F397648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 219 | 299 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300031239|Ga0265328_10004615|Ga0265328_100046155 |
| Length | 138 |
| Sequence | MTGGAAEFGDNPPHRRMGGELMAYMLLIVEPAGQRTTRTESEGRALYERMLRFSAELQSRGVLKLAQSLKTDTVGARVRRDGDKSSVVDGPFAEAKEMIGGFFLLECDTRSEAIAIARECPAAEWATVEVRELGPCFE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 2 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 3 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 4 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 5 | 2941479691 | |||
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 68 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 110 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 111 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 112 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 116 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 119 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 129 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 130 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 131 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 138 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 139 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 140 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 141 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 142 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 143 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 144 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 145 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 146 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 147 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 148 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 149 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 197 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 198 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 199 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 200 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 201 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 202 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 203 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 204 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 205 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 206 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 207 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 215 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 216 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 217 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 218 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 219 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.37 |
| Metatranscriptomes | 0.99 |
| Isolates | 1.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.96 |
| Nodule | 0 |
| Rhizoplane | 2.96 |
| Rhizosphere | 81.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10058199 | 3300002077 | Bacteria | 708 |
| 2 | rootH1_10388109 | 3300003323 | Unclassified | 1753 |
| 3 | Ga0058863_11299941 | 3300004799 | Unclassified | 545 |
| 4 | Ga0058861_11859955 | 3300004800 | Bacteria | 1590 |
| 5 | Ga0058862_12767649 | 3300004803 | Bacteria | 1967 |
| 6 | Ga0065714_10416524 | 3300005288 | Bacteria | 578 |
| 7 | Ga0070683_100023239 | 3300005329 | Bacteria | 5544 |
| 8 | Ga0070683_100617153 | 3300005329 | Unclassified | 1038 |
| 9 | Ga0070690_100538262 | 3300005330 | Bacteria | 879 |
| 10 | Ga0070670_102027595 | 3300005331 | Bacteria | 530 |
| 11 | Ga0068869_100088832 | 3300005334 | Bacteria | 2320 |
| 12 | Ga0068869_100484561 | 3300005334 | Bacteria | 1030 |
| 13 | Ga0068869_100569986 | 3300005334 | Bacteria | 953 |
| 14 | Ga0070666_10112657 | 3300005335 | Bacteria | 1882 |
| 15 | Ga0070680_100036515 | 3300005336 | Bacteria | 3970 |
| 16 | Ga0070682_100719586 | 3300005337 | Unclassified | 802 |
| 17 | Ga0068868_100187753 | 3300005338 | Bacteria | 1718 |
| 18 | Ga0070668_100148910 | 3300005347 | Bacteria | 1891 |
| 19 | Ga0070669_100603931 | 3300005353 | Bacteria | 919 |
| 20 | Ga0070675_100359660 | 3300005354 | Bacteria | 1292 |
| 21 | Ga0070671_100062432 | 3300005355 | Bacteria | 3102 |
| 22 | Ga0070671_101272368 | 3300005355 | Bacteria | 648 |
| 23 | Ga0070659_100654269 | 3300005366 | Unclassified | 906 |
| 24 | Ga0070667_100000068 | 3300005367 | Bacteria | 127663 |
| 25 | Ga0070667_100440210 | 3300005367 | Bacteria | 1190 |
| 26 | Ga0070667_100727985 | 3300005367 | Bacteria | 919 |
| 27 | Ga0070714_100846320 | 3300005435 | Bacteria | 887 |
| 28 | Ga0070713_100053256 | 3300005436 | Bacteria | 3353 |
| 29 | Ga0070710_10281604 | 3300005437 | Bacteria | 1079 |
| 30 | Ga0070711_100206262 | 3300005439 | Bacteria | 1519 |
| 31 | Ga0070663_100769164 | 3300005455 | Bacteria | 824 |
| 32 | Ga0070678_100809537 | 3300005456 | Bacteria | 851 |
| 33 | Ga0070678_101187289 | 3300005456 | Bacteria | 707 |
| 34 | Ga0070681_10105250 | 3300005458 | Bacteria | 2764 |
| 35 | Ga0070679_100258360 | 3300005530 | Unclassified | 1697 |
| 36 | Ga0070684_100051456 | 3300005535 | Bacteria | 3578 |
| 37 | Ga0070672_100593827 | 3300005543 | Bacteria | 964 |
| 38 | Ga0070672_100648235 | 3300005543 | Bacteria | 922 |
| 39 | Ga0070665_100034144 | 3300005548 | Bacteria | 5115 |
| 40 | Ga0070665_100114583 | 3300005548 | Unclassified | 2698 |
| 41 | Ga0070665_101466181 | 3300005548 | Bacteria | 691 |
| 42 | Ga0068855_100012669 | 3300005563 | Bacteria | 10177 |
| 43 | Ga0068855_100084571 | 3300005563 | Bacteria | 3673 |
| 44 | Ga0068857_100239438 | 3300005577 | Bacteria | 1661 |
| 45 | Ga0068857_100346572 | 3300005577 | Bacteria | 1375 |
| 46 | Ga0068856_100171489 | 3300005614 | Bacteria | 2182 |
| 47 | Ga0068856_101342889 | 3300005614 | Bacteria | 730 |
| 48 | Ga0068859_100090494 | 3300005617 | Bacteria | 3111 |
| 49 | Ga0068859_100166092 | 3300005617 | Bacteria | 2287 |
| 50 | Ga0068864_100020426 | 3300005618 | Bacteria | 5541 |
| 51 | Ga0068864_100041325 | 3300005618 | Bacteria | 3944 |
| 52 | Ga0068870_10221096 | 3300005840 | Bacteria | 1159 |
| 53 | Ga0068863_100064087 | 3300005841 | Bacteria | 3476 |
| 54 | Ga0068863_100167329 | 3300005841 | Bacteria | 2108 |
| 55 | Ga0068858_101575846 | 3300005842 | Bacteria | 648 |
| 56 | Ga0068860_100003481 | 3300005843 | Bacteria | 16207 |
| 57 | Ga0068860_100052159 | 3300005843 | Bacteria | 3891 |
| 58 | Ga0068862_100351825 | 3300005844 | Bacteria | 1367 |
| 59 | Ga0081539_10018647 | 3300005985 | Bacteria | 4802 |
| 60 | Ga0097621_100083864 | 3300006237 | Bacteria | 2656 |
| 61 | Ga0068871_100089221 | 3300006358 | Bacteria | 2566 |
| 62 | Ga0068871_101104769 | 3300006358 | Bacteria | 741 |
| 63 | Ga0068865_100003486 | 3300006881 | Bacteria | 9431 |
| 64 | Ga0097620_100090493 | 3300006931 | Bacteria | 3111 |
| 65 | Ga0097620_100166095 | 3300006931 | Bacteria | 2287 |
| 66 | Ga0105240_10036132 | 3300009093 | Bacteria | 6358 |
| 67 | Ga0105240_10078755 | 3300009093 | Unclassified | 4057 |
| 68 | Ga0105240_10339582 | 3300009093 | Unclassified | 1707 |
| 69 | Ga0105245_10046747 | 3300009098 | Bacteria | 3867 |
| 70 | Ga0105247_10206182 | 3300009101 | Bacteria | 1324 |
| 71 | Ga0105242_10004834 | 3300009176 | Bacteria | 10430 |
| 72 | Ga0105248_10034472 | 3300009177 | Bacteria | 5660 |
| 73 | Ga0105237_10012083 | 3300009545 | Bacteria | 9120 |
| 74 | Ga0105237_10314005 | 3300009545 | Bacteria | 1570 |
| 75 | Ga0105237_12181809 | 3300009545 | Bacteria | 563 |
| 76 | Ga0105249_10050152 | 3300009553 | Bacteria | 3806 |
| 77 | Ga0105249_10383510 | 3300009553 | Bacteria | 1432 |
| 78 | Ga0099796_10474240 | 3300010159 | Unclassified | 559 |
| 79 | Ga0105239_12601393 | 3300010375 | Unclassified | 590 |
| 80 | Ga0157369_10420950 | 3300013105 | Bacteria | 1385 |
| 81 | Ga0157378_10000158 | 3300013297 | Bacteria | 64291 |
| 82 | Ga0163162_10010739 | 3300013306 | Bacteria | 8908 |
| 83 | Ga0163162_11748635 | 3300013306 | Bacteria | 710 |
| 84 | Ga0157372_11131642 | 3300013307 | Bacteria | 905 |
| 85 | Ga0157372_11388572 | 3300013307 | Bacteria | 810 |
| 86 | Ga0157375_10002359 | 3300013308 | Bacteria | 16317 |
| 87 | Ga0163163_10034983 | 3300014325 | Bacteria | 4870 |
| 88 | Ga0163163_10111543 | 3300014325 | Unclassified | 2764 |
| 89 | Ga0182008_10069501 | 3300014497 | Bacteria | 1732 |
| 90 | Ga0182008_10376425 | 3300014497 | Bacteria | 758 |
| 91 | Ga0157379_10131206 | 3300014968 | Bacteria | 2256 |
| 92 | Ga0157379_10511228 | 3300014968 | Bacteria | 1114 |
| 93 | Ga0157379_11433164 | 3300014968 | Unclassified | 670 |
| 94 | Ga0157376_10065300 | 3300014969 | Bacteria | 3072 |
| 95 | Ga0157376_10723878 | 3300014969 | Bacteria | 1002 |
| 96 | Ga0209676_1009369 | 3300025292 | Bacteria | 4231 |
| 97 | Ga0209050_1001219 | 3300025298 | Bacteria | 30024 |
| 98 | Ga0207680_10012177 | 3300025903 | Bacteria | 4374 |
| 99 | Ga0207680_10073118 | 3300025903 | Bacteria | 2131 |
| 100 | Ga0207654_10091833 | 3300025911 | Bacteria | 1852 |
| 101 | Ga0207707_10096946 | 3300025912 | Bacteria | 2577 |
| 102 | Ga0207695_10039732 | 3300025913 | Bacteria | 5054 |
| 103 | Ga0207695_10280146 | 3300025913 | Unclassified | 1561 |
| 104 | Ga0207695_10523080 | 3300025913 | Bacteria | 1068 |
| 105 | Ga0207671_10235241 | 3300025914 | Bacteria | 1438 |
| 106 | Ga0207663_10067866 | 3300025916 | Bacteria | 2289 |
| 107 | Ga0207660_10056666 | 3300025917 | Bacteria | 2804 |
| 108 | Ga0207652_10340550 | 3300025921 | Unclassified | 1354 |
| 109 | Ga0207694_10604312 | 3300025924 | Unclassified | 922 |
| 110 | Ga0207650_10199548 | 3300025925 | Bacteria | 1602 |
| 111 | Ga0207659_10561326 | 3300025926 | Bacteria | 971 |
| 112 | Ga0207687_10026703 | 3300025927 | Bacteria | 3868 |
| 113 | Ga0207700_10096579 | 3300025928 | Unclassified | 2346 |
| 114 | Ga0207690_10895144 | 3300025932 | Bacteria | 736 |
| 115 | Ga0207686_10671682 | 3300025934 | Bacteria | 821 |
| 116 | Ga0207711_10011142 | 3300025941 | Bacteria | 7473 |
| 117 | Ga0207711_10114973 | 3300025941 | Bacteria | 2397 |
| 118 | Ga0207689_10101940 | 3300025942 | Bacteria | 2358 |
| 119 | Ga0207689_11274136 | 3300025942 | Bacteria | 618 |
| 120 | Ga0207661_10042645 | 3300025944 | Bacteria | 3578 |
| 121 | Ga0207661_10440125 | 3300025944 | Unclassified | 1186 |
| 122 | Ga0207667_10030225 | 3300025949 | Bacteria | 5863 |
| 123 | Ga0207667_10298894 | 3300025949 | Bacteria | 1645 |
| 124 | Ga0207712_10519744 | 3300025961 | Bacteria | 1020 |
| 125 | Ga0207668_10417860 | 3300025972 | Bacteria | 1138 |
| 126 | Ga0207658_10000325 | 3300025986 | Bacteria | 48105 |
| 127 | Ga0207658_10323287 | 3300025986 | Bacteria | 1336 |
| 128 | Ga0207703_10958866 | 3300026035 | Bacteria | 820 |
| 129 | Ga0207703_11496469 | 3300026035 | Bacteria | 649 |
| 130 | Ga0207678_11074607 | 3300026067 | Bacteria | 712 |
| 131 | Ga0207702_10795822 | 3300026078 | Bacteria | 934 |
| 132 | Ga0207641_10021106 | 3300026088 | Bacteria | 5353 |
| 133 | Ga0207641_10046125 | 3300026088 | Bacteria | 3673 |
| 134 | Ga0207648_10373614 | 3300026089 | Bacteria | 1288 |
| 135 | Ga0207676_10022023 | 3300026095 | Bacteria | 4683 |
| 136 | Ga0207676_10103892 | 3300026095 | Bacteria | 2362 |
| 137 | Ga0207674_10250681 | 3300026116 | Bacteria | 1717 |
| 138 | Ga0207674_10715192 | 3300026116 | Bacteria | 967 |
| 139 | Ga0207674_10840282 | 3300026116 | Bacteria | 886 |
| 140 | Ga0207683_11512566 | 3300026121 | Bacteria | 620 |
| 141 | Ga0209371_1047778 | 3300027312 | Bacteria | 835 |
| 142 | Ga0268266_10000783 | 3300028379 | Bacteria | 42459 |
| 143 | Ga0268266_10051033 | 3300028379 | Bacteria | 3550 |
| 144 | Ga0268265_10066645 | 3300028380 | Bacteria | 2784 |
| 145 | Ga0268264_10006166 | 3300028381 | Bacteria | 10123 |
| 146 | Ga0268264_10075170 | 3300028381 | Bacteria | 2872 |
| 147 | Ga0265334_10035677 | 3300028573 | Bacteria | 1967 |
| 148 | Ga0307515_10006590 | 3300028794 | Bacteria | 23179 |
| 149 | Ga0265338_10592613 | 3300028800 | Bacteria | 773 |
| 150 | Ga0268256_1053829 | 3300030500 | Bacteria | 835 |
| 151 | Ga0307511_10000037 | 3300030521 | Bacteria | 103008 |
| 152 | Ga0307512_10178373 | 3300030522 | Bacteria | 1200 |
| 153 | Ga0265328_10004615 | 3300031239 | Bacteria | 5965 |
| 154 | Ga0265340_10061704 | 3300031247 | Bacteria | 1792 |
| 155 | Ga0265316_10343558 | 3300031344 | Bacteria | 1081 |
| 156 | Ga0307513_10023092 | 3300031456 | Bacteria | 7278 |
| 157 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 158 | Ga0307408_100030687 | 3300031548 | Bacteria | 3735 |
| 159 | Ga0307408_100433167 | 3300031548 | Bacteria | 1137 |
| 160 | Ga0307408_100436342 | 3300031548 | Bacteria | 1133 |
| 161 | Ga0307408_101269661 | 3300031548 | Bacteria | 689 |
| 162 | Ga0307514_10005618 | 3300031649 | Bacteria | 11112 |
| 163 | Ga0307516_10000056 | 3300031730 | Bacteria | 122840 |
| 164 | Ga0307405_10398635 | 3300031731 | Bacteria | 1076 |
| 165 | Ga0307413_10001880 | 3300031824 | Bacteria | 8293 |
| 166 | Ga0307410_10138083 | 3300031852 | Unclassified | 1799 |
| 167 | Ga0307406_10060495 | 3300031901 | Unclassified | 2442 |
| 168 | Ga0307407_10038893 | 3300031903 | Bacteria | 2640 |
| 169 | Ga0307412_10001185 | 3300031911 | Bacteria | 14849 |
| 170 | Ga0307412_10020652 | 3300031911 | Bacteria | 4011 |
| 171 | Ga0307412_10116479 | 3300031911 | Bacteria | 1917 |
| 172 | Ga0307412_10152063 | 3300031911 | Bacteria | 1709 |
| 173 | Ga0307412_10589225 | 3300031911 | Bacteria | 940 |
| 174 | Ga0307409_100022216 | 3300031995 | Bacteria | 4368 |
| 175 | Ga0307416_101452505 | 3300032002 | Unclassified | 791 |
| 176 | Ga0307416_102502763 | 3300032002 | Bacteria | 615 |
| 177 | Ga0307411_10058268 | 3300032005 | Bacteria | 2555 |
| 178 | Ga0307415_100002241 | 3300032126 | Bacteria | 9568 |
| 179 | Ga0307510_10265574 | 3300033180 | Bacteria | 1195 |
| 180 | Ga0373934_0084641 | 3300035086 | Bacteria | 1276 |
| 181 | Ga0373932_0147313 | 3300035112 | Bacteria | 805 |
| 182 | Ga0373956_0056744 | 3300035119 | Bacteria | 1769 |
| 183 | Ga0373931_0443345 | 3300035691 | Bacteria | 829 |
| 184 | Ga0395900_0953752 | 3300037418 | Bacteria | 779 |
| 185 | Ga0395905_0092096 | 3300037471 | Bacteria | 2842 |
| 186 | Ga0395905_0673790 | 3300037471 | Bacteria | 936 |
| 187 | Ga0439436_0015745 | 3300041404 | Bacteria | 2272 |
| 188 | Ga0439461_0161297 | 3300041410 | Bacteria | 584 |
| 189 | Ga0439466_0031675 | 3300041411 | Bacteria | 1807 |
| 190 | Ga0439465_0299882 | 3300041413 | Bacteria | 601 |
| 191 | Ga0439432_159495 | 3300042006 | Bacteria | 660 |
| 192 | Ga0439449_0000612 | 3300042007 | Bacteria | 13391 |
| 193 | Ga0450912_015755 | 3300042116 | Bacteria | 696 |
| 194 | Ga0439446_0052719 | 3300042156 | Bacteria | 1218 |
| 195 | Ga0439435_0207487 | 3300042436 | Bacteria | 648 |
| 196 | Ga0439464_0316057 | 3300042439 | Bacteria | 512 |
| 197 | Ga0451577_0005919 | 3300042876 | Bacteria | 12338 |
| 198 | Ga0466969_0000744 | 3300044656 | Bacteria | 17623 |
| 199 | Ga0466969_0009950 | 3300044656 | Bacteria | 5042 |
| 200 | Ga0466972_0207775 | 3300044658 | Bacteria | 916 |
| 201 | Ga0466965_0105661 | 3300044683 | Bacteria | 1443 |
| 202 | Ga0466966_0006478 | 3300044684 | Bacteria | 7749 |
| 203 | Ga0466966_0171141 | 3300044684 | Bacteria | 1320 |
| 204 | Ga0466961_0010479 | 3300044693 | Bacteria | 5913 |
| 205 | Ga0466961_0251167 | 3300044693 | Bacteria | 1086 |
| 206 | Ga0453684_0852182 | 3300044712 | Bacteria | 979 |
| 207 | Ga0466968_0060260 | 3300044735 | Bacteria | 1636 |
| 208 | Ga0466968_0578166 | 3300044735 | Bacteria | 565 |
| 209 | Ga0466970_0009001 | 3300044765 | Bacteria | 5036 |
| 210 | Ga0466970_0130119 | 3300044765 | Bacteria | 1382 |
| 211 | Ga0466970_0371869 | 3300044765 | Bacteria | 813 |
| 212 | Ga0466970_0518637 | 3300044765 | Bacteria | 687 |
| 213 | Ga0466957_0627447 | 3300044842 | Bacteria | 754 |
| 214 | Ga0466960_0156826 | 3300044901 | Bacteria | 1219 |
| 215 | Ga0466959_0005030 | 3300045049 | Bacteria | 8979 |
| 216 | Ga0466959_0017468 | 3300045049 | Bacteria | 5260 |
| 217 | Ga0466959_0035096 | 3300045049 | Bacteria | 3710 |
| 218 | Ga0466959_0139428 | 3300045049 | Bacteria | 1715 |
| 219 | Ga0451576_0009874 | 3300045051 | Bacteria | 11026 |
| 220 | Ga0466967_1599168 | 3300045976 | Bacteria | 649 |
| 221 | Ga0495629_0548034 | 3300046459 | Bacteria | 776 |
| 222 | Ga0495629_1023486 | 3300046459 | Bacteria | 537 |
| 223 | Ga0495580_0040589 | 3300046472 | Bacteria | 3323 |
| 224 | Ga0495582_0021867 | 3300046473 | Bacteria | 3499 |
| 225 | Ga0495582_0832814 | 3300046473 | Unclassified | 534 |
| 226 | Ga0495639_0129430 | 3300046475 | Bacteria | 1208 |
| 227 | Ga0495630_0818800 | 3300046517 | Bacteria | 711 |
| 228 | Ga0495648_0381934 | 3300046524 | Unclassified | 635 |
| 229 | Ga0495663_0059160 | 3300046525 | Bacteria | 1202 |
| 230 | Ga0495642_0042283 | 3300046528 | Bacteria | 1856 |
| 231 | Ga0495654_0104882 | 3300046530 | Bacteria | 1296 |
| 232 | Ga0495665_0049695 | 3300046531 | Bacteria | 2223 |
| 233 | Ga0495586_0108281 | 3300046535 | Bacteria | 1546 |
| 234 | Ga0495645_0529180 | 3300046543 | Bacteria | 733 |
| 235 | Ga0495656_0019050 | 3300046615 | Bacteria | 2644 |
| 236 | Ga0495661_0323375 | 3300046665 | Bacteria | 766 |
| 237 | Ga0495657_0368134 | 3300046675 | Bacteria | 849 |
| 238 | Ga0495647_0018339 | 3300046681 | Bacteria | 2490 |
| 239 | Ga0495658_0064556 | 3300046683 | Bacteria | 2109 |
| 240 | Ga0495613_0083638 | 3300046689 | Bacteria | 2318 |
| 241 | Ga0495670_0700277 | 3300046691 | Bacteria | 552 |
| 242 | Ga0495600_0505471 | 3300046809 | Bacteria | 742 |
| 243 | Ga0495636_0462575 | 3300047318 | Bacteria | 610 |
| 244 | Ga0495674_0205422 | 3300047319 | Bacteria | 1633 |
| 245 | Ga0495674_1125028 | 3300047319 | Unclassified | 597 |
| 246 | Ga0495676_1068982 | 3300047321 | Archaea | 514 |
| 247 | Ga0495680_0330922 | 3300047322 | Bacteria | 1064 |
| 248 | Ga0495677_0023025 | 3300047445 | Bacteria | 2261 |
| 249 | Ga0495685_040599 | 3300047447 | Bacteria | 1591 |
| 250 | Ga0495684_0113703 | 3300047471 | Bacteria | 2041 |
| 251 | Ga0495626_0092634 | 3300048091 | Bacteria | 1327 |
| 252 | Ga0496100_0708601 | 3300048903 | Bacteria | 786 |
| 253 | Ga0496101_0289720 | 3300048904 | Bacteria | 1281 |
| 254 | Ga0496102_0130390 | 3300048905 | Bacteria | 2353 |
| 255 | Ga0496104_0000058 | 3300048907 | Bacteria | 118768 |
| 256 | Ga0496104_0431272 | 3300048907 | Bacteria | 1230 |
| 257 | Ga0496104_1457991 | 3300048907 | Unclassified | 587 |
| 258 | Ga0496105_0000021 | 3300048908 | Bacteria | 164255 |
| 259 | Ga0496108_0453678 | 3300048911 | Bacteria | 1120 |
| 260 | Ga0496111_0854582 | 3300048914 | Bacteria | 657 |
| 261 | Ga0496116_0001634 | 3300048919 | Bacteria | 24666 |
| 262 | Ga0496116_0080879 | 3300048919 | Bacteria | 2016 |
| 263 | Ga0496117_0613104 | 3300048920 | Bacteria | 507 |
| 264 | Ga0496118_0013298 | 3300048921 | Bacteria | 7798 |
| 265 | Ga0496118_0067495 | 3300048921 | Bacteria | 2603 |
| 266 | Ga0496119_0103390 | 3300048922 | Bacteria | 1595 |
| 267 | Ga0496120_0004000 | 3300048923 | Bacteria | 12812 |
| 268 | Ga0496120_0327298 | 3300048923 | Bacteria | 694 |
| 269 | Ga0496121_0000211 | 3300048924 | Bacteria | 127602 |
| 270 | Ga0496121_0126473 | 3300048924 | Bacteria | 1920 |
| 271 | Ga0496122_0000021 | 3300048925 | Bacteria | 391363 |
| 272 | Ga0496122_0057909 | 3300048925 | Bacteria | 2873 |
| 273 | Ga0496122_0082057 | 3300048925 | Bacteria | 2241 |
| 274 | Ga0496122_0326957 | 3300048925 | Bacteria | 812 |
| 275 | Ga0496123_0000174 | 3300048926 | Bacteria | 130310 |
| 276 | Ga0496123_0014822 | 3300048926 | Bacteria | 6434 |
| 277 | Ga0496123_0425741 | 3300048926 | Bacteria | 597 |
| 278 | Ga0496124_0077032 | 3300048927 | Bacteria | 2751 |
| 279 | Ga0496124_0262659 | 3300048927 | Bacteria | 1269 |
| 280 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 281 | Ga0496125_0022549 | 3300048928 | Bacteria | 5841 |
| 282 | Ga0496125_0120861 | 3300048928 | Bacteria | 1869 |
| 283 | Ga0496125_0731836 | 3300048928 | Bacteria | 521 |
| 284 | Ga0496126_0111788 | 3300048929 | Bacteria | 2379 |
| 285 | Ga0496126_0298433 | 3300048929 | Bacteria | 1330 |
| 286 | Ga0501033_0387108 | 3300049570 | Bacteria | 976 |
| 287 | Ga0501038_1208436 | 3300049574 | Unclassified | 549 |
| 288 | Ga0501071_0981598 | 3300049587 | Bacteria | 652 |
| 289 | Ga0501072_1512363 | 3300049588 | Unclassified | 518 |
| 290 | Ga0501035_0303633 | 3300049822 | Bacteria | 1344 |
| 291 | Ga0501044_0089475 | 3300049823 | Bacteria | 3107 |
| 292 | Ga0495619_1103030 | 3300053085 | Unclassified | 528 |
| 293 | Ga0500572_139873 | 3300053111 | Bacteria | 788 |
| 294 | Ga0500614_138558 | 3300053123 | Unclassified | 727 |
| 295 | Ga0500642_0446421 | 3300053130 | Unclassified | 556 |
| 296 | Ga0500590_002156 | 3300053148 | Bacteria | 8560 |
| 297 | Ga0500636_0237695 | 3300053177 | Bacteria | 938 |
| 298 | Ga0500637_0030139 | 3300053178 | Bacteria | 3016 |
| 299 | Ga0500637_0085162 | 3300053178 | Unclassified | 1827 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_10131206 | Ga0157379_101312064 | 113 |
| 2 | iso_pu_bacteria | 2643221569 | 2643863370 | 113 |
| 3 | iso_pu_bacteria | 2643221594 | 2643978759 | 113 |
| 4 | iso_pu_bacteria | 2643221621 | 2644120197 | 113 |
| 5 | iso_pu_bacteria | 2808606395 | 2809036482 | 113 |
| 6 | iso_pu_bacteria | 2941479691 | 2941483387 | 113 |
| 7 | 3300006358 | Ga0068871_101104769 | Ga0068871_1011047692 | 114 |
| 8 | 3300010159 | Ga0099796_10474240 | Ga0099796_104742401 | 114 |
| 9 | 3300035112 | Ga0373932_0147313 | Ga0373932_0147313_40_384 | 114 |
| 10 | 3300035691 | Ga0373931_0443345 | Ga0373931_0443345_262_606 | 114 |
| 11 | 3300037471 | Ga0395905_0673790 | Ga0395905_0673790_205_549 | 114 |
| 12 | 3300044656 | Ga0466969_0009950 | Ga0466969_0009950_4444_4788 | 114 |
| 13 | 3300044658 | Ga0466972_0207775 | Ga0466972_0207775_304_648 | 114 |
| 14 | 3300044683 | Ga0466965_0105661 | Ga0466965_0105661_247_591 | 114 |
| 15 | 3300044684 | Ga0466966_0006478 | Ga0466966_0006478_3501_3845 | 114 |
| 16 | 3300044693 | Ga0466961_0010479 | Ga0466961_0010479_5027_5371 | 114 |
| 17 | 3300044712 | Ga0453684_0852182 | Ga0453684_0852182_395_739 | 114 |
| 18 | 3300044735 | Ga0466968_0060260 | Ga0466968_0060260_752_1096 | 114 |
| 19 | 3300044765 | Ga0466970_0009001 | Ga0466970_0009001_1701_2048 | 114 |
| 20 | 3300044765 | Ga0466970_0371869 | Ga0466970_0371869_233_577 | 114 |
| 21 | 3300044842 | Ga0466957_0627447 | Ga0466957_0627447_162_509 | 114 |
| 22 | 3300044901 | Ga0466960_0156826 | Ga0466960_0156826_638_982 | 114 |
| 23 | 3300045049 | Ga0466959_0005030 | Ga0466959_0005030_1441_1788 | 114 |
| 24 | 3300045049 | Ga0466959_0035096 | Ga0466959_0035096_666_1010 | 114 |
| 25 | 3300045051 | Ga0451576_0009874 | Ga0451576_0009874_5265_5609 | 114 |
| 26 | 3300045976 | Ga0466967_1599168 | Ga0466967_1599168_72_416 | 114 |
| 27 | 3300046459 | Ga0495629_1023486 | Ga0495629_1023486_64_408 | 114 |
| 28 | 3300046517 | Ga0495630_0818800 | Ga0495630_0818800_12_356 | 114 |
| 29 | 3300053111 | Ga0500572_139873 | Ga0500572_139873_216_560 | 114 |
| 30 | 3300053177 | Ga0500636_0237695 | Ga0500636_0237695_57_401 | 114 |
| 31 | 3300053178 | Ga0500637_0030139 | Ga0500637_0030139_2186_2530 | 114 |
| 32 | 3300005330 | Ga0070690_100538262 | Ga0070690_1005382621 | 115 |
| 33 | 3300005334 | Ga0068869_100484561 | Ga0068869_1004845612 | 115 |
| 34 | 3300005335 | Ga0070666_10112657 | Ga0070666_101126572 | 115 |
| 35 | 3300005367 | Ga0070667_100727985 | Ga0070667_1007279852 | 115 |
| 36 | 3300005439 | Ga0070711_100206262 | Ga0070711_1002062621 | 115 |
| 37 | 3300005455 | Ga0070663_100769164 | Ga0070663_1007691641 | 115 |
| 38 | 3300005456 | Ga0070678_100809537 | Ga0070678_1008095372 | 115 |
| 39 | 3300005577 | Ga0068857_100239438 | Ga0068857_1002394382 | 115 |
| 40 | 3300005843 | Ga0068860_100003481 | Ga0068860_10000348114 | 115 |
| 41 | 3300006881 | Ga0068865_100003486 | Ga0068865_1000034865 | 115 |
| 42 | 3300009176 | Ga0105242_10004834 | Ga0105242_1000483410 | 115 |
| 43 | 3300013306 | Ga0163162_10010739 | Ga0163162_100107399 | 115 |
| 44 | 3300013306 | Ga0163162_11748635 | Ga0163162_117486352 | 115 |
| 45 | 3300013308 | Ga0157375_10002359 | Ga0157375_1000235912 | 115 |
| 46 | 3300014497 | Ga0182008_10069501 | Ga0182008_100695012 | 115 |
| 47 | 3300014969 | Ga0157376_10065300 | Ga0157376_100653002 | 115 |
| 48 | 3300025903 | Ga0207680_10073118 | Ga0207680_100731183 | 115 |
| 49 | 3300025916 | Ga0207663_10067866 | Ga0207663_100678662 | 115 |
| 50 | 3300025934 | Ga0207686_10671682 | Ga0207686_106716822 | 115 |
| 51 | 3300026067 | Ga0207678_11074607 | Ga0207678_110746072 | 115 |
| 52 | 3300026089 | Ga0207648_10373614 | Ga0207648_103736141 | 115 |
| 53 | 3300026116 | Ga0207674_10250681 | Ga0207674_102506812 | 115 |
| 54 | 3300028381 | Ga0268264_10006166 | Ga0268264_100061662 | 115 |
| 55 | 3300035086 | Ga0373934_0084641 | Ga0373934_0084641_834_1184 | 115 |
| 56 | 3300035119 | Ga0373956_0056744 | Ga0373956_0056744_841_1191 | 115 |
| 57 | 3300046472 | Ga0495580_0040589 | Ga0495580_0040589_1154_1504 | 115 |
| 58 | 3300046473 | Ga0495582_0021867 | Ga0495582_0021867_1642_1992 | 115 |
| 59 | 3300046475 | Ga0495639_0129430 | Ga0495639_0129430_844_1194 | 115 |
| 60 | 3300046531 | Ga0495665_0049695 | Ga0495665_0049695_1411_1761 | 115 |
| 61 | 3300046535 | Ga0495586_0108281 | Ga0495586_0108281_633_983 | 115 |
| 62 | 3300046543 | Ga0495645_0529180 | Ga0495645_0529180_137_487 | 115 |
| 63 | 3300046675 | Ga0495657_0368134 | Ga0495657_0368134_308_658 | 115 |
| 64 | 3300046681 | Ga0495647_0018339 | Ga0495647_0018339_91_441 | 115 |
| 65 | 3300046683 | Ga0495658_0064556 | Ga0495658_0064556_505_855 | 115 |
| 66 | 3300046689 | Ga0495613_0083638 | Ga0495613_0083638_997_1347 | 115 |
| 67 | 3300046809 | Ga0495600_0505471 | Ga0495600_0505471_62_412 | 115 |
| 68 | 3300047319 | Ga0495674_0205422 | Ga0495674_0205422_47_397 | 115 |
| 69 | 3300047471 | Ga0495684_0113703 | Ga0495684_0113703_244_594 | 115 |
| 70 | 3300048907 | Ga0496104_0000058 | Ga0496104_0000058_84398_84748 | 115 |
| 71 | 3300048908 | Ga0496105_0000021 | Ga0496105_0000021_27472_27822 | 115 |
| 72 | 3300049587 | Ga0501071_0981598 | Ga0501071_0981598_26_418 | 115 |
| 73 | 3300049588 | Ga0501072_1512363 | Ga0501072_1512363_96_488 | 115 |
| 74 | 3300053085 | Ga0495619_1103030 | Ga0495619_1103030_165_515 | 115 |
| 75 | 3300053123 | Ga0500614_138558 | Ga0500614_138558_356_706 | 115 |
| 76 | 3300002077 | JGI24744J21845_10058199 | JGI24744J21845_100581992 | 117 |
| 77 | 3300003323 | rootH1_10388109 | rootH1_103881092 | 117 |
| 78 | 3300004799 | Ga0058863_11299941 | Ga0058863_112999411 | 117 |
| 79 | 3300004800 | Ga0058861_11859955 | Ga0058861_118599551 | 117 |
| 80 | 3300004803 | Ga0058862_12767649 | Ga0058862_127676493 | 117 |
| 81 | 3300005288 | Ga0065714_10416524 | Ga0065714_104165241 | 117 |
| 82 | 3300005329 | Ga0070683_100023239 | Ga0070683_1000232393 | 117 |
| 83 | 3300005329 | Ga0070683_100617153 | Ga0070683_1006171532 | 117 |
| 84 | 3300005331 | Ga0070670_102027595 | Ga0070670_1020275951 | 117 |
| 85 | 3300005334 | Ga0068869_100088832 | Ga0068869_1000888323 | 117 |
| 86 | 3300005334 | Ga0068869_100569986 | Ga0068869_1005699861 | 117 |
| 87 | 3300005336 | Ga0070680_100036515 | Ga0070680_1000365153 | 117 |
| 88 | 3300005337 | Ga0070682_100719586 | Ga0070682_1007195862 | 117 |
| 89 | 3300005338 | Ga0068868_100187753 | Ga0068868_1001877531 | 117 |
| 90 | 3300005347 | Ga0070668_100148910 | Ga0070668_1001489104 | 117 |
| 91 | 3300005353 | Ga0070669_100603931 | Ga0070669_1006039311 | 117 |
| 92 | 3300005354 | Ga0070675_100359660 | Ga0070675_1003596602 | 117 |
| 93 | 3300005355 | Ga0070671_100062432 | Ga0070671_1000624323 | 117 |
| 94 | 3300005355 | Ga0070671_101272368 | Ga0070671_1012723682 | 117 |
| 95 | 3300005366 | Ga0070659_100654269 | Ga0070659_1006542692 | 117 |
| 96 | 3300005367 | Ga0070667_100000068 | Ga0070667_10000006897 | 117 |
| 97 | 3300005367 | Ga0070667_100440210 | Ga0070667_1004402102 | 117 |
| 98 | 3300005435 | Ga0070714_100846320 | Ga0070714_1008463201 | 117 |
| 99 | 3300005436 | Ga0070713_100053256 | Ga0070713_1000532563 | 117 |
| 100 | 3300005437 | Ga0070710_10281604 | Ga0070710_102816042 | 117 |
| 101 | 3300005456 | Ga0070678_101187289 | Ga0070678_1011872892 | 117 |
| 102 | 3300005458 | Ga0070681_10105250 | Ga0070681_101052502 | 117 |
| 103 | 3300005530 | Ga0070679_100258360 | Ga0070679_1002583602 | 117 |
| 104 | 3300005535 | Ga0070684_100051456 | Ga0070684_1000514562 | 117 |
| 105 | 3300005543 | Ga0070672_100593827 | Ga0070672_1005938272 | 117 |
| 106 | 3300005543 | Ga0070672_100648235 | Ga0070672_1006482352 | 117 |
| 107 | 3300005548 | Ga0070665_100034144 | Ga0070665_1000341442 | 117 |
| 108 | 3300005548 | Ga0070665_100114583 | Ga0070665_1001145833 | 117 |
| 109 | 3300005548 | Ga0070665_101466181 | Ga0070665_1014661811 | 117 |
| 110 | 3300005563 | Ga0068855_100012669 | Ga0068855_1000126699 | 117 |
| 111 | 3300005563 | Ga0068855_100084571 | Ga0068855_1000845713 | 117 |
| 112 | 3300005577 | Ga0068857_100346572 | Ga0068857_1003465722 | 117 |
| 113 | 3300005614 | Ga0068856_100171489 | Ga0068856_1001714892 | 117 |
| 114 | 3300005614 | Ga0068856_101342889 | Ga0068856_1013428891 | 117 |
| 115 | 3300005617 | Ga0068859_100090494 | Ga0068859_1000904944 | 117 |
| 116 | 3300005617 | Ga0068859_100166092 | Ga0068859_1001660923 | 117 |
| 117 | 3300005618 | Ga0068864_100020426 | Ga0068864_1000204264 | 117 |
| 118 | 3300005618 | Ga0068864_100041325 | Ga0068864_1000413252 | 117 |
| 119 | 3300005840 | Ga0068870_10221096 | Ga0068870_102210962 | 117 |
| 120 | 3300005841 | Ga0068863_100064087 | Ga0068863_1000640874 | 117 |
| 121 | 3300005841 | Ga0068863_100167329 | Ga0068863_1001673293 | 117 |
| 122 | 3300005842 | Ga0068858_101575846 | Ga0068858_1015758462 | 117 |
| 123 | 3300005843 | Ga0068860_100052159 | Ga0068860_1000521593 | 117 |
| 124 | 3300005844 | Ga0068862_100351825 | Ga0068862_1003518252 | 117 |
| 125 | 3300005985 | Ga0081539_10018647 | Ga0081539_100186476 | 117 |
| 126 | 3300006237 | Ga0097621_100083864 | Ga0097621_1000838643 | 117 |
| 127 | 3300006358 | Ga0068871_100089221 | Ga0068871_1000892212 | 117 |
| 128 | 3300006931 | Ga0097620_100090493 | Ga0097620_1000904934 | 117 |
| 129 | 3300006931 | Ga0097620_100166095 | Ga0097620_1001660953 | 117 |
| 130 | 3300009093 | Ga0105240_10036132 | Ga0105240_100361326 | 117 |
| 131 | 3300009093 | Ga0105240_10078755 | Ga0105240_100787552 | 117 |
| 132 | 3300009093 | Ga0105240_10339582 | Ga0105240_103395821 | 117 |
| 133 | 3300009098 | Ga0105245_10046747 | Ga0105245_100467472 | 117 |
| 134 | 3300009101 | Ga0105247_10206182 | Ga0105247_102061822 | 117 |
| 135 | 3300009177 | Ga0105248_10034472 | Ga0105248_100344724 | 117 |
| 136 | 3300009545 | Ga0105237_10012083 | Ga0105237_100120837 | 117 |
| 137 | 3300009545 | Ga0105237_10314005 | Ga0105237_103140051 | 117 |
| 138 | 3300009545 | Ga0105237_12181809 | Ga0105237_121818092 | 117 |
| 139 | 3300009553 | Ga0105249_10050152 | Ga0105249_100501524 | 117 |
| 140 | 3300009553 | Ga0105249_10383510 | Ga0105249_103835102 | 117 |
| 141 | 3300010375 | Ga0105239_12601393 | Ga0105239_126013931 | 117 |
| 142 | 3300013105 | Ga0157369_10420950 | Ga0157369_104209502 | 117 |
| 143 | 3300013297 | Ga0157378_10000158 | Ga0157378_100001584 | 117 |
| 144 | 3300013307 | Ga0157372_11131642 | Ga0157372_111316421 | 117 |
| 145 | 3300013307 | Ga0157372_11388572 | Ga0157372_113885722 | 117 |
| 146 | 3300014325 | Ga0163163_10034983 | Ga0163163_100349838 | 117 |
| 147 | 3300014325 | Ga0163163_10111543 | Ga0163163_101115432 | 117 |
| 148 | 3300014497 | Ga0182008_10376425 | Ga0182008_103764252 | 117 |
| 149 | 3300014968 | Ga0157379_10511228 | Ga0157379_105112281 | 117 |
| 150 | 3300014968 | Ga0157379_11433164 | Ga0157379_114331642 | 117 |
| 151 | 3300014969 | Ga0157376_10723878 | Ga0157376_107238781 | 117 |
| 152 | 3300025292 | Ga0209676_1009369 | Ga0209676_10093694 | 117 |
| 153 | 3300025298 | Ga0209050_1001219 | Ga0209050_10012196 | 117 |
| 154 | 3300025903 | Ga0207680_10012177 | Ga0207680_100121774 | 117 |
| 155 | 3300025911 | Ga0207654_10091833 | Ga0207654_100918331 | 117 |
| 156 | 3300025912 | Ga0207707_10096946 | Ga0207707_100969463 | 117 |
| 157 | 3300025913 | Ga0207695_10039732 | Ga0207695_100397322 | 117 |
| 158 | 3300025913 | Ga0207695_10280146 | Ga0207695_102801461 | 117 |
| 159 | 3300025913 | Ga0207695_10523080 | Ga0207695_105230802 | 117 |
| 160 | 3300025914 | Ga0207671_10235241 | Ga0207671_102352412 | 117 |
| 161 | 3300025917 | Ga0207660_10056666 | Ga0207660_100566664 | 117 |
| 162 | 3300025921 | Ga0207652_10340550 | Ga0207652_103405502 | 117 |
| 163 | 3300025924 | Ga0207694_10604312 | Ga0207694_106043122 | 117 |
| 164 | 3300025925 | Ga0207650_10199548 | Ga0207650_101995483 | 117 |
| 165 | 3300025926 | Ga0207659_10561326 | Ga0207659_105613261 | 117 |
| 166 | 3300025927 | Ga0207687_10026703 | Ga0207687_100267036 | 117 |
| 167 | 3300025928 | Ga0207700_10096579 | Ga0207700_100965792 | 117 |
| 168 | 3300025932 | Ga0207690_10895144 | Ga0207690_108951441 | 117 |
| 169 | 3300025941 | Ga0207711_10011142 | Ga0207711_100111425 | 117 |
| 170 | 3300025941 | Ga0207711_10114973 | Ga0207711_101149732 | 117 |
| 171 | 3300025942 | Ga0207689_10101940 | Ga0207689_101019403 | 117 |
| 172 | 3300025942 | Ga0207689_11274136 | Ga0207689_112741361 | 117 |
| 173 | 3300025944 | Ga0207661_10042645 | Ga0207661_100426452 | 117 |
| 174 | 3300025944 | Ga0207661_10440125 | Ga0207661_104401253 | 117 |
| 175 | 3300025949 | Ga0207667_10030225 | Ga0207667_100302252 | 117 |
| 176 | 3300025949 | Ga0207667_10298894 | Ga0207667_102988942 | 117 |
| 177 | 3300025961 | Ga0207712_10519744 | Ga0207712_105197442 | 117 |
| 178 | 3300025972 | Ga0207668_10417860 | Ga0207668_104178601 | 117 |
| 179 | 3300025986 | Ga0207658_10000325 | Ga0207658_1000032537 | 117 |
| 180 | 3300025986 | Ga0207658_10323287 | Ga0207658_103232872 | 117 |
| 181 | 3300026035 | Ga0207703_10958866 | Ga0207703_109588662 | 117 |
| 182 | 3300026035 | Ga0207703_11496469 | Ga0207703_114964692 | 117 |
| 183 | 3300026078 | Ga0207702_10795822 | Ga0207702_107958222 | 117 |
| 184 | 3300026088 | Ga0207641_10021106 | Ga0207641_100211062 | 117 |
| 185 | 3300026088 | Ga0207641_10046125 | Ga0207641_100461255 | 117 |
| 186 | 3300026095 | Ga0207676_10022023 | Ga0207676_100220234 | 117 |
| 187 | 3300026095 | Ga0207676_10103892 | Ga0207676_101038922 | 117 |
| 188 | 3300026116 | Ga0207674_10715192 | Ga0207674_107151922 | 117 |
| 189 | 3300026116 | Ga0207674_10840282 | Ga0207674_108402821 | 117 |
| 190 | 3300026121 | Ga0207683_11512566 | Ga0207683_115125662 | 117 |
| 191 | 3300027312 | Ga0209371_1047778 | Ga0209371_10477781 | 117 |
| 192 | 3300028379 | Ga0268266_10000783 | Ga0268266_1000078320 | 117 |
| 193 | 3300028379 | Ga0268266_10051033 | Ga0268266_100510334 | 117 |
| 194 | 3300028380 | Ga0268265_10066645 | Ga0268265_100666453 | 117 |
| 195 | 3300028381 | Ga0268264_10075170 | Ga0268264_100751704 | 117 |
| 196 | 3300028573 | Ga0265334_10035677 | Ga0265334_100356773 | 117 |
| 197 | 3300028794 | Ga0307515_10006590 | Ga0307515_100065907 | 117 |
| 198 | 3300028800 | Ga0265338_10592613 | Ga0265338_105926132 | 117 |
| 199 | 3300030500 | Ga0268256_1053829 | Ga0268256_10538291 | 117 |
| 200 | 3300030521 | Ga0307511_10000037 | Ga0307511_1000003728 | 117 |
| 201 | 3300030522 | Ga0307512_10178373 | Ga0307512_101783731 | 117 |
| 202 | 3300031239 | Ga0265328_10004615 | Ga0265328_100046155 | 117 |
| 203 | 3300031247 | Ga0265340_10061704 | Ga0265340_100617043 | 117 |
| 204 | 3300031344 | Ga0265316_10343558 | Ga0265316_103435582 | 117 |
| 205 | 3300031456 | Ga0307513_10023092 | Ga0307513_100230927 | 117 |
| 206 | 3300031507 | Ga0307509_10000001 | Ga0307509_10000001412 | 117 |
| 207 | 3300031548 | Ga0307408_100030687 | Ga0307408_1000306872 | 117 |
| 208 | 3300031548 | Ga0307408_100433167 | Ga0307408_1004331671 | 117 |
| 209 | 3300031548 | Ga0307408_100436342 | Ga0307408_1004363422 | 117 |
| 210 | 3300031548 | Ga0307408_101269661 | Ga0307408_1012696611 | 117 |
| 211 | 3300031649 | Ga0307514_10005618 | Ga0307514_1000561810 | 117 |
| 212 | 3300031730 | Ga0307516_10000056 | Ga0307516_10000056117 | 117 |
| 213 | 3300031731 | Ga0307405_10398635 | Ga0307405_103986352 | 117 |
| 214 | 3300031824 | Ga0307413_10001880 | Ga0307413_100018808 | 117 |
| 215 | 3300031852 | Ga0307410_10138083 | Ga0307410_101380832 | 117 |
| 216 | 3300031901 | Ga0307406_10060495 | Ga0307406_100604952 | 117 |
| 217 | 3300031903 | Ga0307407_10038893 | Ga0307407_100388932 | 117 |
| 218 | 3300031911 | Ga0307412_10001185 | Ga0307412_1000118513 | 117 |
| 219 | 3300031911 | Ga0307412_10020652 | Ga0307412_100206524 | 117 |
| 220 | 3300031911 | Ga0307412_10116479 | Ga0307412_101164792 | 117 |
| 221 | 3300031911 | Ga0307412_10152063 | Ga0307412_101520633 | 117 |
| 222 | 3300031911 | Ga0307412_10589225 | Ga0307412_105892252 | 117 |
| 223 | 3300031995 | Ga0307409_100022216 | Ga0307409_1000222162 | 117 |
| 224 | 3300032002 | Ga0307416_101452505 | Ga0307416_1014525052 | 117 |
| 225 | 3300032002 | Ga0307416_102502763 | Ga0307416_1025027632 | 117 |
| 226 | 3300032005 | Ga0307411_10058268 | Ga0307411_100582682 | 117 |
| 227 | 3300032126 | Ga0307415_100002241 | Ga0307415_10000224110 | 117 |
| 228 | 3300033180 | Ga0307510_10265574 | Ga0307510_102655741 | 117 |
| 229 | 3300037418 | Ga0395900_0953752 | Ga0395900_0953752_392_745 | 117 |
| 230 | 3300037471 | Ga0395905_0092096 | Ga0395905_0092096_1340_1699 | 117 |
| 231 | 3300041404 | Ga0439436_0015745 | Ga0439436_0015745_1770_2123 | 117 |
| 232 | 3300041410 | Ga0439461_0161297 | Ga0439461_0161297_214_567 | 117 |
| 233 | 3300041411 | Ga0439466_0031675 | Ga0439466_0031675_1045_1398 | 117 |
| 234 | 3300041413 | Ga0439465_0299882 | Ga0439465_0299882_68_421 | 117 |
| 235 | 3300042006 | Ga0439432_159495 | Ga0439432_159495_261_614 | 117 |
| 236 | 3300042007 | Ga0439449_0000612 | Ga0439449_0000612_3217_3570 | 117 |
| 237 | 3300042116 | Ga0450912_015755 | Ga0450912_015755_49_402 | 117 |
| 238 | 3300042156 | Ga0439446_0052719 | Ga0439446_0052719_558_923 | 117 |
| 239 | 3300042436 | Ga0439435_0207487 | Ga0439435_0207487_28_381 | 117 |
| 240 | 3300042439 | Ga0439464_0316057 | Ga0439464_0316057_126_479 | 117 |
| 241 | 3300042876 | Ga0451577_0005919 | Ga0451577_0005919_2828_3181 | 117 |
| 242 | 3300044656 | Ga0466969_0000744 | Ga0466969_0000744_8983_9336 | 117 |
| 243 | 3300044684 | Ga0466966_0171141 | Ga0466966_0171141_112_465 | 117 |
| 244 | 3300044693 | Ga0466961_0251167 | Ga0466961_0251167_402_818 | 117 |
| 245 | 3300044735 | Ga0466968_0578166 | Ga0466968_0578166_43_396 | 117 |
| 246 | 3300044765 | Ga0466970_0130119 | Ga0466970_0130119_326_679 | 117 |
| 247 | 3300044765 | Ga0466970_0518637 | Ga0466970_0518637_310_663 | 117 |
| 248 | 3300045049 | Ga0466959_0017468 | Ga0466959_0017468_2920_3336 | 117 |
| 249 | 3300045049 | Ga0466959_0139428 | Ga0466959_0139428_952_1305 | 117 |
| 250 | 3300046459 | Ga0495629_0548034 | Ga0495629_0548034_266_619 | 117 |
| 251 | 3300046473 | Ga0495582_0832814 | Ga0495582_0832814_46_444 | 117 |
| 252 | 3300046524 | Ga0495648_0381934 | Ga0495648_0381934_23_376 | 117 |
| 253 | 3300046525 | Ga0495663_0059160 | Ga0495663_0059160_147_506 | 117 |
| 254 | 3300046528 | Ga0495642_0042283 | Ga0495642_0042283_1079_1438 | 117 |
| 255 | 3300046530 | Ga0495654_0104882 | Ga0495654_0104882_904_1260 | 117 |
| 256 | 3300046615 | Ga0495656_0019050 | Ga0495656_0019050_1308_1667 | 117 |
| 257 | 3300046665 | Ga0495661_0323375 | Ga0495661_0323375_360_713 | 117 |
| 258 | 3300046691 | Ga0495670_0700277 | Ga0495670_0700277_106_465 | 117 |
| 259 | 3300047318 | Ga0495636_0462575 | Ga0495636_0462575_130_489 | 117 |
| 260 | 3300047319 | Ga0495674_1125028 | Ga0495674_1125028_124_477 | 117 |
| 261 | 3300047321 | Ga0495676_1068982 | Ga0495676_1068982_73_426 | 117 |
| 262 | 3300047322 | Ga0495680_0330922 | Ga0495680_0330922_656_1009 | 117 |
| 263 | 3300047445 | Ga0495677_0023025 | Ga0495677_0023025_17_376 | 117 |
| 264 | 3300047447 | Ga0495685_040599 | Ga0495685_040599_742_1101 | 117 |
| 265 | 3300048091 | Ga0495626_0092634 | Ga0495626_0092634_286_642 | 117 |
| 266 | 3300048903 | Ga0496100_0708601 | Ga0496100_0708601_342_716 | 117 |
| 267 | 3300048904 | Ga0496101_0289720 | Ga0496101_0289720_708_1082 | 117 |
| 268 | 3300048905 | Ga0496102_0130390 | Ga0496102_0130390_163_537 | 117 |
| 269 | 3300048907 | Ga0496104_0431272 | Ga0496104_0431272_170_544 | 117 |
| 270 | 3300048907 | Ga0496104_1457991 | Ga0496104_1457991_173_526 | 117 |
| 271 | 3300048911 | Ga0496108_0453678 | Ga0496108_0453678_460_834 | 117 |
| 272 | 3300048914 | Ga0496111_0854582 | Ga0496111_0854582_92_466 | 117 |
| 273 | 3300048919 | Ga0496116_0001634 | Ga0496116_0001634_3409_3762 | 117 |
| 274 | 3300048919 | Ga0496116_0080879 | Ga0496116_0080879_1310_1663 | 117 |
| 275 | 3300048920 | Ga0496117_0613104 | Ga0496117_0613104_65_418 | 117 |
| 276 | 3300048921 | Ga0496118_0013298 | Ga0496118_0013298_5040_5393 | 117 |
| 277 | 3300048921 | Ga0496118_0067495 | Ga0496118_0067495_728_1081 | 117 |
| 278 | 3300048922 | Ga0496119_0103390 | Ga0496119_0103390_92_445 | 117 |
| 279 | 3300048923 | Ga0496120_0004000 | Ga0496120_0004000_10705_11058 | 117 |
| 280 | 3300048923 | Ga0496120_0327298 | Ga0496120_0327298_180_533 | 117 |
| 281 | 3300048924 | Ga0496121_0000211 | Ga0496121_0000211_21123_21476 | 117 |
| 282 | 3300048924 | Ga0496121_0126473 | Ga0496121_0126473_1090_1443 | 117 |
| 283 | 3300048925 | Ga0496122_0000021 | Ga0496122_0000021_343731_344084 | 117 |
| 284 | 3300048925 | Ga0496122_0057909 | Ga0496122_0057909_1258_1611 | 117 |
| 285 | 3300048925 | Ga0496122_0082057 | Ga0496122_0082057_49_402 | 117 |
| 286 | 3300048925 | Ga0496122_0326957 | Ga0496122_0326957_299_652 | 117 |
| 287 | 3300048926 | Ga0496123_0000174 | Ga0496123_0000174_95435_95788 | 117 |
| 288 | 3300048926 | Ga0496123_0014822 | Ga0496123_0014822_5527_5880 | 117 |
| 289 | 3300048926 | Ga0496123_0425741 | Ga0496123_0425741_47_400 | 117 |
| 290 | 3300048927 | Ga0496124_0077032 | Ga0496124_0077032_672_1025 | 117 |
| 291 | 3300048927 | Ga0496124_0262659 | Ga0496124_0262659_149_502 | 117 |
| 292 | 3300048928 | Ga0496125_0000005 | Ga0496125_0000005_159728_160081 | 117 |
| 293 | 3300048928 | Ga0496125_0022549 | Ga0496125_0022549_5221_5574 | 117 |
| 294 | 3300048928 | Ga0496125_0120861 | Ga0496125_0120861_969_1322 | 117 |
| 295 | 3300048928 | Ga0496125_0731836 | Ga0496125_0731836_60_416 | 117 |
| 296 | 3300048929 | Ga0496126_0111788 | Ga0496126_0111788_523_876 | 117 |
| 297 | 3300048929 | Ga0496126_0298433 | Ga0496126_0298433_551_904 | 117 |
| 298 | 3300049570 | Ga0501033_0387108 | Ga0501033_0387108_176_529 | 117 |
| 299 | 3300049574 | Ga0501038_1208436 | Ga0501038_1208436_184_537 | 117 |
| 300 | 3300049822 | Ga0501035_0303633 | Ga0501035_0303633_800_1153 | 117 |
| 301 | 3300049823 | Ga0501044_0089475 | Ga0501044_0089475_987_1340 | 117 |
| 302 | 3300053130 | Ga0500642_0446421 | Ga0500642_0446421_171_524 | 117 |
| 303 | 3300053148 | Ga0500590_002156 | Ga0500590_002156_2210_2563 | 117 |
| 304 | 3300053178 | Ga0500637_0085162 | Ga0500637_0085162_664_1062 | 117 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.9123 | 1 | 114 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.8833 | 1 | 114 |
| 4lbp-assembly1.cif.gz_A | 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone | 0.6946 | 1 | 113 |
| 1mwq-assembly1.cif.gz_A | structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine | 0.6826 | 1 | 115 |
| 2nzc-assembly1.cif.gz_C | the structure of uncharacterized protein tm1266 from thermotoga maritima. | 0.6736 | 2 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.9123 | 1 | 114 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.8833 | 1 | 114 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7533 | 1 | 114 | 3.30.70.1060 |
| af_P0AB55_1_98_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7005 | 1 | 115 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7002 | 1 | 114 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8SSE1-F1-model_v4 | deleted | 0.984 | 1 | 117 |
|
| AF-A0A6I2GU57-F1-model_v4 | Dehydrogenase | 0.9798 | 1 | 117 |
|
| AF-A0A2N8KZH9-F1-model_v4 | Dehydrogenase | 0.9767 | 2 | 117 |
|
| AF-A0A6N8SSE1-F1-model_v4 | deleted | 0.9758 | 1 | 117 |
|
| AF-B1Y0D2-F1-model_v4 | DGPFAETKE family protein | 0.9738 | 1 | 117 |
GO:0005829
GO:0006541 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar