F397643

General Info

Members Datasets Scaffolds Average Seq Length
304 178 608 329

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10151696|Ga0265338_101516962
Length 366
Sequence VAQHNRRDYYEILEVTKSASQEEVKSAYRKAALKWHPDRNPEKKETAEAKFREATEAYSVLSDAEKRSAYDRFGHAGVSSAGGAGGFNRTIFEEFQDVFGDFFGFEXXXGRGAAAAGGARGRARVQRGSDLRYDMRLTFDEAAAGVSTKIRLPRQDFCEACKGTGGKSGTGVVACETCGGRGQLHYQQGFFAISRTCPNCQGAGQVTIDVRIPPGVDSQTRIRVPGEGEPGANGGPAGDLYIVLEVKEHAFFERRGADLYCTIPVSIAQAALGTDITVPGITAEEKVSIPEGTQTGSIIRLKGKGLPDPHGGGKGDLYVCIRVITPTKLTREQRRMLQQLGETLGVENRPADRNSSFFEKVKDIFG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
76 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
77 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
86 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
87 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.64
Rhizosphere 98.03
Stem 0
Stem Tuber 0
Unclassified 12.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10151696 3300028800 Unclassified 1800
2 Ga0070692_10024988 3300005345 Bacteria 2941
3 Ga0070669_100002919 3300005353 Bacteria 12314
4 Ga0070671_100132907 3300005355 Bacteria 2096
5 Ga0070709_10017635 3300005434 Bacteria 4099
6 Ga0070709_10036240 3300005434 Unclassified 3004
7 Ga0070709_10181679 3300005434 Archaea 1478
8 Ga0070709_10246400 3300005434 Archaea 1285
9 Ga0070714_100218172 3300005435 Bacteria 1752
10 Ga0070714_100300650 3300005435 Bacteria 1496
11 Ga0070713_100038467 3300005436 Bacteria 3877
12 Ga0070713_100047041 3300005436 Unclassified 3544
13 Ga0070713_100089253 3300005436 Bacteria 2647
14 Ga0070713_100215880 3300005436 Bacteria 1738
15 Ga0070710_10070197 3300005437 Archaea 2017
16 Ga0070701_10024411 3300005438 Bacteria 2924
17 Ga0070711_100052158 3300005439 Bacteria 2814
18 Ga0070711_100089461 3300005439 Bacteria 2215
19 Ga0070711_100128001 3300005439 Archaea 1887
20 Ga0070705_100088226 3300005440 Bacteria 1925
21 Ga0070708_100079394 3300005445 Bacteria 2968
22 Ga0070678_100065504 3300005456 Bacteria 2698
23 Ga0070681_10004696 3300005458 Archaea 13072
24 Ga0070706_100095505 3300005467 Bacteria 2759
25 Ga0070707_100000031 3300005468 Bacteria 120203
26 Ga0070707_100006797 3300005468 Bacteria 10589
27 Ga0070707_100009356 3300005468 Bacteria 9095
28 Ga0070707_100103282 3300005468 Bacteria 2762
29 Ga0070698_100055146 3300005471 Bacteria 4033
30 Ga0070698_100063410 3300005471 Bacteria 3727
31 Ga0070698_100316570 3300005471 Bacteria 1491
32 Ga0070699_100100896 3300005518 Bacteria 2530
33 Ga0070697_100268596 3300005536 Unclassified 1462
34 Ga0070695_100045259 3300005545 Unclassified 2804
35 Ga0070665_100003010 3300005548 Bacteria 18176
36 Ga0068859_100339075 3300005617 Bacteria 1597
37 Ga0068863_100010229 3300005841 Bacteria 9118
38 Ga0068858_100064937 3300005842 Bacteria 3378
39 Ga0068862_100102457 3300005844 Bacteria 2506
40 Ga0081455_10008627 3300005937 Bacteria 10568
41 Ga0081455_10021728 3300005937 Bacteria 6011
42 Ga0081539_10000494 3300005985 Bacteria 82708
43 Ga0081539_10072389 3300005985 Bacteria 1842
44 Ga0070717_10040876 3300006028 Bacteria 3779
45 Ga0070712_100043186 3300006175 Bacteria 3103
46 Ga0097621_100039553 3300006237 Bacteria 3788
47 Ga0068871_100001278 3300006358 Bacteria 16815
48 Ga0075428_100013979 3300006844 Bacteria 8936
49 Ga0075428_100101853 3300006844 Bacteria 3131
50 Ga0075428_100355600 3300006844 Bacteria 1572
51 Ga0075430_100179443 3300006846 Bacteria 1761
52 Ga0075430_100373870 3300006846 Unclassified 1176
53 Ga0075431_100079062 3300006847 Bacteria 3395
54 Ga0075431_100290455 3300006847 Unclassified 1654
55 Ga0075433_10011405 3300006852 Bacteria 7157
56 Ga0075433_10031263 3300006852 Bacteria 4550
57 Ga0075433_10117182 3300006852 Bacteria 2363
58 Ga0075434_100000527 3300006871 Bacteria 29136
59 Ga0075434_100006816 3300006871 Bacteria 10508
60 Ga0075434_100078972 3300006871 Bacteria 3287
61 Ga0075436_100025537 3300006914 Bacteria 4067
62 Ga0075436_100099175 3300006914 Archaea 2028
63 Ga0097620_100339074 3300006931 Bacteria 1597
64 Ga0075435_100016329 3300007076 Bacteria 5597
65 Ga0099794_10005531 3300007265 Bacteria 5072
66 Ga0105240_10012563 3300009093 Archaea 11681
67 Ga0105240_10069565 3300009093 Unclassified 4356
68 Ga0111539_10002668 3300009094 Bacteria 23630
69 Ga0114129_10008808 3300009147 Bacteria 14398
70 Ga0114129_10096576 3300009147 Bacteria 4091
71 Ga0105243_10086568 3300009148 Bacteria 2570
72 Ga0105242_10224881 3300009176 Bacteria 1679
73 Ga0157373_10234658 3300013100 Bacteria 1296
74 Ga0157374_10071818 3300013296 Bacteria 3265
75 Ga0157378_10003816 3300013297 Bacteria 13331
76 Ga0157378_10005703 3300013297 Bacteria 10894
77 Ga0157375_10076526 3300013308 Bacteria 3374
78 Ga0157379_10117000 3300014968 Bacteria 2398
79 Ga0157376_10000004 3300014969 Bacteria 508493
80 Ga0157376_10002854 3300014969 Bacteria 11831
81 Ga0228598_1001648 3300024227 Unclassified 4881
82 Ga0207692_10008834 3300025898 Archaea 4186
83 Ga0207692_10013410 3300025898 Archaea 3555
84 Ga0207699_10025727 3300025906 Bacteria 3235
85 Ga0207699_10116542 3300025906 Unclassified 1720
86 Ga0207705_10004576 3300025909 Bacteria 10447
87 Ga0207684_10104096 3300025910 Archaea 2426
88 Ga0207684_10194311 3300025910 Bacteria 1750
89 Ga0207707_10008333 3300025912 Archaea 8992
90 Ga0207695_10053722 3300025913 Archaea 4211
91 Ga0207695_10197859 3300025913 Unclassified 1925
92 Ga0207693_10046843 3300025915 Bacteria 3397
93 Ga0207663_10009316 3300025916 Archaea 5182
94 Ga0207663_10028616 3300025916 Archaea 3263
95 Ga0207663_10034782 3300025916 Archaea 3017
96 Ga0207646_10000012 3300025922 Bacteria 367049
97 Ga0207646_10000046 3300025922 Bacteria 177239
98 Ga0207646_10004238 3300025922 Bacteria 15671
99 Ga0207646_10076221 3300025922 Bacteria 2997
100 Ga0207687_10080289 3300025927 Bacteria 2354
101 Ga0207700_10001548 3300025928 Archaea 13040
102 Ga0207700_10092996 3300025928 Bacteria 2385
103 Ga0207664_10043736 3300025929 Archaea 3505
104 Ga0207664_10323401 3300025929 Bacteria 1361
105 Ga0207665_10006643 3300025939 Bacteria 7674
106 Ga0207665_10033074 3300025939 Bacteria 3426
107 Ga0207711_10124035 3300025941 Bacteria 2309
108 Ga0207667_10087004 3300025949 Bacteria 3233
109 Ga0207640_10184618 3300025981 Bacteria 1567
110 Ga0207703_10285448 3300026035 Bacteria 1500
111 Ga0207708_10083064 3300026075 Bacteria 2462
112 Ga0207641_10025119 3300026088 Bacteria 4911
113 Ga0207641_10216689 3300026088 Bacteria 1773
114 Ga0207683_10087637 3300026121 Bacteria 2768
115 Ga0207428_10002609 3300027907 Bacteria 18000
116 Ga0207428_10007573 3300027907 Bacteria 9897
117 Ga0268266_10000470 3300028379 Bacteria 58333
118 Ga0265337_1043419 3300028556 Archaea 1285
119 Ga0265326_10000233 3300028558 Archaea 26740
120 Ga0265326_10000234 3300028558 Archaea 26730
121 Ga0265319_1000970 3300028563 Bacteria 18050
122 Ga0265334_10000746 3300028573 Archaea 16291
123 Ga0265318_10000424 3300028577 Bacteria 32313
124 Ga0265322_10000018 3300028654 Archaea 112105
125 Ga0265336_10000035 3300028666 Archaea 158710
126 Ga0265336_10000817 3300028666 Archaea 16330
127 Ga0265338_10000361 3300028800 Archaea 82062
128 Ga0265338_10000362 3300028800 Archaea 82041
129 Ga0265338_10006280 3300028800 Bacteria 15195
130 Ga0265338_10021761 3300028800 Bacteria 6667
131 Ga0265338_10052701 3300028800 Bacteria 3647
132 Ga0265324_10000463 3300029957 Archaea 28562
133 Ga0265324_10000655 3300029957 Archaea 23366
134 Ga0265332_10002602 3300031238 Archaea 9126
135 Ga0265332_10006469 3300031238 Bacteria 5313
136 Ga0265328_10056216 3300031239 Bacteria 1444
137 Ga0265320_10000131 3300031240 Bacteria 64956
138 Ga0265320_10006778 3300031240 Bacteria 7182
139 Ga0265325_10000528 3300031241 Archaea 27612
140 Ga0265325_10004101 3300031241 Bacteria 9280
141 Ga0265325_10005365 3300031241 Bacteria 7930
142 Ga0265325_10051070 3300031241 Archaea 2127
143 Ga0265329_10006292 3300031242 Archaea 4719
144 Ga0265340_10000978 3300031247 Archaea 16330
145 Ga0265340_10000980 3300031247 Archaea 16319
146 Ga0265340_10002645 3300031247 Bacteria 10180
147 Ga0265340_10023569 3300031247 Bacteria 3137
148 Ga0265339_10000642 3300031249 Archaea 26990
149 Ga0265339_10005286 3300031249 Bacteria 8611
150 Ga0265339_10042405 3300031249 Archaea 2519
151 Ga0265331_10000016 3300031250 Archaea 273855
152 Ga0265331_10000246 3300031250 Bacteria 64957
153 Ga0265331_10000890 3300031250 Archaea 24279
154 Ga0265331_10003861 3300031250 Bacteria 9482
155 Ga0265331_10049358 3300031250 Bacteria 2021
156 Ga0265316_10000602 3300031344 Bacteria 40145
157 Ga0265316_10003098 3300031344 Archaea 16940
158 Ga0265316_10006470 3300031344 Bacteria 11183
159 Ga0265316_10007613 3300031344 Bacteria 10177
160 Ga0265316_10039576 3300031344 Bacteria 3785
161 Ga0265316_10062693 3300031344 Bacteria 2885
162 Ga0307408_100266269 3300031548 Bacteria 1421
163 Ga0265313_10001486 3300031595 Bacteria 21862
164 Ga0265314_10001616 3300031711 Archaea 24718
165 Ga0265314_10020331 3300031711 Bacteria 5125
166 Ga0265342_10000218 3300031712 Bacteria 64950
167 Ga0265342_10034981 3300031712 Bacteria 3079
168 Ga0307405_10216731 3300031731 Bacteria 1401
169 Ga0307410_10005178 3300031852 Bacteria 6867
170 Ga0307407_10165299 3300031903 Bacteria 1452
171 Ga0307409_100020613 3300031995 Bacteria 4498
172 Ga0307416_100042102 3300032002 Bacteria 3562
173 Ga0307411_10133321 3300032005 Bacteria 1819
174 Ga0307415_100054866 3300032126 Bacteria 2723
175 Ga0307415_100131157 3300032126 Bacteria 1897
176 Ga0316593_10026724 3300032168 Unclassified 1847
177 Ga0373939_0009963 3300035114 Bacteria 2366
178 Ga0373954_0060955 3300035118 Unclassified 1780
179 Ga0373960_0034965 3300035121 Archaea 1424
180 Ga0373931_0066453 3300035691 Unclassified 1957
181 Ga0373935_0032180 3300035692 Unclassified 3258
182 Ga0373947_0024015 3300035725 Unclassified 3549
183 Ga0373937_0041127 3300036401 Unclassified 4217
184 Ga0373937_0053719 3300036401 Unclassified 3695
185 Ga0395900_0024683 3300037418 Bacteria 6152
186 Ga0395900_0177602 3300037418 Bacteria 2165
187 Ga0395905_0001373 3300037471 Bacteria 29537
188 Ga0395905_0155582 3300037471 Bacteria 2150
189 Ga0395905_0417066 3300037471 Bacteria 1238
190 Ga0395901_0003598 3300038443 Bacteria 15633
191 Ga0395901_0130038 3300038443 Bacteria 2645
192 Ga0395901_0138068 3300038443 Bacteria 2562
193 Ga0436363_0224992 3300039450 Bacteria 2953
194 Ga0451577_0085296 3300042876 Bacteria 2817
195 Ga0451577_0268751 3300042876 Bacteria 1544
196 Ga0453683_0011305 3300044673 Bacteria 5888
197 Ga0453684_0027949 3300044712 Bacteria 8068
198 Ga0451576_0008447 3300045051 Bacteria 12090
199 Ga0451576_0009712 3300045051 Bacteria 11127
200 Ga0451576_0407816 3300045051 Bacteria 1425
201 Ga0495592_0007262 3300046454 Bacteria 8288
202 Ga0495603_0018086 3300046455 Bacteria 4264
203 Ga0495629_0000006 3300046459 Bacteria 389181
204 Ga0495651_0000132 3300046462 Bacteria 55295
205 Ga0495651_0003699 3300046462 Bacteria 11720
206 Ga0495651_0009783 3300046462 Bacteria 7372
207 Ga0495653_0002178 3300046463 Bacteria 15492
208 Ga0495653_0030213 3300046463 Unclassified 4318
209 Ga0495580_0007808 3300046472 Bacteria 8568
210 Ga0495582_0038665 3300046473 Bacteria 2626
211 Ga0495639_0007146 3300046475 Bacteria 4793
212 Ga0495639_0057547 3300046475 Bacteria 1776
213 Ga0495662_0018989 3300046476 Bacteria 3327
214 Ga0495594_0005608 3300046499 Bacteria 6450
215 Ga0495594_0080879 3300046499 Bacteria 1814
216 Ga0495608_0043203 3300046511 Bacteria 3012
217 Ga0495618_0065301 3300046514 Unclassified 2313
218 Ga0495628_0000278 3300046516 Bacteria 45948
219 Ga0495628_0374934 3300046516 Unclassified 1043
220 Ga0495630_0014659 3300046517 Bacteria 5714
221 Ga0495630_0024161 3300046517 Unclassified 4495
222 Ga0495666_0008362 3300046526 Bacteria 5187
223 Ga0495652_0001155 3300046529 Bacteria 29749
224 Ga0495652_0023471 3300046529 Bacteria 5467
225 Ga0495652_0149474 3300046529 Bacteria 1827
226 Ga0495665_0066909 3300046531 Unclassified 1895
227 Ga0495587_0001436 3300046536 Bacteria 15864
228 Ga0495667_0008760 3300046559 Bacteria 6876
229 Ga0495667_0014061 3300046559 Bacteria 5401
230 Ga0495634_0051222 3300046642 Unclassified 2771
231 Ga0495634_0117213 3300046642 Bacteria 1708
232 Ga0495635_0008581 3300046663 Bacteria 7136
233 Ga0495635_0025627 3300046663 Unclassified 4108
234 Ga0495635_0030693 3300046663 Bacteria 3734
235 Ga0495588_0019872 3300046674 Bacteria 3295
236 Ga0495657_0036562 3300046675 Bacteria 3393
237 Ga0495657_0056343 3300046675 Unclassified 2617
238 Ga0495657_0178880 3300046675 Bacteria 1303
239 Ga0495623_0036146 3300046679 Unclassified 3165
240 Ga0495646_0022275 3300046680 Unclassified 3997
241 Ga0495646_0099999 3300046680 Unclassified 1664
242 Ga0495647_0023792 3300046681 Bacteria 2224
243 Ga0495658_0000739 3300046683 Bacteria 17610
244 Ga0495613_0002121 3300046689 Bacteria 15056
245 Ga0495613_0036024 3300046689 Bacteria 3669
246 Ga0495624_0023217 3300046690 Unclassified 4091
247 Ga0495624_0069799 3300046690 Bacteria 2188
248 Ga0495600_0003416 3300046809 Bacteria 9339
249 Ga0495581_0007095 3300047315 Bacteria 6488
250 Ga0495604_0001652 3300047317 Bacteria 18342
251 Ga0495604_0020983 3300047317 Unclassified 5213
252 Ga0495604_0038155 3300047317 Unclassified 3780
253 Ga0495604_0105323 3300047317 Bacteria 2064
254 Ga0495674_0066297 3300047319 Unclassified 3133
255 Ga0495674_0066467 3300047319 Bacteria 3128
256 Ga0495674_0083237 3300047319 Unclassified 2743
257 Ga0495674_0090174 3300047319 Bacteria 2620
258 Ga0495676_0103042 3300047321 Unclassified 2108
259 Ga0495680_0000068 3300047322 Bacteria 89135
260 Ga0495680_0000096 3300047322 Bacteria 79944
261 Ga0495680_0021891 3300047322 Bacteria 5341
262 Ga0495675_0000169 3300047444 Bacteria 47184
263 Ga0495675_0022203 3300047444 Unclassified 4044
264 Ga0495675_0096049 3300047444 Unclassified 1858
265 Ga0495684_0005408 3300047471 Bacteria 9942
266 Ga0495684_0007939 3300047471 Bacteria 8209
267 Ga0495684_0017258 3300047471 Bacteria 5556
268 Ga0495593_0013347 3300047673 Bacteria 4688
269 Ga0495602_0059020 3300048088 Unclassified 3352
270 Ga0495614_0017005 3300048089 Bacteria 3161
271 Ga0496109_0000292 3300048912 Bacteria 47514
272 Ga0496111_0101915 3300048914 Bacteria 2110
273 Ga0496115_0007029 3300048918 Bacteria 8271
274 Ga0496115_0055268 3300048918 Bacteria 3189
275 Ga0496115_0138260 3300048918 Bacteria 2009
276 Ga0501039_0048592 3300049575 Archaea 3280
277 Ga0501039_0096278 3300049575 Bacteria 2308
278 Ga0501075_0003861 3300049591 Archaea 10094
279 Ga0501079_0038800 3300049741 Archaea 3673
280 Ga0501081_0007371 3300049743 Archaea 7140
281 nmdc:mga05p37_400785_c1 3300050507 Bacteria 1602
282 nmdc:mga09592_37628_c1 3300050508 Bacteria 4059
283 nmdc:mga09592_90346_c1 3300050508 Bacteria 2616
284 nmdc:mga06r32_28449_c1 3300050510 Bacteria 5230
285 nmdc:mga06r32_60978_c1 3300050510 Bacteria 3630
286 nmdc:mga08y16_12214_c1 3300050511 Bacteria 9025
287 nmdc:mga08y16_19631_c1 3300050511 Bacteria 7127
288 nmdc:mga08y16_547052_c1 3300050511 Bacteria 1172
289 nmdc:mga0n895_16025_c1 3300050512 Bacteria 6865
290 nmdc:mga0n895_3502_c1 3300050512 Bacteria 12674
291 nmdc:mga0n895_54906_c1 3300050512 Bacteria 3919
292 nmdc:mga0rr50_15293_c1 3300050513 Bacteria 5062
293 nmdc:mga0rr50_202107_c1 3300050513 Bacteria 1633
294 nmdc:mga08x19_32306_c1 3300050514 Bacteria 3296
295 nmdc:mga08x19_37981_c1 3300050514 Archaea 3058
296 nmdc:mga0a205_12718_c1 3300050515 Bacteria 7800
297 nmdc:mga0a205_132358_c1 3300050515 Bacteria 2394
298 nmdc:mga0a205_39500_c1 3300050515 Bacteria 4542
299 Ga0495612_0008731 3300053078 Bacteria 4110
300 Ga0495595_0117525 3300053084 Unclassified 1294
301 Ga0495619_0003638 3300053085 Bacteria 9929
302 Ga0501084_0313349 3300054114 Bacteria 1325
303 Ga0501082_0000052 3300060353 Bacteria 83141
304 Ga0501082_0006783 3300060353 Archaea 9896
305 Ga0265338_10151696
306 Ga0070692_10024988
307 Ga0070669_100002919
308 Ga0070671_100132907
309 Ga0070709_10017635
310 Ga0070709_10036240
311 Ga0070709_10181679
312 Ga0070709_10246400
313 Ga0070714_100218172
314 Ga0070714_100300650
315 Ga0070713_100038467
316 Ga0070713_100047041
317 Ga0070713_100089253
318 Ga0070713_100215880
319 Ga0070710_10070197
320 Ga0070701_10024411
321 Ga0070711_100052158
322 Ga0070711_100089461
323 Ga0070711_100128001
324 Ga0070705_100088226
325 Ga0070708_100079394
326 Ga0070678_100065504
327 Ga0070681_10004696
328 Ga0070706_100095505
329 Ga0070707_100000031
330 Ga0070707_100006797
331 Ga0070707_100009356
332 Ga0070707_100103282
333 Ga0070698_100055146
334 Ga0070698_100063410
335 Ga0070698_100316570
336 Ga0070699_100100896
337 Ga0070697_100268596
338 Ga0070695_100045259
339 Ga0070665_100003010
340 Ga0068859_100339075
341 Ga0068863_100010229
342 Ga0068858_100064937
343 Ga0068862_100102457
344 Ga0081455_10008627
345 Ga0081455_10021728
346 Ga0081539_10000494
347 Ga0081539_10072389
348 Ga0070717_10040876
349 Ga0070712_100043186
350 Ga0097621_100039553
351 Ga0068871_100001278
352 Ga0075428_100013979
353 Ga0075428_100101853
354 Ga0075428_100355600
355 Ga0075430_100179443
356 Ga0075430_100373870
357 Ga0075431_100079062
358 Ga0075431_100290455
359 Ga0075433_10011405
360 Ga0075433_10031263
361 Ga0075433_10117182
362 Ga0075434_100000527
363 Ga0075434_100006816
364 Ga0075434_100078972
365 Ga0075436_100025537
366 Ga0075436_100099175
367 Ga0097620_100339074
368 Ga0075435_100016329
369 Ga0099794_10005531
370 Ga0105240_10012563
371 Ga0105240_10069565
372 Ga0111539_10002668
373 Ga0114129_10008808
374 Ga0114129_10096576
375 Ga0105243_10086568
376 Ga0105242_10224881
377 Ga0157373_10234658
378 Ga0157374_10071818
379 Ga0157378_10003816
380 Ga0157378_10005703
381 Ga0157375_10076526
382 Ga0157379_10117000
383 Ga0157376_10000004
384 Ga0157376_10002854
385 Ga0228598_1001648
386 Ga0207692_10008834
387 Ga0207692_10013410
388 Ga0207699_10025727
389 Ga0207699_10116542
390 Ga0207705_10004576
391 Ga0207684_10104096
392 Ga0207684_10194311
393 Ga0207707_10008333
394 Ga0207695_10053722
395 Ga0207695_10197859
396 Ga0207693_10046843
397 Ga0207663_10009316
398 Ga0207663_10028616
399 Ga0207663_10034782
400 Ga0207646_10000012
401 Ga0207646_10000046
402 Ga0207646_10004238
403 Ga0207646_10076221
404 Ga0207687_10080289
405 Ga0207700_10001548
406 Ga0207700_10092996
407 Ga0207664_10043736
408 Ga0207664_10323401
409 Ga0207665_10006643
410 Ga0207665_10033074
411 Ga0207711_10124035
412 Ga0207667_10087004
413 Ga0207640_10184618
414 Ga0207703_10285448
415 Ga0207708_10083064
416 Ga0207641_10025119
417 Ga0207641_10216689
418 Ga0207683_10087637
419 Ga0207428_10002609
420 Ga0207428_10007573
421 Ga0268266_10000470
422 Ga0265337_1043419
423 Ga0265326_10000233
424 Ga0265326_10000234
425 Ga0265319_1000970
426 Ga0265334_10000746
427 Ga0265318_10000424
428 Ga0265322_10000018
429 Ga0265336_10000035
430 Ga0265336_10000817
431 Ga0265338_10000361
432 Ga0265338_10000362
433 Ga0265338_10006280
434 Ga0265338_10021761
435 Ga0265338_10052701
436 Ga0265324_10000463
437 Ga0265324_10000655
438 Ga0265332_10002602
439 Ga0265332_10006469
440 Ga0265328_10056216
441 Ga0265320_10000131
442 Ga0265320_10006778
443 Ga0265325_10000528
444 Ga0265325_10004101
445 Ga0265325_10005365
446 Ga0265325_10051070
447 Ga0265329_10006292
448 Ga0265340_10000978
449 Ga0265340_10000980
450 Ga0265340_10002645
451 Ga0265340_10023569
452 Ga0265339_10000642
453 Ga0265339_10005286
454 Ga0265339_10042405
455 Ga0265331_10000016
456 Ga0265331_10000246
457 Ga0265331_10000890
458 Ga0265331_10003861
459 Ga0265331_10049358
460 Ga0265316_10000602
461 Ga0265316_10003098
462 Ga0265316_10006470
463 Ga0265316_10007613
464 Ga0265316_10039576
465 Ga0265316_10062693
466 Ga0307408_100266269
467 Ga0265313_10001486
468 Ga0265314_10001616
469 Ga0265314_10020331
470 Ga0265342_10000218
471 Ga0265342_10034981
472 Ga0307405_10216731
473 Ga0307410_10005178
474 Ga0307407_10165299
475 Ga0307409_100020613
476 Ga0307416_100042102
477 Ga0307411_10133321
478 Ga0307415_100054866
479 Ga0307415_100131157
480 Ga0316593_10026724
481 Ga0373939_0009963
482 Ga0373954_0060955
483 Ga0373960_0034965
484 Ga0373931_0066453
485 Ga0373935_0032180
486 Ga0373947_0024015
487 Ga0373937_0041127
488 Ga0373937_0053719
489 Ga0395900_0024683
490 Ga0395900_0177602
491 Ga0395905_0001373
492 Ga0395905_0155582
493 Ga0395905_0417066
494 Ga0395901_0003598
495 Ga0395901_0130038
496 Ga0395901_0138068
497 Ga0436363_0224992
498 Ga0451577_0085296
499 Ga0451577_0268751
500 Ga0453683_0011305
501 Ga0453684_0027949
502 Ga0451576_0008447
503 Ga0451576_0009712
504 Ga0451576_0407816
505 Ga0495592_0007262
506 Ga0495603_0018086
507 Ga0495629_0000006
508 Ga0495651_0000132
509 Ga0495651_0003699
510 Ga0495651_0009783
511 Ga0495653_0002178
512 Ga0495653_0030213
513 Ga0495580_0007808
514 Ga0495582_0038665
515 Ga0495639_0007146
516 Ga0495639_0057547
517 Ga0495662_0018989
518 Ga0495594_0005608
519 Ga0495594_0080879
520 Ga0495608_0043203
521 Ga0495618_0065301
522 Ga0495628_0000278
523 Ga0495628_0374934
524 Ga0495630_0014659
525 Ga0495630_0024161
526 Ga0495666_0008362
527 Ga0495652_0001155
528 Ga0495652_0023471
529 Ga0495652_0149474
530 Ga0495665_0066909
531 Ga0495587_0001436
532 Ga0495667_0008760
533 Ga0495667_0014061
534 Ga0495634_0051222
535 Ga0495634_0117213
536 Ga0495635_0008581
537 Ga0495635_0025627
538 Ga0495635_0030693
539 Ga0495588_0019872
540 Ga0495657_0036562
541 Ga0495657_0056343
542 Ga0495657_0178880
543 Ga0495623_0036146
544 Ga0495646_0022275
545 Ga0495646_0099999
546 Ga0495647_0023792
547 Ga0495658_0000739
548 Ga0495613_0002121
549 Ga0495613_0036024
550 Ga0495624_0023217
551 Ga0495624_0069799
552 Ga0495600_0003416
553 Ga0495581_0007095
554 Ga0495604_0001652
555 Ga0495604_0020983
556 Ga0495604_0038155
557 Ga0495604_0105323
558 Ga0495674_0066297
559 Ga0495674_0066467
560 Ga0495674_0083237
561 Ga0495674_0090174
562 Ga0495676_0103042
563 Ga0495680_0000068
564 Ga0495680_0000096
565 Ga0495680_0021891
566 Ga0495675_0000169
567 Ga0495675_0022203
568 Ga0495675_0096049
569 Ga0495684_0005408
570 Ga0495684_0007939
571 Ga0495684_0017258
572 Ga0495593_0013347
573 Ga0495602_0059020
574 Ga0495614_0017005
575 Ga0496109_0000292
576 Ga0496111_0101915
577 Ga0496115_0007029
578 Ga0496115_0055268
579 Ga0496115_0138260
580 Ga0501039_0048592
581 Ga0501039_0096278
582 Ga0501075_0003861
583 Ga0501079_0038800
584 Ga0501081_0007371
585 nmdc:mga05p37_400785_c1
586 nmdc:mga09592_37628_c1
587 nmdc:mga09592_90346_c1
588 nmdc:mga06r32_28449_c1
589 nmdc:mga06r32_60978_c1
590 nmdc:mga08y16_12214_c1
591 nmdc:mga08y16_19631_c1
592 nmdc:mga08y16_547052_c1
593 nmdc:mga0n895_16025_c1
594 nmdc:mga0n895_3502_c1
595 nmdc:mga0n895_54906_c1
596 nmdc:mga0rr50_15293_c1
597 nmdc:mga0rr50_202107_c1
598 nmdc:mga08x19_32306_c1
599 nmdc:mga08x19_37981_c1
600 nmdc:mga0a205_12718_c1
601 nmdc:mga0a205_132358_c1
602 nmdc:mga0a205_39500_c1
603 Ga0495612_0008731
604 Ga0495595_0117525
605 Ga0495619_0003638
606 Ga0501084_0313349
607 Ga0501082_0000052
608 Ga0501082_0006783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

8

71

0.98

PF01556

DnaJ_C

DnaJ C terminal domain

131

326

0.97

PF00684

DnaJ_CXXCXGXG

DnaJ central domain

158

210

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rzy-assembly2.cif.gz_B plasmodium falciparum pfa0660w hsp40 co-chaperone j-domain 0.9589 4 67
5nro-assembly1.cif.gz_B structure of full-length dnak with bound j-domain 0.9588 4 64
3apq-assembly1.cif.gz_A crystal structure of j-trx1 fragment of erdj5 0.9504 4 72
3apq-assembly2.cif.gz_B crystal structure of j-trx1 fragment of erdj5 0.9499 4 72
5ayl-assembly1.cif.gz_A crystal structure of erdj5 form ii 0.9447 4 73
ID Description Score Start End Superfamily
af_I1LJ46_11_102_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9935 5 70 1.10.287.110
af_I1LP50_1_90_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9923 5 70 1.10.287.110
af_Q54YH7_8_119_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9798 4 68 1.10.287.110
af_Q55D57_37_119_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9789 4 68 1.10.287.110
af_A0A0R0EVG5_46_123_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9687 1 68 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A7S3CC44-F1-model_v4 J domain-containing protein 0.9767 4 71 GO:0005783
GO:0036503
GO:0051087
GO:0051787
AF-A0A6G7RSU1-F1-model_v4 Chaperone DnaJ C-terminal domain-containing protein 0.962 109 309 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A7S3C9R4-F1-model_v4 Chaperone DnaJ C-terminal domain-containing protein 0.9579 171 309 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A6G3VHS8-F1-model_v4 deleted 0.9538 216 295
AF-A0A7C0U482-F1-model_v4 J domain-containing protein 0.9508 209 309 GO:0005737
GO:0042026
GO:0051082
GO:0051085

Map