199074
468 Ga0207698_10000001
469 Ga0207698_10735489
470 Ga0268265_10063717
471 Ga0268264_10233173
472 Ga0265337_1000001
473 Ga0265337_1001897
474 Ga0265337_1001932
475 Ga0265337_1002922
476 Ga0265337_1005837
477 Ga0265326_10000303
478 Ga0265326_10001540
479 Ga0265326_10004220
480 Ga0265326_10037183
481 Ga0265326_10050454
482 Ga0265319_1008118
483 Ga0265319_1030009
484 Ga0265334_10000049
485 Ga0265334_10003511
486 Ga0265334_10004026
487 Ga0265334_10025136
488 Ga0265334_10038813
489 Ga0265334_10095985
490 Ga0265318_10003578
491 Ga0265318_10011506
492 Ga0265318_10116134
493 Ga0265323_10005117
494 Ga0265322_10001961
495 Ga0265322_10083645
496 Ga0265336_10000047
497 Ga0265336_10002635
498 Ga0265336_10002777
499 Ga0265336_10005536
500 Ga0265338_10000003
501 Ga0265338_10000039
502 Ga0265338_10000054
503 Ga0265338_10000178
504 Ga0265338_10000482
505 Ga0265338_10002389
506 Ga0265338_10013060
507 Ga0265338_10030929
508 Ga0265338_10076270
509 Ga0265338_10090631
510 Ga0265338_10100438
511 Ga0265338_10149692
512 Ga0265338_10182989
513 Ga0265338_10242244
514 Ga0265338_10350161
515 Ga0265324_10011104
516 Ga0265324_10023814
517 Ga0265324_10025215
518 Ga0265330_10009761
519 Ga0265330_10081468
520 Ga0265332_10003382
521 Ga0265332_10174258
522 Ga0265332_10233944
523 Ga0265328_10012928
524 Ga0265320_10009368
525 Ga0265320_10020970
526 Ga0265320_10093688
527 Ga0265320_10132006
528 Ga0265325_10014388
529 Ga0265325_10018573
530 Ga0265325_10139795
531 Ga0265325_10162559
532 Ga0265329_10008151
533 Ga0265340_10019710
534 Ga0265340_10079875
535 Ga0265340_10239722
536 Ga0265339_10052767
537 Ga0265339_10059147
538 Ga0265331_10003494
539 Ga0265327_10017578
540 Ga0265327_10033859
541 Ga0265327_10067732
542 Ga0265327_10070631
543 Ga0265327_10157489
544 Ga0265316_10050602
545 Ga0265316_10085616
546 Ga0265316_10279838
547 Ga0265316_10348382
548 Ga0265313_10005537
549 Ga0265313_10007292
550 Ga0265313_10034726
551 Ga0265313_10074012
552 Ga0265313_10128406
553 Ga0265313_10334902
554 Ga0265314_10007161
555 Ga0265314_10019396
556 Ga0265314_10111998
557 Ga0265314_10272428
558 Ga0265314_10469608
559 Ga0265342_10005380
560 Ga0265342_10215193
561 Ga0307406_10116453
562 Ga0307409_100091047
563 Ga0307411_10120043
564 Ga0307415_100023226
565 Ga0373944_0135418
566 Ga0395900_0005281
567 Ga0395900_0157148
568 Ga0395898_0059724
569 Ga0395898_0158574
570 Ga0395905_0062800
571 Ga0395901_0002456
572 Ga0395901_0093963
573 Ga0451577_0114423
574 Ga0453683_0288198
575 Ga0453683_1097914
576 Ga0453684_0011100
577 Ga0453684_0559872
578 Ga0451576_0036414
579 Ga0451576_0059644
580 Ga0466958_0354566
581 Ga0495628_0028531
582 Ga0495674_0717544
583 Ga0501032_0215077
584 Ga0501034_0002581
585 Ga0501034_0010282
586 Ga0501034_0083345
587 Ga0501036_0068508
588 Ga0501038_0264351
589 Ga0501038_0564584
590 Ga0501041_0169311
591 Ga0501047_0000397
592 Ga0501047_0018551
593 Ga0501047_0117084
594 Ga0501073_0113640
595 Ga0501083_0005553
596 Ga0501083_0169109
597 Ga0501035_0000033
598 Ga0501044_0165989
599 nmdc:mga0yw44_29003_c1
600 nmdc:mga0k408_114_c1
601 nmdc:mga08y16_634194_c1
602 nmdc:mga08x19_27202_c1
603 Ga0495601_0098796
604 Ga0500556_0001728
605 Ga0500556_0005758
606 Ga0500556_0108950
607 Ga0500628_167022
608 Ga0500588_0056581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

10

107

0.96

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

102

167

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9835 1 142
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9777 2 142
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9771 2 142
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9736 1 143
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.97 1 142
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9772 2 142 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9736 1 143 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.967 1 143 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9624 1 128 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9606 2 143 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A2V6JTY0-F1-model_v4 Ribose-5-phosphate isomerase 1.005 1 125 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6B4V8-F1-model_v4 Ribose-5-phosphate isomerase 1.004 1 118 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6HBS0-F1-model_v4 Ribose 5-phosphate isomerase B 1.003 1 143 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6LHR3-F1-model_v4 Ribose 5-phosphate isomerase B 1.001 1 143 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6D0B3-F1-model_v4 Ribose 5-phosphate isomerase B 1 1 143 GO:0004751
GO:0009052
GO:0019316

Map