F397680
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 199 | 304 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300035725|Ga0373947_0046323|Ga0373947_0046323_705_1676 |
| Length | 323 |
| Sequence | MPAFICTACGAQFAPSEAPPAQCPICEDERQYVPPRGQTWTTLPALAASHFNSYREHAPGVIGIGTQPAFAIGQRALLLRTAGGNVLWDCISLLDAATVTLIGALGGIKAIAISHPHFYTGMVEWSRAFGGVPIHLHAADRAWIMRPDPAIRPWEGETLALMPGVTLVRCGGHFPGGTVLHWAEGAGGRGVLCAGDIAAVAPDRKWLAFMKSYPNFIPLSAGEVDGIAAALAPFQFDIIYGHYFDRVIPTGGKAVLAASVALSRRDRRPAAGLNEADTGQSRKPSTIIGHRTPILLQRPANWERAPAGCGQCQPPRSAHSKPF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 33 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 55 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 80 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 81 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 82 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 83 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 84 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 86 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 87 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 88 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 89 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 90 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 91 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 92 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 93 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 94 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 95 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 97 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 98 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 99 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 100 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 101 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 102 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 103 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 106 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 107 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 108 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 109 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 110 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 111 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 112 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 163 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 180 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 181 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 190 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 193 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 194 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 195 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 196 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 197 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 198 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.62 |
| Nodule | 0 |
| Rhizoplane | 5.26 |
| Rhizosphere | 89.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10006864 | 3300003659 | Bacteria | 2393 |
| 2 | JGI25405J52794_10008474 | 3300003911 | Bacteria | 1921 |
| 3 | Ga0065712_10070433 | 3300005290 | Bacteria | 6010 |
| 4 | Ga0070658_10007874 | 3300005327 | Bacteria | 8582 |
| 5 | Ga0070658_10248064 | 3300005327 | Bacteria | 1510 |
| 6 | Ga0070683_100314548 | 3300005329 | Bacteria | 1490 |
| 7 | Ga0070670_100167255 | 3300005331 | Bacteria | 1907 |
| 8 | Ga0070680_100081901 | 3300005336 | Bacteria | 2663 |
| 9 | Ga0070680_100260682 | 3300005336 | Bacteria | 1466 |
| 10 | Ga0070680_100574272 | 3300005336 | Bacteria | 967 |
| 11 | Ga0070660_100099252 | 3300005339 | Bacteria | 2305 |
| 12 | Ga0070660_100314710 | 3300005339 | Bacteria | 1285 |
| 13 | Ga0070675_100066641 | 3300005354 | Bacteria | 2978 |
| 14 | Ga0070671_100143111 | 3300005355 | Bacteria | 2018 |
| 15 | Ga0070709_10188809 | 3300005434 | Bacteria | 1452 |
| 16 | Ga0070714_100019188 | 3300005435 | Bacteria | 5565 |
| 17 | Ga0070714_100058295 | 3300005435 | Bacteria | 3307 |
| 18 | Ga0070713_100106946 | 3300005436 | Bacteria | 2433 |
| 19 | Ga0070713_100682376 | 3300005436 | Unclassified | 980 |
| 20 | Ga0070711_100014051 | 3300005439 | Bacteria | 5038 |
| 21 | Ga0070700_100001479 | 3300005441 | Bacteria | 11696 |
| 22 | Ga0070681_10058843 | 3300005458 | Bacteria | 3822 |
| 23 | Ga0070681_10114022 | 3300005458 | Bacteria | 2642 |
| 24 | Ga0070685_10079726 | 3300005466 | Bacteria | 1960 |
| 25 | Ga0070707_100071696 | 3300005468 | Bacteria | 3337 |
| 26 | Ga0070698_100003731 | 3300005471 | Bacteria | 16739 |
| 27 | Ga0070699_100054242 | 3300005518 | Bacteria | 3469 |
| 28 | Ga0070679_100110111 | 3300005530 | Bacteria | 2740 |
| 29 | Ga0070679_100353151 | 3300005530 | Bacteria | 1418 |
| 30 | Ga0070679_100368501 | 3300005530 | Bacteria | 1383 |
| 31 | Ga0070697_100030866 | 3300005536 | Bacteria | 4307 |
| 32 | Ga0070697_100205215 | 3300005536 | Bacteria | 1676 |
| 33 | Ga0068853_100510117 | 3300005539 | Bacteria | 1136 |
| 34 | Ga0070693_100460563 | 3300005547 | Unclassified | 894 |
| 35 | Ga0068855_100041664 | 3300005563 | Bacteria | 5441 |
| 36 | Ga0068855_100164426 | 3300005563 | Bacteria | 2516 |
| 37 | Ga0068855_100526113 | 3300005563 | Bacteria | 1282 |
| 38 | Ga0070664_100172884 | 3300005564 | Bacteria | 1917 |
| 39 | Ga0070664_100194310 | 3300005564 | Bacteria | 1809 |
| 40 | Ga0068856_100379931 | 3300005614 | Bacteria | 1432 |
| 41 | Ga0068852_100061975 | 3300005616 | Bacteria | 3251 |
| 42 | Ga0068852_100142231 | 3300005616 | Bacteria | 2222 |
| 43 | Ga0068859_100008041 | 3300005617 | Bacteria | 10692 |
| 44 | Ga0068859_100075510 | 3300005617 | Bacteria | 3411 |
| 45 | Ga0081455_10000031 | 3300005937 | Bacteria | 146486 |
| 46 | Ga0081455_10005956 | 3300005937 | Bacteria | 13223 |
| 47 | Ga0081455_10014661 | 3300005937 | Bacteria | 7663 |
| 48 | Ga0081455_10054090 | 3300005937 | Bacteria | 3424 |
| 49 | Ga0081455_10067410 | 3300005937 | Bacteria | 2982 |
| 50 | Ga0081538_10007058 | 3300005981 | Bacteria | 9767 |
| 51 | Ga0081538_10008070 | 3300005981 | Bacteria | 8990 |
| 52 | Ga0081538_10019479 | 3300005981 | Bacteria | 5040 |
| 53 | Ga0081540_1001200 | 3300005983 | Bacteria | 22696 |
| 54 | Ga0081540_1065179 | 3300005983 | Bacteria | 1714 |
| 55 | Ga0070712_100042462 | 3300006175 | Bacteria | 3127 |
| 56 | Ga0075367_10214089 | 3300006178 | Unclassified | 1205 |
| 57 | Ga0075370_10067599 | 3300006353 | Bacteria | 2040 |
| 58 | Ga0068871_100466773 | 3300006358 | Bacteria | 1133 |
| 59 | Ga0075428_100297351 | 3300006844 | Bacteria | 1736 |
| 60 | Ga0075434_100039278 | 3300006871 | Bacteria | 4689 |
| 61 | Ga0075434_100463852 | 3300006871 | Unclassified | 1288 |
| 62 | Ga0097620_100008041 | 3300006931 | Bacteria | 10692 |
| 63 | Ga0097620_100075509 | 3300006931 | Bacteria | 3411 |
| 64 | Ga0099794_10010561 | 3300007265 | Plasmid | 3926 |
| 65 | Ga0111539_10068290 | 3300009094 | Bacteria | 4196 |
| 66 | Ga0105247_10090667 | 3300009101 | Bacteria | 1940 |
| 67 | Ga0114129_10025670 | 3300009147 | Bacteria | 8347 |
| 68 | Ga0114129_10461860 | 3300009147 | Bacteria | 1664 |
| 69 | Ga0114129_10614974 | 3300009147 | Bacteria | 1406 |
| 70 | Ga0105248_10066779 | 3300009177 | Bacteria | 4038 |
| 71 | Ga0105238_10090475 | 3300009551 | Bacteria | 3047 |
| 72 | Ga0099796_10010685 | 3300010159 | Bacteria | 2533 |
| 73 | Ga0157369_10269878 | 3300013105 | Bacteria | 1773 |
| 74 | Ga0157378_10328020 | 3300013297 | Bacteria | 1489 |
| 75 | Ga0163163_10078637 | 3300014325 | Bacteria | 3295 |
| 76 | Ga0163163_10258168 | 3300014325 | Unclassified | 1793 |
| 77 | Ga0157379_10127072 | 3300014968 | Bacteria | 2294 |
| 78 | Ga0157376_10452885 | 3300014969 | Bacteria | 1252 |
| 79 | Ga0206354_10798211 | 3300020081 | Bacteria | 986 |
| 80 | Ga0206353_10980335 | 3300020082 | Bacteria | 1295 |
| 81 | Ga0213876_10131612 | 3300021384 | Bacteria | 1329 |
| 82 | Ga0207647_10005455 | 3300025904 | Bacteria | 9319 |
| 83 | Ga0207705_10178857 | 3300025909 | Bacteria | 1600 |
| 84 | Ga0207705_10214861 | 3300025909 | Bacteria | 1459 |
| 85 | Ga0207707_10048511 | 3300025912 | Bacteria | 3698 |
| 86 | Ga0207707_10282688 | 3300025912 | Bacteria | 1437 |
| 87 | Ga0207695_10002359 | 3300025913 | Bacteria | 28068 |
| 88 | Ga0207695_10309515 | 3300025913 | Unclassified | 1470 |
| 89 | Ga0207695_10453642 | 3300025913 | Bacteria | 1165 |
| 90 | Ga0207693_10330999 | 3300025915 | Bacteria | 1192 |
| 91 | Ga0207660_10395763 | 3300025917 | Bacteria | 1112 |
| 92 | Ga0207662_10054658 | 3300025918 | Bacteria | 2381 |
| 93 | Ga0207657_10009131 | 3300025919 | Bacteria | 10005 |
| 94 | Ga0207657_10249699 | 3300025919 | Bacteria | 1415 |
| 95 | Ga0207652_10032169 | 3300025921 | Bacteria | 4407 |
| 96 | Ga0207652_10100921 | 3300025921 | Bacteria | 2548 |
| 97 | Ga0207652_10228983 | 3300025921 | Bacteria | 1675 |
| 98 | Ga0207681_10009572 | 3300025923 | Bacteria | 5923 |
| 99 | Ga0207694_10038909 | 3300025924 | Bacteria | 3658 |
| 100 | Ga0207694_10391505 | 3300025924 | Bacteria | 1155 |
| 101 | Ga0207650_10136398 | 3300025925 | Bacteria | 1925 |
| 102 | Ga0207700_10267643 | 3300025928 | Bacteria | 1466 |
| 103 | Ga0207700_10529708 | 3300025928 | Bacteria | 1044 |
| 104 | Ga0207664_10015866 | 3300025929 | Bacteria | 5484 |
| 105 | Ga0207664_10153980 | 3300025929 | Bacteria | 1955 |
| 106 | Ga0207664_10258403 | 3300025929 | Bacteria | 1522 |
| 107 | Ga0207664_10589562 | 3300025929 | Bacteria | 998 |
| 108 | Ga0207670_10023023 | 3300025936 | Bacteria | 3870 |
| 109 | Ga0207691_10038807 | 3300025940 | Bacteria | 4407 |
| 110 | Ga0207711_10097898 | 3300025941 | Bacteria | 2591 |
| 111 | Ga0207661_10169432 | 3300025944 | Bacteria | 1900 |
| 112 | Ga0207679_10046232 | 3300025945 | Bacteria | 3154 |
| 113 | Ga0207679_10132489 | 3300025945 | Bacteria | 2002 |
| 114 | Ga0207667_10047725 | 3300025949 | Bacteria | 4531 |
| 115 | Ga0207667_10414291 | 3300025949 | Bacteria | 1371 |
| 116 | Ga0207667_10702035 | 3300025949 | Bacteria | 1014 |
| 117 | Ga0207658_10051260 | 3300025986 | Bacteria | 3041 |
| 118 | Ga0207708_10001296 | 3300026075 | Bacteria | 18801 |
| 119 | Ga0207675_100058184 | 3300026118 | Bacteria | 3607 |
| 120 | Ga0207698_10022747 | 3300026142 | Bacteria | 4365 |
| 121 | Ga0207428_10313819 | 3300027907 | Bacteria | 1159 |
| 122 | Ga0207428_10323861 | 3300027907 | Bacteria | 1138 |
| 123 | Ga0265337_1003979 | 3300028556 | Bacteria | 6253 |
| 124 | Ga0265325_10054981 | 3300031241 | Bacteria | 2037 |
| 125 | Ga0265340_10012862 | 3300031247 | Bacteria | 4412 |
| 126 | Ga0265313_10000577 | 3300031595 | Bacteria | 38251 |
| 127 | Ga0265313_10065654 | 3300031595 | Bacteria | 1684 |
| 128 | Ga0265314_10053185 | 3300031711 | Bacteria | 2810 |
| 129 | Ga0265342_10000464 | 3300031712 | Bacteria | 43974 |
| 130 | Ga0316583_10009929 | 3300032133 | Bacteria | 3429 |
| 131 | Ga0307510_10045012 | 3300033180 | Bacteria | 4772 |
| 132 | Ga0373944_0017604 | 3300035089 | Bacteria | 2031 |
| 133 | Ga0373945_0003525 | 3300035116 | Bacteria | 4930 |
| 134 | Ga0373953_0009710 | 3300035117 | Bacteria | 3322 |
| 135 | Ga0373954_0014363 | 3300035118 | Bacteria | 3531 |
| 136 | Ga0373956_0021026 | 3300035119 | Bacteria | 2781 |
| 137 | Ga0373960_0007112 | 3300035121 | Bacteria | 2643 |
| 138 | Ga0373943_0002092 | 3300035170 | Bacteria | 9063 |
| 139 | Ga0373946_0006291 | 3300035171 | Bacteria | 4302 |
| 140 | Ga0373955_0063781 | 3300035172 | Bacteria | 2040 |
| 141 | Ga0373924_0044418 | 3300035410 | Bacteria | 1826 |
| 142 | Ga0373931_0068097 | 3300035691 | Bacteria | 1937 |
| 143 | Ga0373935_0008707 | 3300035692 | Bacteria | 6077 |
| 144 | Ga0373935_0092923 | 3300035692 | Bacteria | 1978 |
| 145 | Ga0373935_0242101 | 3300035692 | Bacteria | 1260 |
| 146 | Ga0373927_0002617 | 3300035695 | Bacteria | 13120 |
| 147 | Ga0373927_0034422 | 3300035695 | Bacteria | 3295 |
| 148 | Ga0373927_0166533 | 3300035695 | Bacteria | 1444 |
| 149 | Ga0373927_0220971 | 3300035695 | Bacteria | 1244 |
| 150 | Ga0373933_0032376 | 3300035724 | Bacteria | 3039 |
| 151 | Ga0373933_0140234 | 3300035724 | Bacteria | 1526 |
| 152 | Ga0373947_0000303 | 3300035725 | Bacteria | 27751 |
| 153 | Ga0373947_0046323 | 3300035725 | Bacteria | 2604 |
| 154 | Ga0373947_0066110 | 3300035725 | Bacteria | 2206 |
| 155 | Ga0373947_0154914 | 3300035725 | Bacteria | 1478 |
| 156 | Ga0373937_0032614 | 3300036401 | Bacteria | 4725 |
| 157 | Ga0373937_0092165 | 3300036401 | Bacteria | 2808 |
| 158 | Ga0373937_0101502 | 3300036401 | Bacteria | 2670 |
| 159 | Ga0373937_0284543 | 3300036401 | Unclassified | 1562 |
| 160 | Ga0373925_0049081 | 3300037068 | Bacteria | 3146 |
| 161 | Ga0373925_0163540 | 3300037068 | Bacteria | 1754 |
| 162 | Ga0436364_0931038 | 3300037853 | Bacteria | 1812 |
| 163 | Ga0242420_009565 | 3300038996 | Bacteria | 1592 |
| 164 | Ga0436365_1473399 | 3300039437 | Bacteria | 8261 |
| 165 | Ga0436365_1703167 | 3300039437 | Bacteria | 2218 |
| 166 | Ga0436360_0165678 | 3300039438 | Bacteria | 1002 |
| 167 | Ga0436361_0829307 | 3300039447 | Bacteria | 1563 |
| 168 | Ga0436363_1285858 | 3300039450 | Bacteria | 1161 |
| 169 | Ga0466971_0171022 | 3300044719 | Bacteria | 1020 |
| 170 | Ga0466960_0050236 | 3300044901 | Bacteria | 2010 |
| 171 | Ga0466959_0235829 | 3300045049 | Bacteria | 1265 |
| 172 | Ga0495592_0011187 | 3300046454 | Bacteria | 6779 |
| 173 | Ga0495592_0322310 | 3300046454 | Bacteria | 998 |
| 174 | Ga0495603_0040354 | 3300046455 | Bacteria | 2794 |
| 175 | Ga0495603_0312928 | 3300046455 | Bacteria | 902 |
| 176 | Ga0495629_0021736 | 3300046459 | Bacteria | 4578 |
| 177 | Ga0495629_0150537 | 3300046459 | Bacteria | 1617 |
| 178 | Ga0495651_0025932 | 3300046462 | Bacteria | 4564 |
| 179 | Ga0495651_0051642 | 3300046462 | Bacteria | 3169 |
| 180 | Ga0495651_0197468 | 3300046462 | Bacteria | 1411 |
| 181 | Ga0495653_0049504 | 3300046463 | Bacteria | 3236 |
| 182 | Ga0495580_0071122 | 3300046472 | Bacteria | 2430 |
| 183 | Ga0495582_0061242 | 3300046473 | Bacteria | 2078 |
| 184 | Ga0495639_0089919 | 3300046475 | Bacteria | 1439 |
| 185 | Ga0495662_0007226 | 3300046476 | Bacteria | 5497 |
| 186 | Ga0495664_0000202 | 3300046477 | Bacteria | 28893 |
| 187 | Ga0495664_0311679 | 3300046477 | Bacteria | 949 |
| 188 | Ga0495584_0117346 | 3300046491 | Bacteria | 1347 |
| 189 | Ga0495608_0243620 | 3300046511 | Bacteria | 1122 |
| 190 | Ga0495616_0081891 | 3300046513 | Bacteria | 1543 |
| 191 | Ga0495618_0004996 | 3300046514 | Bacteria | 8105 |
| 192 | Ga0495618_0015879 | 3300046514 | Bacteria | 4596 |
| 193 | Ga0495648_0001044 | 3300046524 | Bacteria | 28102 |
| 194 | Ga0495648_0006355 | 3300046524 | Bacteria | 9660 |
| 195 | Ga0495666_0077509 | 3300046526 | Bacteria | 1575 |
| 196 | Ga0495652_0019081 | 3300046529 | Bacteria | 6107 |
| 197 | Ga0495652_0085601 | 3300046529 | Bacteria | 2590 |
| 198 | Ga0495665_0033806 | 3300046531 | Bacteria | 2734 |
| 199 | Ga0495665_0059616 | 3300046531 | Bacteria | 2014 |
| 200 | Ga0495640_0001275 | 3300046533 | Bacteria | 19760 |
| 201 | Ga0495640_0022955 | 3300046533 | Bacteria | 4556 |
| 202 | Ga0495640_0111073 | 3300046533 | Bacteria | 1791 |
| 203 | Ga0495586_0027053 | 3300046535 | Bacteria | 3069 |
| 204 | Ga0495587_0014525 | 3300046536 | Bacteria | 4937 |
| 205 | Ga0495587_0093623 | 3300046536 | Bacteria | 1735 |
| 206 | Ga0495587_0130267 | 3300046536 | Bacteria | 1438 |
| 207 | Ga0495645_0008678 | 3300046543 | Bacteria | 7099 |
| 208 | Ga0495667_0010201 | 3300046559 | Bacteria | 6357 |
| 209 | Ga0495656_0017589 | 3300046615 | Bacteria | 2730 |
| 210 | Ga0495634_0003024 | 3300046642 | Bacteria | 13688 |
| 211 | Ga0495634_0036286 | 3300046642 | Bacteria | 3372 |
| 212 | Ga0495634_0050976 | 3300046642 | Bacteria | 2778 |
| 213 | Ga0495635_0001332 | 3300046663 | Bacteria | 16434 |
| 214 | Ga0495659_0041121 | 3300046664 | Bacteria | 1650 |
| 215 | Ga0495657_0287555 | 3300046675 | Bacteria | 982 |
| 216 | Ga0495599_0219071 | 3300046678 | Bacteria | 1165 |
| 217 | Ga0495623_0138795 | 3300046679 | Bacteria | 1448 |
| 218 | Ga0495623_0158977 | 3300046679 | Bacteria | 1329 |
| 219 | Ga0495646_0017785 | 3300046680 | Bacteria | 4506 |
| 220 | Ga0495658_0168716 | 3300046683 | Bacteria | 1353 |
| 221 | Ga0495613_0066317 | 3300046689 | Bacteria | 2636 |
| 222 | Ga0495613_0282783 | 3300046689 | Bacteria | 1152 |
| 223 | Ga0495624_0010397 | 3300046690 | Bacteria | 6413 |
| 224 | Ga0495624_0030534 | 3300046690 | Bacteria | 3509 |
| 225 | Ga0495604_0057733 | 3300047317 | Bacteria | 2983 |
| 226 | Ga0495604_0061971 | 3300047317 | Bacteria | 2859 |
| 227 | Ga0495674_0065344 | 3300047319 | Bacteria | 3160 |
| 228 | Ga0495680_0111769 | 3300047322 | Bacteria | 2024 |
| 229 | Ga0495680_0173771 | 3300047322 | Bacteria | 1558 |
| 230 | Ga0495675_0016456 | 3300047444 | Bacteria | 4678 |
| 231 | Ga0495684_0010372 | 3300047471 | Bacteria | 7206 |
| 232 | Ga0495684_0026865 | 3300047471 | Bacteria | 4422 |
| 233 | Ga0495684_0140408 | 3300047471 | Bacteria | 1811 |
| 234 | Ga0495684_0243515 | 3300047471 | Bacteria | 1310 |
| 235 | Ga0495593_0042456 | 3300047673 | Bacteria | 2440 |
| 236 | Ga0495602_0371668 | 3300048088 | Bacteria | 1026 |
| 237 | Ga0496104_0083732 | 3300048907 | Bacteria | 3042 |
| 238 | Ga0496104_0254980 | 3300048907 | Bacteria | 1667 |
| 239 | Ga0496107_0069702 | 3300048910 | Bacteria | 2553 |
| 240 | Ga0496107_0125145 | 3300048910 | Unclassified | 1895 |
| 241 | Ga0496108_0004587 | 3300048911 | Bacteria | 11131 |
| 242 | Ga0496109_0001606 | 3300048912 | Bacteria | 18869 |
| 243 | Ga0496110_0124481 | 3300048913 | Bacteria | 2325 |
| 244 | Ga0496110_0127109 | 3300048913 | Bacteria | 2300 |
| 245 | Ga0496110_0229515 | 3300048913 | Bacteria | 1688 |
| 246 | Ga0496110_0466719 | 3300048913 | Unclassified | 1150 |
| 247 | Ga0496111_0003849 | 3300048914 | Bacteria | 9377 |
| 248 | Ga0496113_0000122 | 3300048916 | Bacteria | 33708 |
| 249 | Ga0496114_0160443 | 3300048917 | Bacteria | 1954 |
| 250 | Ga0496114_0382984 | 3300048917 | Bacteria | 1245 |
| 251 | Ga0496115_0021512 | 3300048918 | Bacteria | 4985 |
| 252 | Ga0496115_0251411 | 3300048918 | Bacteria | 1455 |
| 253 | Ga0501034_0015256 | 3300049571 | Bacteria | 7896 |
| 254 | Ga0501034_0018661 | 3300049571 | Bacteria | 7109 |
| 255 | Ga0501034_0529794 | 3300049571 | Bacteria | 1089 |
| 256 | Ga0501036_0001733 | 3300049572 | Bacteria | 16942 |
| 257 | Ga0501036_0317499 | 3300049572 | Bacteria | 1302 |
| 258 | Ga0501037_0038753 | 3300049573 | Bacteria | 3510 |
| 259 | Ga0501040_0256378 | 3300049576 | Unclassified | 1248 |
| 260 | Ga0501043_0000800 | 3300049579 | Bacteria | 27945 |
| 261 | Ga0501046_0019387 | 3300049580 | Bacteria | 5643 |
| 262 | Ga0501047_0000136 | 3300049581 | Bacteria | 89236 |
| 263 | Ga0501047_0020823 | 3300049581 | Bacteria | 6300 |
| 264 | Ga0501048_0000039 | 3300049582 | Bacteria | 63521 |
| 265 | Ga0501070_0019941 | 3300049586 | Bacteria | 5622 |
| 266 | Ga0501072_0076485 | 3300049588 | Bacteria | 2649 |
| 267 | Ga0501073_0018270 | 3300049589 | Bacteria | 5066 |
| 268 | Ga0501073_0078246 | 3300049589 | Bacteria | 2301 |
| 269 | Ga0501074_0005036 | 3300049590 | Bacteria | 9481 |
| 270 | Ga0501074_0238835 | 3300049590 | Bacteria | 1293 |
| 271 | Ga0501080_0000022 | 3300049742 | Bacteria | 90630 |
| 272 | Ga0501083_0017951 | 3300049744 | Bacteria | 4934 |
| 273 | Ga0501044_0009844 | 3300049823 | Bacteria | 10390 |
| 274 | Ga0501044_0133703 | 3300049823 | Bacteria | 2473 |
| 275 | nmdc:mga06z11_206351_c1 | 3300050494 | Bacteria | 1143 |
| 276 | nmdc:mga07m45_55105_c2 | 3300050496 | Bacteria | 1903 |
| 277 | nmdc:mga05p37_965690_c1 | 3300050507 | Bacteria | 910 |
| 278 | nmdc:mga09592_172062_c1 | 3300050508 | Bacteria | 1873 |
| 279 | nmdc:mga0qj67_7972_c1 | 3300050509 | Bacteria | 7831 |
| 280 | nmdc:mga06r32_13372_c1 | 3300050510 | Bacteria | 7433 |
| 281 | nmdc:mga06r32_9960_c1 | 3300050510 | Bacteria | 8577 |
| 282 | nmdc:mga08y16_144820_c1 | 3300050511 | Bacteria | 2470 |
| 283 | nmdc:mga08y16_156759_c1 | 3300050511 | Bacteria | 2366 |
| 284 | nmdc:mga08y16_235356_c1 | 3300050511 | Unclassified | 1894 |
| 285 | nmdc:mga0n895_48867_c1 | 3300050512 | Bacteria | 4143 |
| 286 | Ga0495601_0001326 | 3300053077 | Bacteria | 13593 |
| 287 | Ga0495601_0031702 | 3300053077 | Bacteria | 3286 |
| 288 | Ga0495601_0031899 | 3300053077 | Bacteria | 3276 |
| 289 | Ga0495612_0070569 | 3300053078 | Bacteria | 1456 |
| 290 | Ga0500635_0004901 | 3300053080 | Bacteria | 3475 |
| 291 | Ga0495595_0001054 | 3300053084 | Bacteria | 10648 |
| 292 | Ga0495595_0014314 | 3300053084 | Bacteria | 3363 |
| 293 | Ga0495595_0015875 | 3300053084 | Bacteria | 3215 |
| 294 | Ga0495619_0006059 | 3300053085 | Bacteria | 7659 |
| 295 | Ga0495619_0055713 | 3300053085 | Bacteria | 2619 |
| 296 | Ga0500646_0085016 | 3300053090 | Viruses | 971 |
| 297 | Ga0500641_0010825 | 3300053096 | Bacteria | 3304 |
| 298 | Ga0500554_001201 | 3300053102 | Bacteria | 5027 |
| 299 | Ga0500603_000963 | 3300053150 | Bacteria | 6805 |
| 300 | Ga0500637_0008015 | 3300053178 | Bacteria | 5307 |
| 301 | Ga0500657_137285 | 3300053728 | Unclassified | 936 |
| 302 | Ga0501084_0369649 | 3300054114 | Bacteria | 1212 |
| 303 | Ga0501082_0048067 | 3300060353 | Bacteria | 3677 |
| 304 | Ga0501082_0161091 | 3300060353 | Bacteria | 1950 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005937 | Ga0081455_10054090 | Ga0081455_100540905 | 236 |
| 2 | 3300047444 | Ga0495675_0016456 | Ga0495675_0016456_49_768 | 236 |
| 3 | 3300047471 | Ga0495684_0140408 | Ga0495684_0140408_55_774 | 236 |
| 4 | 3300048088 | Ga0495602_0371668 | Ga0495602_0371668_54_773 | 236 |
| 5 | 3300005436 | Ga0070713_100682376 | Ga0070713_1006823761 | 241 |
| 6 | 3300035089 | Ga0373944_0017604 | Ga0373944_0017604_257_1078 | 241 |
| 7 | 3300035116 | Ga0373945_0003525 | Ga0373945_0003525_3576_4397 | 241 |
| 8 | 3300035170 | Ga0373943_0002092 | Ga0373943_0002092_6916_7737 | 241 |
| 9 | 3300035171 | Ga0373946_0006291 | Ga0373946_0006291_2509_3330 | 241 |
| 10 | 3300035410 | Ga0373924_0044418 | Ga0373924_0044418_688_1509 | 241 |
| 11 | 3300035692 | Ga0373935_0008707 | Ga0373935_0008707_3771_4592 | 241 |
| 12 | 3300035695 | Ga0373927_0002617 | Ga0373927_0002617_8467_9288 | 241 |
| 13 | 3300035725 | Ga0373947_0000303 | Ga0373947_0000303_16384_17205 | 241 |
| 14 | 3300046459 | Ga0495629_0150537 | Ga0495629_0150537_186_1007 | 241 |
| 15 | 3300046472 | Ga0495580_0071122 | Ga0495580_0071122_1080_1901 | 241 |
| 16 | 3300046475 | Ga0495639_0089919 | Ga0495639_0089919_148_969 | 241 |
| 17 | 3300046531 | Ga0495665_0059616 | Ga0495665_0059616_834_1673 | 241 |
| 18 | 3300046533 | Ga0495640_0111073 | Ga0495640_0111073_488_1309 | 241 |
| 19 | 3300046642 | Ga0495634_0050976 | Ga0495634_0050976_1636_2475 | 241 |
| 20 | 3300046683 | Ga0495658_0168716 | Ga0495658_0168716_156_977 | 241 |
| 21 | 3300046689 | Ga0495613_0066317 | Ga0495613_0066317_1269_2090 | 241 |
| 22 | 3300046690 | Ga0495624_0010397 | Ga0495624_0010397_4473_5294 | 241 |
| 23 | 3300047471 | Ga0495684_0010372 | Ga0495684_0010372_4748_5569 | 241 |
| 24 | 3300047471 | Ga0495684_0243515 | Ga0495684_0243515_349_1188 | 241 |
| 25 | 3300047673 | Ga0495593_0042456 | Ga0495593_0042456_476_1297 | 241 |
| 26 | 3300053728 | Ga0500657_137285 | Ga0500657_137285_103_924 | 241 |
| 27 | 3300009147 | Ga0114129_10461860 | Ga0114129_104618603 | 245 |
| 28 | 3300050494 | nmdc:mga06z11_206351_c1 | nmdc:mga06z11_206351_c1_327_1085 | 245 |
| 29 | 3300005937 | Ga0081455_10005956 | Ga0081455_100059567 | 252 |
| 30 | 3300003911 | JGI25405J52794_10008474 | JGI25405J52794_100084742 | 253 |
| 31 | 3300005290 | Ga0065712_10070433 | Ga0065712_100704333 | 253 |
| 32 | 3300005327 | Ga0070658_10248064 | Ga0070658_102480641 | 253 |
| 33 | 3300005331 | Ga0070670_100167255 | Ga0070670_1001672552 | 253 |
| 34 | 3300005336 | Ga0070680_100260682 | Ga0070680_1002606822 | 253 |
| 35 | 3300005354 | Ga0070675_100066641 | Ga0070675_1000666413 | 253 |
| 36 | 3300005355 | Ga0070671_100143111 | Ga0070671_1001431112 | 253 |
| 37 | 3300005441 | Ga0070700_100001479 | Ga0070700_1000014798 | 253 |
| 38 | 3300005466 | Ga0070685_10079726 | Ga0070685_100797262 | 253 |
| 39 | 3300005530 | Ga0070679_100353151 | Ga0070679_1003531511 | 253 |
| 40 | 3300005547 | Ga0070693_100460563 | Ga0070693_1004605631 | 253 |
| 41 | 3300005564 | Ga0070664_100172884 | Ga0070664_1001728841 | 253 |
| 42 | 3300005564 | Ga0070664_100194310 | Ga0070664_1001943102 | 253 |
| 43 | 3300005617 | Ga0068859_100008041 | Ga0068859_1000080412 | 253 |
| 44 | 3300005617 | Ga0068859_100075510 | Ga0068859_1000755104 | 253 |
| 45 | 3300005937 | Ga0081455_10000031 | Ga0081455_1000003197 | 253 |
| 46 | 3300006353 | Ga0075370_10067599 | Ga0075370_100675993 | 253 |
| 47 | 3300006871 | Ga0075434_100463852 | Ga0075434_1004638522 | 253 |
| 48 | 3300006931 | Ga0097620_100008041 | Ga0097620_10000804110 | 253 |
| 49 | 3300006931 | Ga0097620_100075509 | Ga0097620_1000755092 | 253 |
| 50 | 3300009101 | Ga0105247_10090667 | Ga0105247_100906671 | 253 |
| 51 | 3300009177 | Ga0105248_10066779 | Ga0105248_100667794 | 253 |
| 52 | 3300013297 | Ga0157378_10328020 | Ga0157378_103280202 | 253 |
| 53 | 3300014325 | Ga0163163_10258168 | Ga0163163_102581681 | 253 |
| 54 | 3300025904 | Ga0207647_10005455 | Ga0207647_100054553 | 253 |
| 55 | 3300025918 | Ga0207662_10054658 | Ga0207662_100546582 | 253 |
| 56 | 3300025921 | Ga0207652_10032169 | Ga0207652_100321692 | 253 |
| 57 | 3300025925 | Ga0207650_10136398 | Ga0207650_101363982 | 253 |
| 58 | 3300025936 | Ga0207670_10023023 | Ga0207670_100230232 | 253 |
| 59 | 3300025940 | Ga0207691_10038807 | Ga0207691_100388072 | 253 |
| 60 | 3300025941 | Ga0207711_10097898 | Ga0207711_100978983 | 253 |
| 61 | 3300025945 | Ga0207679_10046232 | Ga0207679_100462323 | 253 |
| 62 | 3300025945 | Ga0207679_10132489 | Ga0207679_101324892 | 253 |
| 63 | 3300025986 | Ga0207658_10051260 | Ga0207658_100512601 | 253 |
| 64 | 3300026075 | Ga0207708_10001296 | Ga0207708_1000129615 | 253 |
| 65 | 3300026118 | Ga0207675_100058184 | Ga0207675_1000581842 | 253 |
| 66 | 3300038996 | Ga0242420_009565 | Ga0242420_009565_55_867 | 253 |
| 67 | 3300048910 | Ga0496107_0125145 | Ga0496107_0125145_826_1638 | 253 |
| 68 | 3300048911 | Ga0496108_0004587 | Ga0496108_0004587_2029_2841 | 253 |
| 69 | 3300048912 | Ga0496109_0001606 | Ga0496109_0001606_8618_9430 | 253 |
| 70 | 3300048913 | Ga0496110_0124481 | Ga0496110_0124481_1054_1866 | 253 |
| 71 | 3300048914 | Ga0496111_0003849 | Ga0496111_0003849_7245_8057 | 253 |
| 72 | 3300048916 | Ga0496113_0000122 | Ga0496113_0000122_30474_31286 | 253 |
| 73 | 3300050496 | nmdc:mga07m45_55105_c2 | nmdc:mga07m45_55105_c2_443_1255 | 253 |
| 74 | 3300005435 | Ga0070714_100058295 | Ga0070714_1000582951 | 255 |
| 75 | 3300005563 | Ga0068855_100526113 | Ga0068855_1005261131 | 255 |
| 76 | 3300025929 | Ga0207664_10258403 | Ga0207664_102584032 | 255 |
| 77 | 3300025949 | Ga0207667_10414291 | Ga0207667_104142911 | 255 |
| 78 | 3300025949 | Ga0207667_10702035 | Ga0207667_107020352 | 255 |
| 79 | 3300050511 | nmdc:mga08y16_235356_c1 | nmdc:mga08y16_235356_c1_407_1219 | 255 |
| 80 | 3300005329 | Ga0070683_100314548 | Ga0070683_1003145482 | 257 |
| 81 | 3300005339 | Ga0070660_100314710 | Ga0070660_1003147101 | 257 |
| 82 | 3300005530 | Ga0070679_100368501 | Ga0070679_1003685012 | 257 |
| 83 | 3300005539 | Ga0068853_100510117 | Ga0068853_1005101171 | 257 |
| 84 | 3300005563 | Ga0068855_100041664 | Ga0068855_1000416643 | 257 |
| 85 | 3300005614 | Ga0068856_100379931 | Ga0068856_1003799312 | 257 |
| 86 | 3300005616 | Ga0068852_100061975 | Ga0068852_1000619752 | 257 |
| 87 | 3300009551 | Ga0105238_10090475 | Ga0105238_100904751 | 257 |
| 88 | 3300013105 | Ga0157369_10269878 | Ga0157369_102698781 | 257 |
| 89 | 3300025909 | Ga0207705_10178857 | Ga0207705_101788571 | 257 |
| 90 | 3300025919 | Ga0207657_10249699 | Ga0207657_102496992 | 257 |
| 91 | 3300025921 | Ga0207652_10228983 | Ga0207652_102289831 | 257 |
| 92 | 3300025924 | Ga0207694_10038909 | Ga0207694_100389096 | 257 |
| 93 | 3300025944 | Ga0207661_10169432 | Ga0207661_101694321 | 257 |
| 94 | 3300025949 | Ga0207667_10047725 | Ga0207667_100477256 | 257 |
| 95 | 3300026142 | Ga0207698_10022747 | Ga0207698_100227476 | 257 |
| 96 | 3300005336 | Ga0070680_100574272 | Ga0070680_1005742721 | 258 |
| 97 | 3300005458 | Ga0070681_10114022 | Ga0070681_101140222 | 258 |
| 98 | 3300036401 | Ga0373937_0284543 | Ga0373937_0284543_22_840 | 259 |
| 99 | 3300046536 | Ga0495587_0130267 | Ga0495587_0130267_344_1162 | 259 |
| 100 | 3300005327 | Ga0070658_10007874 | Ga0070658_100078746 | 260 |
| 101 | 3300005336 | Ga0070680_100081901 | Ga0070680_1000819012 | 260 |
| 102 | 3300005339 | Ga0070660_100099252 | Ga0070660_1000992522 | 260 |
| 103 | 3300005435 | Ga0070714_100019188 | Ga0070714_1000191884 | 260 |
| 104 | 3300005458 | Ga0070681_10058843 | Ga0070681_100588434 | 260 |
| 105 | 3300005530 | Ga0070679_100110111 | Ga0070679_1001101112 | 260 |
| 106 | 3300005563 | Ga0068855_100164426 | Ga0068855_1001644263 | 260 |
| 107 | 3300005616 | Ga0068852_100142231 | Ga0068852_1001422311 | 260 |
| 108 | 3300020081 | Ga0206354_10798211 | Ga0206354_107982111 | 260 |
| 109 | 3300025909 | Ga0207705_10214861 | Ga0207705_102148612 | 260 |
| 110 | 3300025912 | Ga0207707_10048511 | Ga0207707_100485114 | 260 |
| 111 | 3300025913 | Ga0207695_10453642 | Ga0207695_104536422 | 260 |
| 112 | 3300025917 | Ga0207660_10395763 | Ga0207660_103957631 | 260 |
| 113 | 3300025919 | Ga0207657_10009131 | Ga0207657_1000913110 | 260 |
| 114 | 3300025921 | Ga0207652_10100921 | Ga0207652_101009213 | 260 |
| 115 | 3300025929 | Ga0207664_10015866 | Ga0207664_100158663 | 260 |
| 116 | 3300028556 | Ga0265337_1003979 | Ga0265337_10039791 | 260 |
| 117 | 3300031595 | Ga0265313_10065654 | Ga0265313_100656541 | 260 |
| 118 | 3300031711 | Ga0265314_10053185 | Ga0265314_100531851 | 260 |
| 119 | 3300031712 | Ga0265342_10000464 | Ga0265342_1000046413 | 260 |
| 120 | 3300032133 | Ga0316583_10009929 | Ga0316583_100099291 | 260 |
| 121 | 3300044719 | Ga0466971_0171022 | Ga0466971_0171022_85_903 | 260 |
| 122 | 3300049571 | Ga0501034_0529794 | Ga0501034_0529794_159_977 | 260 |
| 123 | 3300049581 | Ga0501047_0020823 | Ga0501047_0020823_5398_6216 | 260 |
| 124 | 3300049590 | Ga0501074_0238835 | Ga0501074_0238835_351_1169 | 260 |
| 125 | 3300049823 | Ga0501044_0133703 | Ga0501044_0133703_1024_1842 | 260 |
| 126 | 3300035695 | Ga0373927_0034422 | Ga0373927_0034422_182_1003 | 262 |
| 127 | 3300035725 | Ga0373947_0066110 | Ga0373947_0066110_1065_1886 | 262 |
| 128 | 3300046454 | Ga0495592_0322310 | Ga0495592_0322310_112_933 | 262 |
| 129 | 3300046462 | Ga0495651_0197468 | Ga0495651_0197468_498_1319 | 262 |
| 130 | 3300046476 | Ga0495662_0007226 | Ga0495662_0007226_3504_4325 | 262 |
| 131 | 3300046477 | Ga0495664_0000202 | Ga0495664_0000202_22634_23455 | 262 |
| 132 | 3300046514 | Ga0495618_0004996 | Ga0495618_0004996_3805_4626 | 262 |
| 133 | 3300046531 | Ga0495665_0033806 | Ga0495665_0033806_1310_2131 | 262 |
| 134 | 3300046533 | Ga0495640_0001275 | Ga0495640_0001275_3721_4542 | 262 |
| 135 | 3300046543 | Ga0495645_0008678 | Ga0495645_0008678_5676_6497 | 262 |
| 136 | 3300046642 | Ga0495634_0003024 | Ga0495634_0003024_12641_13462 | 262 |
| 137 | 3300046663 | Ga0495635_0001332 | Ga0495635_0001332_11892_12710 | 262 |
| 138 | 3300046678 | Ga0495599_0219071 | Ga0495599_0219071_76_897 | 262 |
| 139 | 3300046690 | Ga0495624_0030534 | Ga0495624_0030534_1211_2032 | 262 |
| 140 | 3300047317 | Ga0495604_0057733 | Ga0495604_0057733_924_1745 | 262 |
| 141 | 3300047471 | Ga0495684_0026865 | Ga0495684_0026865_2286_3107 | 262 |
| 142 | 3300053077 | Ga0495601_0001326 | Ga0495601_0001326_5437_6258 | 262 |
| 143 | 3300053085 | Ga0495619_0006059 | Ga0495619_0006059_2169_2990 | 262 |
| 144 | 3300006844 | Ga0075428_100297351 | Ga0075428_1002973512 | 265 |
| 145 | 3300009147 | Ga0114129_10025670 | Ga0114129_100256706 | 265 |
| 146 | 3300050507 | nmdc:mga05p37_965690_c1 | nmdc:mga05p37_965690_c1_59_877 | 265 |
| 147 | 3300031241 | Ga0265325_10054981 | Ga0265325_100549812 | 266 |
| 148 | 3300036401 | Ga0373937_0101502 | Ga0373937_0101502_1671_2507 | 266 |
| 149 | 3300049571 | Ga0501034_0015256 | Ga0501034_0015256_6034_6936 | 266 |
| 150 | 3300049589 | Ga0501073_0078246 | Ga0501073_0078246_1232_2134 | 266 |
| 151 | 3300053084 | Ga0495595_0014314 | Ga0495595_0014314_1925_2761 | 266 |
| 152 | 3300053090 | Ga0500646_0085016 | Ga0500646_0085016_69_881 | 266 |
| 153 | 3300053096 | Ga0500641_0010825 | Ga0500641_0010825_162_974 | 266 |
| 154 | 3300060353 | Ga0501082_0048067 | Ga0501082_0048067_17_829 | 266 |
| 155 | 3300005937 | Ga0081455_10067410 | Ga0081455_100674103 | 267 |
| 156 | 3300005981 | Ga0081538_10019479 | Ga0081538_100194793 | 267 |
| 157 | 3300037853 | Ga0436364_0931038 | Ga0436364_0931038_526_1335 | 267 |
| 158 | 3300049576 | Ga0501040_0256378 | Ga0501040_0256378_17_859 | 267 |
| 159 | 3300049588 | Ga0501072_0076485 | Ga0501072_0076485_494_1336 | 267 |
| 160 | 3300005439 | Ga0070711_100014051 | Ga0070711_1000140515 | 268 |
| 161 | 3300005471 | Ga0070698_100003731 | Ga0070698_10000373115 | 268 |
| 162 | 3300005518 | Ga0070699_100054242 | Ga0070699_1000542424 | 268 |
| 163 | 3300005536 | Ga0070697_100030866 | Ga0070697_1000308664 | 268 |
| 164 | 3300005536 | Ga0070697_100205215 | Ga0070697_1002052152 | 268 |
| 165 | 3300005981 | Ga0081538_10007058 | Ga0081538_100070585 | 268 |
| 166 | 3300005981 | Ga0081538_10008070 | Ga0081538_100080701 | 268 |
| 167 | 3300005983 | Ga0081540_1065179 | Ga0081540_10651791 | 268 |
| 168 | 3300006178 | Ga0075367_10214089 | Ga0075367_102140892 | 268 |
| 169 | 3300006358 | Ga0068871_100466773 | Ga0068871_1004667732 | 268 |
| 170 | 3300006871 | Ga0075434_100039278 | Ga0075434_1000392784 | 268 |
| 171 | 3300007265 | Ga0099794_10010561 | Ga0099794_100105613 | 268 |
| 172 | 3300009094 | Ga0111539_10068290 | Ga0111539_100682903 | 268 |
| 173 | 3300010159 | Ga0099796_10010685 | Ga0099796_100106851 | 268 |
| 174 | 3300014969 | Ga0157376_10452885 | Ga0157376_104528851 | 268 |
| 175 | 3300021384 | Ga0213876_10131612 | Ga0213876_101316122 | 268 |
| 176 | 3300025913 | Ga0207695_10309515 | Ga0207695_103095151 | 268 |
| 177 | 3300025928 | Ga0207700_10267643 | Ga0207700_102676432 | 268 |
| 178 | 3300025929 | Ga0207664_10153980 | Ga0207664_101539802 | 268 |
| 179 | 3300027907 | Ga0207428_10323861 | Ga0207428_103238612 | 268 |
| 180 | 3300031595 | Ga0265313_10000577 | Ga0265313_1000057723 | 268 |
| 181 | 3300033180 | Ga0307510_10045012 | Ga0307510_100450122 | 268 |
| 182 | 3300035117 | Ga0373953_0009710 | Ga0373953_0009710_239_1054 | 268 |
| 183 | 3300035118 | Ga0373954_0014363 | Ga0373954_0014363_2120_2935 | 268 |
| 184 | 3300035119 | Ga0373956_0021026 | Ga0373956_0021026_1407_2222 | 268 |
| 185 | 3300035121 | Ga0373960_0007112 | Ga0373960_0007112_1213_2040 | 268 |
| 186 | 3300035172 | Ga0373955_0063781 | Ga0373955_0063781_286_1101 | 268 |
| 187 | 3300035691 | Ga0373931_0068097 | Ga0373931_0068097_178_1005 | 268 |
| 188 | 3300035692 | Ga0373935_0092923 | Ga0373935_0092923_215_1030 | 268 |
| 189 | 3300035692 | Ga0373935_0242101 | Ga0373935_0242101_250_1077 | 268 |
| 190 | 3300035695 | Ga0373927_0220971 | Ga0373927_0220971_236_1063 | 268 |
| 191 | 3300035724 | Ga0373933_0032376 | Ga0373933_0032376_2044_2859 | 268 |
| 192 | 3300035724 | Ga0373933_0140234 | Ga0373933_0140234_657_1472 | 268 |
| 193 | 3300035725 | Ga0373947_0154914 | Ga0373947_0154914_170_997 | 268 |
| 194 | 3300036401 | Ga0373937_0032614 | Ga0373937_0032614_2467_3285 | 268 |
| 195 | 3300036401 | Ga0373937_0092165 | Ga0373937_0092165_45_860 | 268 |
| 196 | 3300037068 | Ga0373925_0163540 | Ga0373925_0163540_542_1369 | 268 |
| 197 | 3300039437 | Ga0436365_1473399 | Ga0436365_1473399_1790_2617 | 268 |
| 198 | 3300039438 | Ga0436360_0165678 | Ga0436360_0165678_33_848 | 268 |
| 199 | 3300039447 | Ga0436361_0829307 | Ga0436361_0829307_626_1441 | 268 |
| 200 | 3300045049 | Ga0466959_0235829 | Ga0466959_0235829_409_1224 | 268 |
| 201 | 3300046454 | Ga0495592_0011187 | Ga0495592_0011187_2270_3085 | 268 |
| 202 | 3300046455 | Ga0495603_0040354 | Ga0495603_0040354_234_1076 | 268 |
| 203 | 3300046455 | Ga0495603_0312928 | Ga0495603_0312928_61_888 | 268 |
| 204 | 3300046459 | Ga0495629_0021736 | Ga0495629_0021736_236_1051 | 268 |
| 205 | 3300046462 | Ga0495651_0025932 | Ga0495651_0025932_2268_3083 | 268 |
| 206 | 3300046462 | Ga0495651_0051642 | Ga0495651_0051642_86_901 | 268 |
| 207 | 3300046463 | Ga0495653_0049504 | Ga0495653_0049504_468_1283 | 268 |
| 208 | 3300046473 | Ga0495582_0061242 | Ga0495582_0061242_868_1695 | 268 |
| 209 | 3300046477 | Ga0495664_0311679 | Ga0495664_0311679_56_871 | 268 |
| 210 | 3300046511 | Ga0495608_0243620 | Ga0495608_0243620_57_872 | 268 |
| 211 | 3300046514 | Ga0495618_0015879 | Ga0495618_0015879_317_1132 | 268 |
| 212 | 3300046524 | Ga0495648_0001044 | Ga0495648_0001044_594_1415 | 268 |
| 213 | 3300046524 | Ga0495648_0006355 | Ga0495648_0006355_7309_8124 | 268 |
| 214 | 3300046526 | Ga0495666_0077509 | Ga0495666_0077509_622_1449 | 268 |
| 215 | 3300046529 | Ga0495652_0019081 | Ga0495652_0019081_1293_2108 | 268 |
| 216 | 3300046529 | Ga0495652_0085601 | Ga0495652_0085601_596_1417 | 268 |
| 217 | 3300046533 | Ga0495640_0022955 | Ga0495640_0022955_3396_4211 | 268 |
| 218 | 3300046535 | Ga0495586_0027053 | Ga0495586_0027053_1816_2631 | 268 |
| 219 | 3300046536 | Ga0495587_0014525 | Ga0495587_0014525_3057_3872 | 268 |
| 220 | 3300046536 | Ga0495587_0093623 | Ga0495587_0093623_137_958 | 268 |
| 221 | 3300046559 | Ga0495667_0010201 | Ga0495667_0010201_4776_5591 | 268 |
| 222 | 3300046642 | Ga0495634_0036286 | Ga0495634_0036286_1610_2425 | 268 |
| 223 | 3300046675 | Ga0495657_0287555 | Ga0495657_0287555_115_930 | 268 |
| 224 | 3300046679 | Ga0495623_0138795 | Ga0495623_0138795_398_1219 | 268 |
| 225 | 3300046679 | Ga0495623_0158977 | Ga0495623_0158977_213_1028 | 268 |
| 226 | 3300046680 | Ga0495646_0017785 | Ga0495646_0017785_2066_2881 | 268 |
| 227 | 3300046689 | Ga0495613_0282783 | Ga0495613_0282783_165_992 | 268 |
| 228 | 3300047317 | Ga0495604_0061971 | Ga0495604_0061971_140_955 | 268 |
| 229 | 3300047319 | Ga0495674_0065344 | Ga0495674_0065344_1399_2214 | 268 |
| 230 | 3300047322 | Ga0495680_0111769 | Ga0495680_0111769_753_1568 | 268 |
| 231 | 3300047322 | Ga0495680_0173771 | Ga0495680_0173771_565_1386 | 268 |
| 232 | 3300048907 | Ga0496104_0254980 | Ga0496104_0254980_648_1475 | 268 |
| 233 | 3300048913 | Ga0496110_0466719 | Ga0496110_0466719_32_847 | 268 |
| 234 | 3300048917 | Ga0496114_0160443 | Ga0496114_0160443_439_1266 | 268 |
| 235 | 3300048918 | Ga0496115_0251411 | Ga0496115_0251411_353_1180 | 268 |
| 236 | 3300049571 | Ga0501034_0018661 | Ga0501034_0018661_5400_6227 | 268 |
| 237 | 3300049572 | Ga0501036_0001733 | Ga0501036_0001733_11237_12064 | 268 |
| 238 | 3300049573 | Ga0501037_0038753 | Ga0501037_0038753_2397_3224 | 268 |
| 239 | 3300049579 | Ga0501043_0000800 | Ga0501043_0000800_16521_17348 | 268 |
| 240 | 3300049580 | Ga0501046_0019387 | Ga0501046_0019387_2748_3575 | 268 |
| 241 | 3300049581 | Ga0501047_0000136 | Ga0501047_0000136_72362_73189 | 268 |
| 242 | 3300049582 | Ga0501048_0000039 | Ga0501048_0000039_24207_25034 | 268 |
| 243 | 3300049586 | Ga0501070_0019941 | Ga0501070_0019941_466_1293 | 268 |
| 244 | 3300049589 | Ga0501073_0018270 | Ga0501073_0018270_3379_4206 | 268 |
| 245 | 3300049590 | Ga0501074_0005036 | Ga0501074_0005036_4548_5375 | 268 |
| 246 | 3300049742 | Ga0501080_0000022 | Ga0501080_0000022_36698_37525 | 268 |
| 247 | 3300049744 | Ga0501083_0017951 | Ga0501083_0017951_2512_3339 | 268 |
| 248 | 3300049823 | Ga0501044_0009844 | Ga0501044_0009844_3564_4391 | 268 |
| 249 | 3300050511 | nmdc:mga08y16_156759_c1 | nmdc:mga08y16_156759_c1_1461_2288 | 268 |
| 250 | 3300050512 | nmdc:mga0n895_48867_c1 | nmdc:mga0n895_48867_c1_1268_2095 | 268 |
| 251 | 3300053077 | Ga0495601_0031702 | Ga0495601_0031702_1350_2165 | 268 |
| 252 | 3300053077 | Ga0495601_0031899 | Ga0495601_0031899_1388_2203 | 268 |
| 253 | 3300053078 | Ga0495612_0070569 | Ga0495612_0070569_423_1238 | 268 |
| 254 | 3300053080 | Ga0500635_0004901 | Ga0500635_0004901_633_1475 | 268 |
| 255 | 3300053084 | Ga0495595_0001054 | Ga0495595_0001054_2678_3496 | 268 |
| 256 | 3300053084 | Ga0495595_0015875 | Ga0495595_0015875_1807_2622 | 268 |
| 257 | 3300053085 | Ga0495619_0055713 | Ga0495619_0055713_891_1706 | 268 |
| 258 | 3300053102 | Ga0500554_001201 | Ga0500554_001201_223_1065 | 268 |
| 259 | 3300053150 | Ga0500603_000963 | Ga0500603_000963_216_1058 | 268 |
| 260 | 3300053178 | Ga0500637_0008015 | Ga0500637_0008015_244_1086 | 268 |
| 261 | 3300005434 | Ga0070709_10188809 | Ga0070709_101888091 | 269 |
| 262 | 3300005436 | Ga0070713_100106946 | Ga0070713_1001069463 | 269 |
| 263 | 3300005468 | Ga0070707_100071696 | Ga0070707_1000716964 | 269 |
| 264 | 3300005937 | Ga0081455_10014661 | Ga0081455_100146615 | 269 |
| 265 | 3300009147 | Ga0114129_10614974 | Ga0114129_106149742 | 269 |
| 266 | 3300014325 | Ga0163163_10078637 | Ga0163163_100786372 | 269 |
| 267 | 3300014968 | Ga0157379_10127072 | Ga0157379_101270723 | 269 |
| 268 | 3300025912 | Ga0207707_10282688 | Ga0207707_102826881 | 269 |
| 269 | 3300025913 | Ga0207695_10002359 | Ga0207695_1000235921 | 269 |
| 270 | 3300025915 | Ga0207693_10330999 | Ga0207693_103309992 | 269 |
| 271 | 3300025923 | Ga0207681_10009572 | Ga0207681_100095724 | 269 |
| 272 | 3300025924 | Ga0207694_10391505 | Ga0207694_103915052 | 269 |
| 273 | 3300025929 | Ga0207664_10589562 | Ga0207664_105895621 | 269 |
| 274 | 3300027907 | Ga0207428_10313819 | Ga0207428_103138192 | 269 |
| 275 | 3300031247 | Ga0265340_10012862 | Ga0265340_100128625 | 269 |
| 276 | 3300035695 | Ga0373927_0166533 | Ga0373927_0166533_308_1132 | 269 |
| 277 | 3300035725 | Ga0373947_0046323 | Ga0373947_0046323_705_1676 | 269 |
| 278 | 3300037068 | Ga0373925_0049081 | Ga0373925_0049081_1796_2617 | 269 |
| 279 | 3300039437 | Ga0436365_1703167 | Ga0436365_1703167_540_1424 | 269 |
| 280 | 3300039450 | Ga0436363_1285858 | Ga0436363_1285858_290_1102 | 269 |
| 281 | 3300044901 | Ga0466960_0050236 | Ga0466960_0050236_601_1413 | 269 |
| 282 | 3300046491 | Ga0495584_0117346 | Ga0495584_0117346_393_1223 | 269 |
| 283 | 3300046513 | Ga0495616_0081891 | Ga0495616_0081891_429_1259 | 269 |
| 284 | 3300046615 | Ga0495656_0017589 | Ga0495656_0017589_913_1743 | 269 |
| 285 | 3300046664 | Ga0495659_0041121 | Ga0495659_0041121_643_1473 | 269 |
| 286 | 3300048907 | Ga0496104_0083732 | Ga0496104_0083732_1387_2196 | 269 |
| 287 | 3300048910 | Ga0496107_0069702 | Ga0496107_0069702_1415_2224 | 269 |
| 288 | 3300048913 | Ga0496110_0127109 | Ga0496110_0127109_265_1095 | 269 |
| 289 | 3300048913 | Ga0496110_0229515 | Ga0496110_0229515_759_1574 | 269 |
| 290 | 3300048917 | Ga0496114_0382984 | Ga0496114_0382984_420_1229 | 269 |
| 291 | 3300048918 | Ga0496115_0021512 | Ga0496115_0021512_57_866 | 269 |
| 292 | 3300049572 | Ga0501036_0317499 | Ga0501036_0317499_67_909 | 269 |
| 293 | 3300050508 | nmdc:mga09592_172062_c1 | nmdc:mga09592_172062_c1_196_1071 | 269 |
| 294 | 3300050509 | nmdc:mga0qj67_7972_c1 | nmdc:mga0qj67_7972_c1_6322_7206 | 269 |
| 295 | 3300050510 | nmdc:mga06r32_13372_c1 | nmdc:mga06r32_13372_c1_1583_2467 | 269 |
| 296 | 3300050510 | nmdc:mga06r32_9960_c1 | nmdc:mga06r32_9960_c1_3592_4467 | 269 |
| 297 | 3300050511 | nmdc:mga08y16_144820_c1 | nmdc:mga08y16_144820_c1_1239_2066 | 269 |
| 298 | 3300054114 | Ga0501084_0369649 | Ga0501084_0369649_269_1111 | 269 |
| 299 | 3300060353 | Ga0501082_0161091 | Ga0501082_0161091_976_1818 | 269 |
| 300 | 3300003659 | JGI25404J52841_10006864 | JGI25404J52841_100068643 | 270 |
| 301 | 3300005983 | Ga0081540_1001200 | Ga0081540_100120020 | 270 |
| 302 | 3300006175 | Ga0070712_100042462 | Ga0070712_1000424622 | 270 |
| 303 | 3300020082 | Ga0206353_10980335 | Ga0206353_109803351 | 270 |
| 304 | 3300025928 | Ga0207700_10529708 | Ga0207700_105297081 | 270 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p97-assembly1.cif.gz_A | crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution | 0.7738 | 54 | 263 |
| 2p97-assembly1.cif.gz_A | crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution | 0.7634 | 54 | 263 |
| 6lfd-assembly3.cif.gz_C | crystal structure of vmb-1 at ph5.5(bis-tris) | 0.7585 | 53 | 270 |
| 5mmd-assembly2.cif.gz_F | tmb-1. structural insights into tmb-1 and the role of residue 119 and 228 in substrate and inhibitor binding | 0.7439 | 53 | 270 |
| 6lfd-assembly3.cif.gz_C | crystal structure of vmb-1 at ph5.5(bis-tris) | 0.7432 | 53 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FV07_32_193_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7648 | 77 | 242 | 3.60.15.10 |
| af_Q8RWE1_144_338_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7549 | 60 | 265 | 3.60.15.10 |
| af_A0A1D6QA38_128_270_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7515 | 73 | 210 | 3.60.15.10 |
| af_Q8RWE1_144_338_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7443 | 60 | 265 | 3.60.15.10 |
| 2p97B00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7318 | 50 | 264 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C3QIA7-F1-model_v4 | MBL fold metallo-hydrolase | 0.9957 | 3 | 268 |
GO:0016787
|
| AF-A0A7W1AX02-F1-model_v4 | MBL fold metallo-hydrolase | 0.9956 | 136 | 269 |
GO:0016787
|
| AF-A0A140K036-F1-model_v4 | Metallo-beta-lactamase domain-containing protein | 0.9944 | 123 | 270 |
|
| AF-A0A6H2BUP6-F1-model_v4 | deleted | 0.9935 | 3 | 268 |
|
| AF-A0A1T4REB5-F1-model_v4 | Metallo-beta-lactamase domain-containing protein | 0.9923 | 3 | 268 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar