F397648

General Info

Members Datasets Scaffolds Average Seq Length
304 219 299 118

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10004615|Ga0265328_100046155
Length 138
Sequence MTGGAAEFGDNPPHRRMGGELMAYMLLIVEPAGQRTTRTESEGRALYERMLRFSAELQSRGVLKLAQSLKTDTVGARVRRDGDKSSVVDGPFAEAKEMIGGFFLLECDTRSEAIAIARECPAAEWATVEVRELGPCFE

Samples

Sample ID Description Type Environment
1 2643221569 Achromobacter sp. Root565 Isolate Unclassified
2 2643221594 Achromobacter sp. Root170 Isolate Unclassified
3 2643221621 Achromobacter sp. Root83 Isolate Unclassified
4 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
5 2941479691
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
215 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
216 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
217 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
218 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 0.99
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 2.96
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 12.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10058199 3300002077 Bacteria 708
2 rootH1_10388109 3300003323 Unclassified 1753
3 Ga0058863_11299941 3300004799 Unclassified 545
4 Ga0058861_11859955 3300004800 Bacteria 1590
5 Ga0058862_12767649 3300004803 Bacteria 1967
6 Ga0065714_10416524 3300005288 Bacteria 578
7 Ga0070683_100023239 3300005329 Bacteria 5544
8 Ga0070683_100617153 3300005329 Unclassified 1038
9 Ga0070690_100538262 3300005330 Bacteria 879
10 Ga0070670_102027595 3300005331 Bacteria 530
11 Ga0068869_100088832 3300005334 Bacteria 2320
12 Ga0068869_100484561 3300005334 Bacteria 1030
13 Ga0068869_100569986 3300005334 Bacteria 953
14 Ga0070666_10112657 3300005335 Bacteria 1882
15 Ga0070680_100036515 3300005336 Bacteria 3970
16 Ga0070682_100719586 3300005337 Unclassified 802
17 Ga0068868_100187753 3300005338 Bacteria 1718
18 Ga0070668_100148910 3300005347 Bacteria 1891
19 Ga0070669_100603931 3300005353 Bacteria 919
20 Ga0070675_100359660 3300005354 Bacteria 1292
21 Ga0070671_100062432 3300005355 Bacteria 3102
22 Ga0070671_101272368 3300005355 Bacteria 648
23 Ga0070659_100654269 3300005366 Unclassified 906
24 Ga0070667_100000068 3300005367 Bacteria 127663
25 Ga0070667_100440210 3300005367 Bacteria 1190
26 Ga0070667_100727985 3300005367 Bacteria 919
27 Ga0070714_100846320 3300005435 Bacteria 887
28 Ga0070713_100053256 3300005436 Bacteria 3353
29 Ga0070710_10281604 3300005437 Bacteria 1079
30 Ga0070711_100206262 3300005439 Bacteria 1519
31 Ga0070663_100769164 3300005455 Bacteria 824
32 Ga0070678_100809537 3300005456 Bacteria 851
33 Ga0070678_101187289 3300005456 Bacteria 707
34 Ga0070681_10105250 3300005458 Bacteria 2764
35 Ga0070679_100258360 3300005530 Unclassified 1697
36 Ga0070684_100051456 3300005535 Bacteria 3578
37 Ga0070672_100593827 3300005543 Bacteria 964
38 Ga0070672_100648235 3300005543 Bacteria 922
39 Ga0070665_100034144 3300005548 Bacteria 5115
40 Ga0070665_100114583 3300005548 Unclassified 2698
41 Ga0070665_101466181 3300005548 Bacteria 691
42 Ga0068855_100012669 3300005563 Bacteria 10177
43 Ga0068855_100084571 3300005563 Bacteria 3673
44 Ga0068857_100239438 3300005577 Bacteria 1661
45 Ga0068857_100346572 3300005577 Bacteria 1375
46 Ga0068856_100171489 3300005614 Bacteria 2182
47 Ga0068856_101342889 3300005614 Bacteria 730
48 Ga0068859_100090494 3300005617 Bacteria 3111
49 Ga0068859_100166092 3300005617 Bacteria 2287
50 Ga0068864_100020426 3300005618 Bacteria 5541
51 Ga0068864_100041325 3300005618 Bacteria 3944
52 Ga0068870_10221096 3300005840 Bacteria 1159
53 Ga0068863_100064087 3300005841 Bacteria 3476
54 Ga0068863_100167329 3300005841 Bacteria 2108
55 Ga0068858_101575846 3300005842 Bacteria 648
56 Ga0068860_100003481 3300005843 Bacteria 16207
57 Ga0068860_100052159 3300005843 Bacteria 3891
58 Ga0068862_100351825 3300005844 Bacteria 1367
59 Ga0081539_10018647 3300005985 Bacteria 4802
60 Ga0097621_100083864 3300006237 Bacteria 2656
61 Ga0068871_100089221 3300006358 Bacteria 2566
62 Ga0068871_101104769 3300006358 Bacteria 741
63 Ga0068865_100003486 3300006881 Bacteria 9431
64 Ga0097620_100090493 3300006931 Bacteria 3111
65 Ga0097620_100166095 3300006931 Bacteria 2287
66 Ga0105240_10036132 3300009093 Bacteria 6358
67 Ga0105240_10078755 3300009093 Unclassified 4057
68 Ga0105240_10339582 3300009093 Unclassified 1707
69 Ga0105245_10046747 3300009098 Bacteria 3867
70 Ga0105247_10206182 3300009101 Bacteria 1324
71 Ga0105242_10004834 3300009176 Bacteria 10430
72 Ga0105248_10034472 3300009177 Bacteria 5660
73 Ga0105237_10012083 3300009545 Bacteria 9120
74 Ga0105237_10314005 3300009545 Bacteria 1570
75 Ga0105237_12181809 3300009545 Bacteria 563
76 Ga0105249_10050152 3300009553 Bacteria 3806
77 Ga0105249_10383510 3300009553 Bacteria 1432
78 Ga0099796_10474240 3300010159 Unclassified 559
79 Ga0105239_12601393 3300010375 Unclassified 590
80 Ga0157369_10420950 3300013105 Bacteria 1385
81 Ga0157378_10000158 3300013297 Bacteria 64291
82 Ga0163162_10010739 3300013306 Bacteria 8908
83 Ga0163162_11748635 3300013306 Bacteria 710
84 Ga0157372_11131642 3300013307 Bacteria 905
85 Ga0157372_11388572 3300013307 Bacteria 810
86 Ga0157375_10002359 3300013308 Bacteria 16317
87 Ga0163163_10034983 3300014325 Bacteria 4870
88 Ga0163163_10111543 3300014325 Unclassified 2764
89 Ga0182008_10069501 3300014497 Bacteria 1732
90 Ga0182008_10376425 3300014497 Bacteria 758
91 Ga0157379_10131206 3300014968 Bacteria 2256
92 Ga0157379_10511228 3300014968 Bacteria 1114
93 Ga0157379_11433164 3300014968 Unclassified 670
94 Ga0157376_10065300 3300014969 Bacteria 3072
95 Ga0157376_10723878 3300014969 Bacteria 1002
96 Ga0209676_1009369 3300025292 Bacteria 4231
97 Ga0209050_1001219 3300025298 Bacteria 30024
98 Ga0207680_10012177 3300025903 Bacteria 4374
99 Ga0207680_10073118 3300025903 Bacteria 2131
100 Ga0207654_10091833 3300025911 Bacteria 1852
101 Ga0207707_10096946 3300025912 Bacteria 2577
102 Ga0207695_10039732 3300025913 Bacteria 5054
103 Ga0207695_10280146 3300025913 Unclassified 1561
104 Ga0207695_10523080 3300025913 Bacteria 1068
105 Ga0207671_10235241 3300025914 Bacteria 1438
106 Ga0207663_10067866 3300025916 Bacteria 2289
107 Ga0207660_10056666 3300025917 Bacteria 2804
108 Ga0207652_10340550 3300025921 Unclassified 1354
109 Ga0207694_10604312 3300025924 Unclassified 922
110 Ga0207650_10199548 3300025925 Bacteria 1602
111 Ga0207659_10561326 3300025926 Bacteria 971
112 Ga0207687_10026703 3300025927 Bacteria 3868
113 Ga0207700_10096579 3300025928 Unclassified 2346
114 Ga0207690_10895144 3300025932 Bacteria 736
115 Ga0207686_10671682 3300025934 Bacteria 821
116 Ga0207711_10011142 3300025941 Bacteria 7473
117 Ga0207711_10114973 3300025941 Bacteria 2397
118 Ga0207689_10101940 3300025942 Bacteria 2358
119 Ga0207689_11274136 3300025942 Bacteria 618
120 Ga0207661_10042645 3300025944 Bacteria 3578
121 Ga0207661_10440125 3300025944 Unclassified 1186
122 Ga0207667_10030225 3300025949 Bacteria 5863
123 Ga0207667_10298894 3300025949 Bacteria 1645
124 Ga0207712_10519744 3300025961 Bacteria 1020
125 Ga0207668_10417860 3300025972 Bacteria 1138
126 Ga0207658_10000325 3300025986 Bacteria 48105
127 Ga0207658_10323287 3300025986 Bacteria 1336
128 Ga0207703_10958866 3300026035 Bacteria 820
129 Ga0207703_11496469 3300026035 Bacteria 649
130 Ga0207678_11074607 3300026067 Bacteria 712
131 Ga0207702_10795822 3300026078 Bacteria 934
132 Ga0207641_10021106 3300026088 Bacteria 5353
133 Ga0207641_10046125 3300026088 Bacteria 3673
134 Ga0207648_10373614 3300026089 Bacteria 1288
135 Ga0207676_10022023 3300026095 Bacteria 4683
136 Ga0207676_10103892 3300026095 Bacteria 2362
137 Ga0207674_10250681 3300026116 Bacteria 1717
138 Ga0207674_10715192 3300026116 Bacteria 967
139 Ga0207674_10840282 3300026116 Bacteria 886
140 Ga0207683_11512566 3300026121 Bacteria 620
141 Ga0209371_1047778 3300027312 Bacteria 835
142 Ga0268266_10000783 3300028379 Bacteria 42459
143 Ga0268266_10051033 3300028379 Bacteria 3550
144 Ga0268265_10066645 3300028380 Bacteria 2784
145 Ga0268264_10006166 3300028381 Bacteria 10123
146 Ga0268264_10075170 3300028381 Bacteria 2872
147 Ga0265334_10035677 3300028573 Bacteria 1967
148 Ga0307515_10006590 3300028794 Bacteria 23179
149 Ga0265338_10592613 3300028800 Bacteria 773
150 Ga0268256_1053829 3300030500 Bacteria 835
151 Ga0307511_10000037 3300030521 Bacteria 103008
152 Ga0307512_10178373 3300030522 Bacteria 1200
153 Ga0265328_10004615 3300031239 Bacteria 5965
154 Ga0265340_10061704 3300031247 Bacteria 1792
155 Ga0265316_10343558 3300031344 Bacteria 1081
156 Ga0307513_10023092 3300031456 Bacteria 7278
157 Ga0307509_10000001 3300031507 Bacteria 629324
158 Ga0307408_100030687 3300031548 Bacteria 3735
159 Ga0307408_100433167 3300031548 Bacteria 1137
160 Ga0307408_100436342 3300031548 Bacteria 1133
161 Ga0307408_101269661 3300031548 Bacteria 689
162 Ga0307514_10005618 3300031649 Bacteria 11112
163 Ga0307516_10000056 3300031730 Bacteria 122840
164 Ga0307405_10398635 3300031731 Bacteria 1076
165 Ga0307413_10001880 3300031824 Bacteria 8293
166 Ga0307410_10138083 3300031852 Unclassified 1799
167 Ga0307406_10060495 3300031901 Unclassified 2442
168 Ga0307407_10038893 3300031903 Bacteria 2640
169 Ga0307412_10001185 3300031911 Bacteria 14849
170 Ga0307412_10020652 3300031911 Bacteria 4011
171 Ga0307412_10116479 3300031911 Bacteria 1917
172 Ga0307412_10152063 3300031911 Bacteria 1709
173 Ga0307412_10589225 3300031911 Bacteria 940
174 Ga0307409_100022216 3300031995 Bacteria 4368
175 Ga0307416_101452505 3300032002 Unclassified 791
176 Ga0307416_102502763 3300032002 Bacteria 615
177 Ga0307411_10058268 3300032005 Bacteria 2555
178 Ga0307415_100002241 3300032126 Bacteria 9568
179 Ga0307510_10265574 3300033180 Bacteria 1195
180 Ga0373934_0084641 3300035086 Bacteria 1276
181 Ga0373932_0147313 3300035112 Bacteria 805
182 Ga0373956_0056744 3300035119 Bacteria 1769
183 Ga0373931_0443345 3300035691 Bacteria 829
184 Ga0395900_0953752 3300037418 Bacteria 779
185 Ga0395905_0092096 3300037471 Bacteria 2842
186 Ga0395905_0673790 3300037471 Bacteria 936
187 Ga0439436_0015745 3300041404 Bacteria 2272
188 Ga0439461_0161297 3300041410 Bacteria 584
189 Ga0439466_0031675 3300041411 Bacteria 1807
190 Ga0439465_0299882 3300041413 Bacteria 601
191 Ga0439432_159495 3300042006 Bacteria 660
192 Ga0439449_0000612 3300042007 Bacteria 13391
193 Ga0450912_015755 3300042116 Bacteria 696
194 Ga0439446_0052719 3300042156 Bacteria 1218
195 Ga0439435_0207487 3300042436 Bacteria 648
196 Ga0439464_0316057 3300042439 Bacteria 512
197 Ga0451577_0005919 3300042876 Bacteria 12338
198 Ga0466969_0000744 3300044656 Bacteria 17623
199 Ga0466969_0009950 3300044656 Bacteria 5042
200 Ga0466972_0207775 3300044658 Bacteria 916
201 Ga0466965_0105661 3300044683 Bacteria 1443
202 Ga0466966_0006478 3300044684 Bacteria 7749
203 Ga0466966_0171141 3300044684 Bacteria 1320
204 Ga0466961_0010479 3300044693 Bacteria 5913
205 Ga0466961_0251167 3300044693 Bacteria 1086
206 Ga0453684_0852182 3300044712 Bacteria 979
207 Ga0466968_0060260 3300044735 Bacteria 1636
208 Ga0466968_0578166 3300044735 Bacteria 565
209 Ga0466970_0009001 3300044765 Bacteria 5036
210 Ga0466970_0130119 3300044765 Bacteria 1382
211 Ga0466970_0371869 3300044765 Bacteria 813
212 Ga0466970_0518637 3300044765 Bacteria 687
213 Ga0466957_0627447 3300044842 Bacteria 754
214 Ga0466960_0156826 3300044901 Bacteria 1219
215 Ga0466959_0005030 3300045049 Bacteria 8979
216 Ga0466959_0017468 3300045049 Bacteria 5260
217 Ga0466959_0035096 3300045049 Bacteria 3710
218 Ga0466959_0139428 3300045049 Bacteria 1715
219 Ga0451576_0009874 3300045051 Bacteria 11026
220 Ga0466967_1599168 3300045976 Bacteria 649
221 Ga0495629_0548034 3300046459 Bacteria 776
222 Ga0495629_1023486 3300046459 Bacteria 537
223 Ga0495580_0040589 3300046472 Bacteria 3323
224 Ga0495582_0021867 3300046473 Bacteria 3499
225 Ga0495582_0832814 3300046473 Unclassified 534
226 Ga0495639_0129430 3300046475 Bacteria 1208
227 Ga0495630_0818800 3300046517 Bacteria 711
228 Ga0495648_0381934 3300046524 Unclassified 635
229 Ga0495663_0059160 3300046525 Bacteria 1202
230 Ga0495642_0042283 3300046528 Bacteria 1856
231 Ga0495654_0104882 3300046530 Bacteria 1296
232 Ga0495665_0049695 3300046531 Bacteria 2223
233 Ga0495586_0108281 3300046535 Bacteria 1546
234 Ga0495645_0529180 3300046543 Bacteria 733
235 Ga0495656_0019050 3300046615 Bacteria 2644
236 Ga0495661_0323375 3300046665 Bacteria 766
237 Ga0495657_0368134 3300046675 Bacteria 849
238 Ga0495647_0018339 3300046681 Bacteria 2490
239 Ga0495658_0064556 3300046683 Bacteria 2109
240 Ga0495613_0083638 3300046689 Bacteria 2318
241 Ga0495670_0700277 3300046691 Bacteria 552
242 Ga0495600_0505471 3300046809 Bacteria 742
243 Ga0495636_0462575 3300047318 Bacteria 610
244 Ga0495674_0205422 3300047319 Bacteria 1633
245 Ga0495674_1125028 3300047319 Unclassified 597
246 Ga0495676_1068982 3300047321 Archaea 514
247 Ga0495680_0330922 3300047322 Bacteria 1064
248 Ga0495677_0023025 3300047445 Bacteria 2261
249 Ga0495685_040599 3300047447 Bacteria 1591
250 Ga0495684_0113703 3300047471 Bacteria 2041
251 Ga0495626_0092634 3300048091 Bacteria 1327
252 Ga0496100_0708601 3300048903 Bacteria 786
253 Ga0496101_0289720 3300048904 Bacteria 1281
254 Ga0496102_0130390 3300048905 Bacteria 2353
255 Ga0496104_0000058 3300048907 Bacteria 118768
256 Ga0496104_0431272 3300048907 Bacteria 1230
257 Ga0496104_1457991 3300048907 Unclassified 587
258 Ga0496105_0000021 3300048908 Bacteria 164255
259 Ga0496108_0453678 3300048911 Bacteria 1120
260 Ga0496111_0854582 3300048914 Bacteria 657
261 Ga0496116_0001634 3300048919 Bacteria 24666
262 Ga0496116_0080879 3300048919 Bacteria 2016
263 Ga0496117_0613104 3300048920 Bacteria 507
264 Ga0496118_0013298 3300048921 Bacteria 7798
265 Ga0496118_0067495 3300048921 Bacteria 2603
266 Ga0496119_0103390 3300048922 Bacteria 1595
267 Ga0496120_0004000 3300048923 Bacteria 12812
268 Ga0496120_0327298 3300048923 Bacteria 694
269 Ga0496121_0000211 3300048924 Bacteria 127602
270 Ga0496121_0126473 3300048924 Bacteria 1920
271 Ga0496122_0000021 3300048925 Bacteria 391363
272 Ga0496122_0057909 3300048925 Bacteria 2873
273 Ga0496122_0082057 3300048925 Bacteria 2241
274 Ga0496122_0326957 3300048925 Bacteria 812
275 Ga0496123_0000174 3300048926 Bacteria 130310
276 Ga0496123_0014822 3300048926 Bacteria 6434
277 Ga0496123_0425741 3300048926 Bacteria 597
278 Ga0496124_0077032 3300048927 Bacteria 2751
279 Ga0496124_0262659 3300048927 Bacteria 1269
280 Ga0496125_0000005 3300048928 Bacteria 827598
281 Ga0496125_0022549 3300048928 Bacteria 5841
282 Ga0496125_0120861 3300048928 Bacteria 1869
283 Ga0496125_0731836 3300048928 Bacteria 521
284 Ga0496126_0111788 3300048929 Bacteria 2379
285 Ga0496126_0298433 3300048929 Bacteria 1330
286 Ga0501033_0387108 3300049570 Bacteria 976
287 Ga0501038_1208436 3300049574 Unclassified 549
288 Ga0501071_0981598 3300049587 Bacteria 652
289 Ga0501072_1512363 3300049588 Unclassified 518
290 Ga0501035_0303633 3300049822 Bacteria 1344
291 Ga0501044_0089475 3300049823 Bacteria 3107
292 Ga0495619_1103030 3300053085 Unclassified 528
293 Ga0500572_139873 3300053111 Bacteria 788
294 Ga0500614_138558 3300053123 Unclassified 727
295 Ga0500642_0446421 3300053130 Unclassified 556
296 Ga0500590_002156 3300053148 Bacteria 8560
297 Ga0500636_0237695 3300053177 Bacteria 938
298 Ga0500637_0030139 3300053178 Bacteria 3016
299 Ga0500637_0085162 3300053178 Unclassified 1827

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10131206 Ga0157379_101312064 113
2 iso_pu_bacteria 2643221569 2643863370 113
3 iso_pu_bacteria 2643221594 2643978759 113
4 iso_pu_bacteria 2643221621 2644120197 113
5 iso_pu_bacteria 2808606395 2809036482 113
6 iso_pu_bacteria 2941479691 2941483387 113
7 3300006358 Ga0068871_101104769 Ga0068871_1011047692 114
8 3300010159 Ga0099796_10474240 Ga0099796_104742401 114
9 3300035112 Ga0373932_0147313 Ga0373932_0147313_40_384 114
10 3300035691 Ga0373931_0443345 Ga0373931_0443345_262_606 114
11 3300037471 Ga0395905_0673790 Ga0395905_0673790_205_549 114
12 3300044656 Ga0466969_0009950 Ga0466969_0009950_4444_4788 114
13 3300044658 Ga0466972_0207775 Ga0466972_0207775_304_648 114
14 3300044683 Ga0466965_0105661 Ga0466965_0105661_247_591 114
15 3300044684 Ga0466966_0006478 Ga0466966_0006478_3501_3845 114
16 3300044693 Ga0466961_0010479 Ga0466961_0010479_5027_5371 114
17 3300044712 Ga0453684_0852182 Ga0453684_0852182_395_739 114
18 3300044735 Ga0466968_0060260 Ga0466968_0060260_752_1096 114
19 3300044765 Ga0466970_0009001 Ga0466970_0009001_1701_2048 114
20 3300044765 Ga0466970_0371869 Ga0466970_0371869_233_577 114
21 3300044842 Ga0466957_0627447 Ga0466957_0627447_162_509 114
22 3300044901 Ga0466960_0156826 Ga0466960_0156826_638_982 114
23 3300045049 Ga0466959_0005030 Ga0466959_0005030_1441_1788 114
24 3300045049 Ga0466959_0035096 Ga0466959_0035096_666_1010 114
25 3300045051 Ga0451576_0009874 Ga0451576_0009874_5265_5609 114
26 3300045976 Ga0466967_1599168 Ga0466967_1599168_72_416 114
27 3300046459 Ga0495629_1023486 Ga0495629_1023486_64_408 114
28 3300046517 Ga0495630_0818800 Ga0495630_0818800_12_356 114
29 3300053111 Ga0500572_139873 Ga0500572_139873_216_560 114
30 3300053177 Ga0500636_0237695 Ga0500636_0237695_57_401 114
31 3300053178 Ga0500637_0030139 Ga0500637_0030139_2186_2530 114
32 3300005330 Ga0070690_100538262 Ga0070690_1005382621 115
33 3300005334 Ga0068869_100484561 Ga0068869_1004845612 115
34 3300005335 Ga0070666_10112657 Ga0070666_101126572 115
35 3300005367 Ga0070667_100727985 Ga0070667_1007279852 115
36 3300005439 Ga0070711_100206262 Ga0070711_1002062621 115
37 3300005455 Ga0070663_100769164 Ga0070663_1007691641 115
38 3300005456 Ga0070678_100809537 Ga0070678_1008095372 115
39 3300005577 Ga0068857_100239438 Ga0068857_1002394382 115
40 3300005843 Ga0068860_100003481 Ga0068860_10000348114 115
41 3300006881 Ga0068865_100003486 Ga0068865_1000034865 115
42 3300009176 Ga0105242_10004834 Ga0105242_1000483410 115
43 3300013306 Ga0163162_10010739 Ga0163162_100107399 115
44 3300013306 Ga0163162_11748635 Ga0163162_117486352 115
45 3300013308 Ga0157375_10002359 Ga0157375_1000235912 115
46 3300014497 Ga0182008_10069501 Ga0182008_100695012 115
47 3300014969 Ga0157376_10065300 Ga0157376_100653002 115
48 3300025903 Ga0207680_10073118 Ga0207680_100731183 115
49 3300025916 Ga0207663_10067866 Ga0207663_100678662 115
50 3300025934 Ga0207686_10671682 Ga0207686_106716822 115
51 3300026067 Ga0207678_11074607 Ga0207678_110746072 115
52 3300026089 Ga0207648_10373614 Ga0207648_103736141 115
53 3300026116 Ga0207674_10250681 Ga0207674_102506812 115
54 3300028381 Ga0268264_10006166 Ga0268264_100061662 115
55 3300035086 Ga0373934_0084641 Ga0373934_0084641_834_1184 115
56 3300035119 Ga0373956_0056744 Ga0373956_0056744_841_1191 115
57 3300046472 Ga0495580_0040589 Ga0495580_0040589_1154_1504 115
58 3300046473 Ga0495582_0021867 Ga0495582_0021867_1642_1992 115
59 3300046475 Ga0495639_0129430 Ga0495639_0129430_844_1194 115
60 3300046531 Ga0495665_0049695 Ga0495665_0049695_1411_1761 115
61 3300046535 Ga0495586_0108281 Ga0495586_0108281_633_983 115
62 3300046543 Ga0495645_0529180 Ga0495645_0529180_137_487 115
63 3300046675 Ga0495657_0368134 Ga0495657_0368134_308_658 115
64 3300046681 Ga0495647_0018339 Ga0495647_0018339_91_441 115
65 3300046683 Ga0495658_0064556 Ga0495658_0064556_505_855 115
66 3300046689 Ga0495613_0083638 Ga0495613_0083638_997_1347 115
67 3300046809 Ga0495600_0505471 Ga0495600_0505471_62_412 115
68 3300047319 Ga0495674_0205422 Ga0495674_0205422_47_397 115
69 3300047471 Ga0495684_0113703 Ga0495684_0113703_244_594 115
70 3300048907 Ga0496104_0000058 Ga0496104_0000058_84398_84748 115
71 3300048908 Ga0496105_0000021 Ga0496105_0000021_27472_27822 115
72 3300049587 Ga0501071_0981598 Ga0501071_0981598_26_418 115
73 3300049588 Ga0501072_1512363 Ga0501072_1512363_96_488 115
74 3300053085 Ga0495619_1103030 Ga0495619_1103030_165_515 115
75 3300053123 Ga0500614_138558 Ga0500614_138558_356_706 115
76 3300002077 JGI24744J21845_10058199 JGI24744J21845_100581992 117
77 3300003323 rootH1_10388109 rootH1_103881092 117
78 3300004799 Ga0058863_11299941 Ga0058863_112999411 117
79 3300004800 Ga0058861_11859955 Ga0058861_118599551 117
80 3300004803 Ga0058862_12767649 Ga0058862_127676493 117
81 3300005288 Ga0065714_10416524 Ga0065714_104165241 117
82 3300005329 Ga0070683_100023239 Ga0070683_1000232393 117
83 3300005329 Ga0070683_100617153 Ga0070683_1006171532 117
84 3300005331 Ga0070670_102027595 Ga0070670_1020275951 117
85 3300005334 Ga0068869_100088832 Ga0068869_1000888323 117
86 3300005334 Ga0068869_100569986 Ga0068869_1005699861 117
87 3300005336 Ga0070680_100036515 Ga0070680_1000365153 117
88 3300005337 Ga0070682_100719586 Ga0070682_1007195862 117
89 3300005338 Ga0068868_100187753 Ga0068868_1001877531 117
90 3300005347 Ga0070668_100148910 Ga0070668_1001489104 117
91 3300005353 Ga0070669_100603931 Ga0070669_1006039311 117
92 3300005354 Ga0070675_100359660 Ga0070675_1003596602 117
93 3300005355 Ga0070671_100062432 Ga0070671_1000624323 117
94 3300005355 Ga0070671_101272368 Ga0070671_1012723682 117
95 3300005366 Ga0070659_100654269 Ga0070659_1006542692 117
96 3300005367 Ga0070667_100000068 Ga0070667_10000006897 117
97 3300005367 Ga0070667_100440210 Ga0070667_1004402102 117
98 3300005435 Ga0070714_100846320 Ga0070714_1008463201 117
99 3300005436 Ga0070713_100053256 Ga0070713_1000532563 117
100 3300005437 Ga0070710_10281604 Ga0070710_102816042 117
101 3300005456 Ga0070678_101187289 Ga0070678_1011872892 117
102 3300005458 Ga0070681_10105250 Ga0070681_101052502 117
103 3300005530 Ga0070679_100258360 Ga0070679_1002583602 117
104 3300005535 Ga0070684_100051456 Ga0070684_1000514562 117
105 3300005543 Ga0070672_100593827 Ga0070672_1005938272 117
106 3300005543 Ga0070672_100648235 Ga0070672_1006482352 117
107 3300005548 Ga0070665_100034144 Ga0070665_1000341442 117
108 3300005548 Ga0070665_100114583 Ga0070665_1001145833 117
109 3300005548 Ga0070665_101466181 Ga0070665_1014661811 117
110 3300005563 Ga0068855_100012669 Ga0068855_1000126699 117
111 3300005563 Ga0068855_100084571 Ga0068855_1000845713 117
112 3300005577 Ga0068857_100346572 Ga0068857_1003465722 117
113 3300005614 Ga0068856_100171489 Ga0068856_1001714892 117
114 3300005614 Ga0068856_101342889 Ga0068856_1013428891 117
115 3300005617 Ga0068859_100090494 Ga0068859_1000904944 117
116 3300005617 Ga0068859_100166092 Ga0068859_1001660923 117
117 3300005618 Ga0068864_100020426 Ga0068864_1000204264 117
118 3300005618 Ga0068864_100041325 Ga0068864_1000413252 117
119 3300005840 Ga0068870_10221096 Ga0068870_102210962 117
120 3300005841 Ga0068863_100064087 Ga0068863_1000640874 117
121 3300005841 Ga0068863_100167329 Ga0068863_1001673293 117
122 3300005842 Ga0068858_101575846 Ga0068858_1015758462 117
123 3300005843 Ga0068860_100052159 Ga0068860_1000521593 117
124 3300005844 Ga0068862_100351825 Ga0068862_1003518252 117
125 3300005985 Ga0081539_10018647 Ga0081539_100186476 117
126 3300006237 Ga0097621_100083864 Ga0097621_1000838643 117
127 3300006358 Ga0068871_100089221 Ga0068871_1000892212 117
128 3300006931 Ga0097620_100090493 Ga0097620_1000904934 117
129 3300006931 Ga0097620_100166095 Ga0097620_1001660953 117
130 3300009093 Ga0105240_10036132 Ga0105240_100361326 117
131 3300009093 Ga0105240_10078755 Ga0105240_100787552 117
132 3300009093 Ga0105240_10339582 Ga0105240_103395821 117
133 3300009098 Ga0105245_10046747 Ga0105245_100467472 117
134 3300009101 Ga0105247_10206182 Ga0105247_102061822 117
135 3300009177 Ga0105248_10034472 Ga0105248_100344724 117
136 3300009545 Ga0105237_10012083 Ga0105237_100120837 117
137 3300009545 Ga0105237_10314005 Ga0105237_103140051 117
138 3300009545 Ga0105237_12181809 Ga0105237_121818092 117
139 3300009553 Ga0105249_10050152 Ga0105249_100501524 117
140 3300009553 Ga0105249_10383510 Ga0105249_103835102 117
141 3300010375 Ga0105239_12601393 Ga0105239_126013931 117
142 3300013105 Ga0157369_10420950 Ga0157369_104209502 117
143 3300013297 Ga0157378_10000158 Ga0157378_100001584 117
144 3300013307 Ga0157372_11131642 Ga0157372_111316421 117
145 3300013307 Ga0157372_11388572 Ga0157372_113885722 117
146 3300014325 Ga0163163_10034983 Ga0163163_100349838 117
147 3300014325 Ga0163163_10111543 Ga0163163_101115432 117
148 3300014497 Ga0182008_10376425 Ga0182008_103764252 117
149 3300014968 Ga0157379_10511228 Ga0157379_105112281 117
150 3300014968 Ga0157379_11433164 Ga0157379_114331642 117
151 3300014969 Ga0157376_10723878 Ga0157376_107238781 117
152 3300025292 Ga0209676_1009369 Ga0209676_10093694 117
153 3300025298 Ga0209050_1001219 Ga0209050_10012196 117
154 3300025903 Ga0207680_10012177 Ga0207680_100121774 117
155 3300025911 Ga0207654_10091833 Ga0207654_100918331 117
156 3300025912 Ga0207707_10096946 Ga0207707_100969463 117
157 3300025913 Ga0207695_10039732 Ga0207695_100397322 117
158 3300025913 Ga0207695_10280146 Ga0207695_102801461 117
159 3300025913 Ga0207695_10523080 Ga0207695_105230802 117
160 3300025914 Ga0207671_10235241 Ga0207671_102352412 117
161 3300025917 Ga0207660_10056666 Ga0207660_100566664 117
162 3300025921 Ga0207652_10340550 Ga0207652_103405502 117
163 3300025924 Ga0207694_10604312 Ga0207694_106043122 117
164 3300025925 Ga0207650_10199548 Ga0207650_101995483 117
165 3300025926 Ga0207659_10561326 Ga0207659_105613261 117
166 3300025927 Ga0207687_10026703 Ga0207687_100267036 117
167 3300025928 Ga0207700_10096579 Ga0207700_100965792 117
168 3300025932 Ga0207690_10895144 Ga0207690_108951441 117
169 3300025941 Ga0207711_10011142 Ga0207711_100111425 117
170 3300025941 Ga0207711_10114973 Ga0207711_101149732 117
171 3300025942 Ga0207689_10101940 Ga0207689_101019403 117
172 3300025942 Ga0207689_11274136 Ga0207689_112741361 117
173 3300025944 Ga0207661_10042645 Ga0207661_100426452 117
174 3300025944 Ga0207661_10440125 Ga0207661_104401253 117
175 3300025949 Ga0207667_10030225 Ga0207667_100302252 117
176 3300025949 Ga0207667_10298894 Ga0207667_102988942 117
177 3300025961 Ga0207712_10519744 Ga0207712_105197442 117
178 3300025972 Ga0207668_10417860 Ga0207668_104178601 117
179 3300025986 Ga0207658_10000325 Ga0207658_1000032537 117
180 3300025986 Ga0207658_10323287 Ga0207658_103232872 117
181 3300026035 Ga0207703_10958866 Ga0207703_109588662 117
182 3300026035 Ga0207703_11496469 Ga0207703_114964692 117
183 3300026078 Ga0207702_10795822 Ga0207702_107958222 117
184 3300026088 Ga0207641_10021106 Ga0207641_100211062 117
185 3300026088 Ga0207641_10046125 Ga0207641_100461255 117
186 3300026095 Ga0207676_10022023 Ga0207676_100220234 117
187 3300026095 Ga0207676_10103892 Ga0207676_101038922 117
188 3300026116 Ga0207674_10715192 Ga0207674_107151922 117
189 3300026116 Ga0207674_10840282 Ga0207674_108402821 117
190 3300026121 Ga0207683_11512566 Ga0207683_115125662 117
191 3300027312 Ga0209371_1047778 Ga0209371_10477781 117
192 3300028379 Ga0268266_10000783 Ga0268266_1000078320 117
193 3300028379 Ga0268266_10051033 Ga0268266_100510334 117
194 3300028380 Ga0268265_10066645 Ga0268265_100666453 117
195 3300028381 Ga0268264_10075170 Ga0268264_100751704 117
196 3300028573 Ga0265334_10035677 Ga0265334_100356773 117
197 3300028794 Ga0307515_10006590 Ga0307515_100065907 117
198 3300028800 Ga0265338_10592613 Ga0265338_105926132 117
199 3300030500 Ga0268256_1053829 Ga0268256_10538291 117
200 3300030521 Ga0307511_10000037 Ga0307511_1000003728 117
201 3300030522 Ga0307512_10178373 Ga0307512_101783731 117
202 3300031239 Ga0265328_10004615 Ga0265328_100046155 117
203 3300031247 Ga0265340_10061704 Ga0265340_100617043 117
204 3300031344 Ga0265316_10343558 Ga0265316_103435582 117
205 3300031456 Ga0307513_10023092 Ga0307513_100230927 117
206 3300031507 Ga0307509_10000001 Ga0307509_10000001412 117
207 3300031548 Ga0307408_100030687 Ga0307408_1000306872 117
208 3300031548 Ga0307408_100433167 Ga0307408_1004331671 117
209 3300031548 Ga0307408_100436342 Ga0307408_1004363422 117
210 3300031548 Ga0307408_101269661 Ga0307408_1012696611 117
211 3300031649 Ga0307514_10005618 Ga0307514_1000561810 117
212 3300031730 Ga0307516_10000056 Ga0307516_10000056117 117
213 3300031731 Ga0307405_10398635 Ga0307405_103986352 117
214 3300031824 Ga0307413_10001880 Ga0307413_100018808 117
215 3300031852 Ga0307410_10138083 Ga0307410_101380832 117
216 3300031901 Ga0307406_10060495 Ga0307406_100604952 117
217 3300031903 Ga0307407_10038893 Ga0307407_100388932 117
218 3300031911 Ga0307412_10001185 Ga0307412_1000118513 117
219 3300031911 Ga0307412_10020652 Ga0307412_100206524 117
220 3300031911 Ga0307412_10116479 Ga0307412_101164792 117
221 3300031911 Ga0307412_10152063 Ga0307412_101520633 117
222 3300031911 Ga0307412_10589225 Ga0307412_105892252 117
223 3300031995 Ga0307409_100022216 Ga0307409_1000222162 117
224 3300032002 Ga0307416_101452505 Ga0307416_1014525052 117
225 3300032002 Ga0307416_102502763 Ga0307416_1025027632 117
226 3300032005 Ga0307411_10058268 Ga0307411_100582682 117
227 3300032126 Ga0307415_100002241 Ga0307415_10000224110 117
228 3300033180 Ga0307510_10265574 Ga0307510_102655741 117
229 3300037418 Ga0395900_0953752 Ga0395900_0953752_392_745 117
230 3300037471 Ga0395905_0092096 Ga0395905_0092096_1340_1699 117
231 3300041404 Ga0439436_0015745 Ga0439436_0015745_1770_2123 117
232 3300041410 Ga0439461_0161297 Ga0439461_0161297_214_567 117
233 3300041411 Ga0439466_0031675 Ga0439466_0031675_1045_1398 117
234 3300041413 Ga0439465_0299882 Ga0439465_0299882_68_421 117
235 3300042006 Ga0439432_159495 Ga0439432_159495_261_614 117
236 3300042007 Ga0439449_0000612 Ga0439449_0000612_3217_3570 117
237 3300042116 Ga0450912_015755 Ga0450912_015755_49_402 117
238 3300042156 Ga0439446_0052719 Ga0439446_0052719_558_923 117
239 3300042436 Ga0439435_0207487 Ga0439435_0207487_28_381 117
240 3300042439 Ga0439464_0316057 Ga0439464_0316057_126_479 117
241 3300042876 Ga0451577_0005919 Ga0451577_0005919_2828_3181 117
242 3300044656 Ga0466969_0000744 Ga0466969_0000744_8983_9336 117
243 3300044684 Ga0466966_0171141 Ga0466966_0171141_112_465 117
244 3300044693 Ga0466961_0251167 Ga0466961_0251167_402_818 117
245 3300044735 Ga0466968_0578166 Ga0466968_0578166_43_396 117
246 3300044765 Ga0466970_0130119 Ga0466970_0130119_326_679 117
247 3300044765 Ga0466970_0518637 Ga0466970_0518637_310_663 117
248 3300045049 Ga0466959_0017468 Ga0466959_0017468_2920_3336 117
249 3300045049 Ga0466959_0139428 Ga0466959_0139428_952_1305 117
250 3300046459 Ga0495629_0548034 Ga0495629_0548034_266_619 117
251 3300046473 Ga0495582_0832814 Ga0495582_0832814_46_444 117
252 3300046524 Ga0495648_0381934 Ga0495648_0381934_23_376 117
253 3300046525 Ga0495663_0059160 Ga0495663_0059160_147_506 117
254 3300046528 Ga0495642_0042283 Ga0495642_0042283_1079_1438 117
255 3300046530 Ga0495654_0104882 Ga0495654_0104882_904_1260 117
256 3300046615 Ga0495656_0019050 Ga0495656_0019050_1308_1667 117
257 3300046665 Ga0495661_0323375 Ga0495661_0323375_360_713 117
258 3300046691 Ga0495670_0700277 Ga0495670_0700277_106_465 117
259 3300047318 Ga0495636_0462575 Ga0495636_0462575_130_489 117
260 3300047319 Ga0495674_1125028 Ga0495674_1125028_124_477 117
261 3300047321 Ga0495676_1068982 Ga0495676_1068982_73_426 117
262 3300047322 Ga0495680_0330922 Ga0495680_0330922_656_1009 117
263 3300047445 Ga0495677_0023025 Ga0495677_0023025_17_376 117
264 3300047447 Ga0495685_040599 Ga0495685_040599_742_1101 117
265 3300048091 Ga0495626_0092634 Ga0495626_0092634_286_642 117
266 3300048903 Ga0496100_0708601 Ga0496100_0708601_342_716 117
267 3300048904 Ga0496101_0289720 Ga0496101_0289720_708_1082 117
268 3300048905 Ga0496102_0130390 Ga0496102_0130390_163_537 117
269 3300048907 Ga0496104_0431272 Ga0496104_0431272_170_544 117
270 3300048907 Ga0496104_1457991 Ga0496104_1457991_173_526 117
271 3300048911 Ga0496108_0453678 Ga0496108_0453678_460_834 117
272 3300048914 Ga0496111_0854582 Ga0496111_0854582_92_466 117
273 3300048919 Ga0496116_0001634 Ga0496116_0001634_3409_3762 117
274 3300048919 Ga0496116_0080879 Ga0496116_0080879_1310_1663 117
275 3300048920 Ga0496117_0613104 Ga0496117_0613104_65_418 117
276 3300048921 Ga0496118_0013298 Ga0496118_0013298_5040_5393 117
277 3300048921 Ga0496118_0067495 Ga0496118_0067495_728_1081 117
278 3300048922 Ga0496119_0103390 Ga0496119_0103390_92_445 117
279 3300048923 Ga0496120_0004000 Ga0496120_0004000_10705_11058 117
280 3300048923 Ga0496120_0327298 Ga0496120_0327298_180_533 117
281 3300048924 Ga0496121_0000211 Ga0496121_0000211_21123_21476 117
282 3300048924 Ga0496121_0126473 Ga0496121_0126473_1090_1443 117
283 3300048925 Ga0496122_0000021 Ga0496122_0000021_343731_344084 117
284 3300048925 Ga0496122_0057909 Ga0496122_0057909_1258_1611 117
285 3300048925 Ga0496122_0082057 Ga0496122_0082057_49_402 117
286 3300048925 Ga0496122_0326957 Ga0496122_0326957_299_652 117
287 3300048926 Ga0496123_0000174 Ga0496123_0000174_95435_95788 117
288 3300048926 Ga0496123_0014822 Ga0496123_0014822_5527_5880 117
289 3300048926 Ga0496123_0425741 Ga0496123_0425741_47_400 117
290 3300048927 Ga0496124_0077032 Ga0496124_0077032_672_1025 117
291 3300048927 Ga0496124_0262659 Ga0496124_0262659_149_502 117
292 3300048928 Ga0496125_0000005 Ga0496125_0000005_159728_160081 117
293 3300048928 Ga0496125_0022549 Ga0496125_0022549_5221_5574 117
294 3300048928 Ga0496125_0120861 Ga0496125_0120861_969_1322 117
295 3300048928 Ga0496125_0731836 Ga0496125_0731836_60_416 117
296 3300048929 Ga0496126_0111788 Ga0496126_0111788_523_876 117
297 3300048929 Ga0496126_0298433 Ga0496126_0298433_551_904 117
298 3300049570 Ga0501033_0387108 Ga0501033_0387108_176_529 117
299 3300049574 Ga0501038_1208436 Ga0501038_1208436_184_537 117
300 3300049822 Ga0501035_0303633 Ga0501035_0303633_800_1153 117
301 3300049823 Ga0501044_0089475 Ga0501044_0089475_987_1340 117
302 3300053130 Ga0500642_0446421 Ga0500642_0446421_171_524 117
303 3300053148 Ga0500590_002156 Ga0500590_002156_2210_2563 117
304 3300053178 Ga0500637_0085162 Ga0500637_0085162_664_1062 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

22

136

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9123 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8833 1 114
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6946 1 113
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.6826 1 115
2nzc-assembly1.cif.gz_C the structure of uncharacterized protein tm1266 from thermotoga maritima. 0.6736 2 110
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9123 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8833 1 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7533 1 114 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7005 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7002 1 114 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A6N8SSE1-F1-model_v4 deleted 0.984 1 117
AF-A0A6I2GU57-F1-model_v4 Dehydrogenase 0.9798 1 117
AF-A0A2N8KZH9-F1-model_v4 Dehydrogenase 0.9767 2 117
AF-A0A6N8SSE1-F1-model_v4 deleted 0.9758 1 117
AF-B1Y0D2-F1-model_v4 DGPFAETKE family protein 0.9738 1 117 GO:0005829
GO:0006541

Feature Viewer

pLDDT pTM Quality
94.24 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map