F397680

General Info

Members Datasets Scaffolds Average Seq Length
304 199 304 267

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0046323|Ga0373947_0046323_705_1676
Length 323
Sequence MPAFICTACGAQFAPSEAPPAQCPICEDERQYVPPRGQTWTTLPALAASHFNSYREHAPGVIGIGTQPAFAIGQRALLLRTAGGNVLWDCISLLDAATVTLIGALGGIKAIAISHPHFYTGMVEWSRAFGGVPIHLHAADRAWIMRPDPAIRPWEGETLALMPGVTLVRCGGHFPGGTVLHWAEGAGGRGVLCAGDIAAVAPDRKWLAFMKSYPNFIPLSAGEVDGIAAALAPFQFDIIYGHYFDRVIPTGGKAVLAASVALSRRDRRPAAGLNEADTGQSRKPSTIIGHRTPILLQRPANWERAPAGCGQCQPPRSAHSKPF

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
195 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
196 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
197 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 5.26
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10006864 3300003659 Bacteria 2393
2 JGI25405J52794_10008474 3300003911 Bacteria 1921
3 Ga0065712_10070433 3300005290 Bacteria 6010
4 Ga0070658_10007874 3300005327 Bacteria 8582
5 Ga0070658_10248064 3300005327 Bacteria 1510
6 Ga0070683_100314548 3300005329 Bacteria 1490
7 Ga0070670_100167255 3300005331 Bacteria 1907
8 Ga0070680_100081901 3300005336 Bacteria 2663
9 Ga0070680_100260682 3300005336 Bacteria 1466
10 Ga0070680_100574272 3300005336 Bacteria 967
11 Ga0070660_100099252 3300005339 Bacteria 2305
12 Ga0070660_100314710 3300005339 Bacteria 1285
13 Ga0070675_100066641 3300005354 Bacteria 2978
14 Ga0070671_100143111 3300005355 Bacteria 2018
15 Ga0070709_10188809 3300005434 Bacteria 1452
16 Ga0070714_100019188 3300005435 Bacteria 5565
17 Ga0070714_100058295 3300005435 Bacteria 3307
18 Ga0070713_100106946 3300005436 Bacteria 2433
19 Ga0070713_100682376 3300005436 Unclassified 980
20 Ga0070711_100014051 3300005439 Bacteria 5038
21 Ga0070700_100001479 3300005441 Bacteria 11696
22 Ga0070681_10058843 3300005458 Bacteria 3822
23 Ga0070681_10114022 3300005458 Bacteria 2642
24 Ga0070685_10079726 3300005466 Bacteria 1960
25 Ga0070707_100071696 3300005468 Bacteria 3337
26 Ga0070698_100003731 3300005471 Bacteria 16739
27 Ga0070699_100054242 3300005518 Bacteria 3469
28 Ga0070679_100110111 3300005530 Bacteria 2740
29 Ga0070679_100353151 3300005530 Bacteria 1418
30 Ga0070679_100368501 3300005530 Bacteria 1383
31 Ga0070697_100030866 3300005536 Bacteria 4307
32 Ga0070697_100205215 3300005536 Bacteria 1676
33 Ga0068853_100510117 3300005539 Bacteria 1136
34 Ga0070693_100460563 3300005547 Unclassified 894
35 Ga0068855_100041664 3300005563 Bacteria 5441
36 Ga0068855_100164426 3300005563 Bacteria 2516
37 Ga0068855_100526113 3300005563 Bacteria 1282
38 Ga0070664_100172884 3300005564 Bacteria 1917
39 Ga0070664_100194310 3300005564 Bacteria 1809
40 Ga0068856_100379931 3300005614 Bacteria 1432
41 Ga0068852_100061975 3300005616 Bacteria 3251
42 Ga0068852_100142231 3300005616 Bacteria 2222
43 Ga0068859_100008041 3300005617 Bacteria 10692
44 Ga0068859_100075510 3300005617 Bacteria 3411
45 Ga0081455_10000031 3300005937 Bacteria 146486
46 Ga0081455_10005956 3300005937 Bacteria 13223
47 Ga0081455_10014661 3300005937 Bacteria 7663
48 Ga0081455_10054090 3300005937 Bacteria 3424
49 Ga0081455_10067410 3300005937 Bacteria 2982
50 Ga0081538_10007058 3300005981 Bacteria 9767
51 Ga0081538_10008070 3300005981 Bacteria 8990
52 Ga0081538_10019479 3300005981 Bacteria 5040
53 Ga0081540_1001200 3300005983 Bacteria 22696
54 Ga0081540_1065179 3300005983 Bacteria 1714
55 Ga0070712_100042462 3300006175 Bacteria 3127
56 Ga0075367_10214089 3300006178 Unclassified 1205
57 Ga0075370_10067599 3300006353 Bacteria 2040
58 Ga0068871_100466773 3300006358 Bacteria 1133
59 Ga0075428_100297351 3300006844 Bacteria 1736
60 Ga0075434_100039278 3300006871 Bacteria 4689
61 Ga0075434_100463852 3300006871 Unclassified 1288
62 Ga0097620_100008041 3300006931 Bacteria 10692
63 Ga0097620_100075509 3300006931 Bacteria 3411
64 Ga0099794_10010561 3300007265 Plasmid 3926
65 Ga0111539_10068290 3300009094 Bacteria 4196
66 Ga0105247_10090667 3300009101 Bacteria 1940
67 Ga0114129_10025670 3300009147 Bacteria 8347
68 Ga0114129_10461860 3300009147 Bacteria 1664
69 Ga0114129_10614974 3300009147 Bacteria 1406
70 Ga0105248_10066779 3300009177 Bacteria 4038
71 Ga0105238_10090475 3300009551 Bacteria 3047
72 Ga0099796_10010685 3300010159 Bacteria 2533
73 Ga0157369_10269878 3300013105 Bacteria 1773
74 Ga0157378_10328020 3300013297 Bacteria 1489
75 Ga0163163_10078637 3300014325 Bacteria 3295
76 Ga0163163_10258168 3300014325 Unclassified 1793
77 Ga0157379_10127072 3300014968 Bacteria 2294
78 Ga0157376_10452885 3300014969 Bacteria 1252
79 Ga0206354_10798211 3300020081 Bacteria 986
80 Ga0206353_10980335 3300020082 Bacteria 1295
81 Ga0213876_10131612 3300021384 Bacteria 1329
82 Ga0207647_10005455 3300025904 Bacteria 9319
83 Ga0207705_10178857 3300025909 Bacteria 1600
84 Ga0207705_10214861 3300025909 Bacteria 1459
85 Ga0207707_10048511 3300025912 Bacteria 3698
86 Ga0207707_10282688 3300025912 Bacteria 1437
87 Ga0207695_10002359 3300025913 Bacteria 28068
88 Ga0207695_10309515 3300025913 Unclassified 1470
89 Ga0207695_10453642 3300025913 Bacteria 1165
90 Ga0207693_10330999 3300025915 Bacteria 1192
91 Ga0207660_10395763 3300025917 Bacteria 1112
92 Ga0207662_10054658 3300025918 Bacteria 2381
93 Ga0207657_10009131 3300025919 Bacteria 10005
94 Ga0207657_10249699 3300025919 Bacteria 1415
95 Ga0207652_10032169 3300025921 Bacteria 4407
96 Ga0207652_10100921 3300025921 Bacteria 2548
97 Ga0207652_10228983 3300025921 Bacteria 1675
98 Ga0207681_10009572 3300025923 Bacteria 5923
99 Ga0207694_10038909 3300025924 Bacteria 3658
100 Ga0207694_10391505 3300025924 Bacteria 1155
101 Ga0207650_10136398 3300025925 Bacteria 1925
102 Ga0207700_10267643 3300025928 Bacteria 1466
103 Ga0207700_10529708 3300025928 Bacteria 1044
104 Ga0207664_10015866 3300025929 Bacteria 5484
105 Ga0207664_10153980 3300025929 Bacteria 1955
106 Ga0207664_10258403 3300025929 Bacteria 1522
107 Ga0207664_10589562 3300025929 Bacteria 998
108 Ga0207670_10023023 3300025936 Bacteria 3870
109 Ga0207691_10038807 3300025940 Bacteria 4407
110 Ga0207711_10097898 3300025941 Bacteria 2591
111 Ga0207661_10169432 3300025944 Bacteria 1900
112 Ga0207679_10046232 3300025945 Bacteria 3154
113 Ga0207679_10132489 3300025945 Bacteria 2002
114 Ga0207667_10047725 3300025949 Bacteria 4531
115 Ga0207667_10414291 3300025949 Bacteria 1371
116 Ga0207667_10702035 3300025949 Bacteria 1014
117 Ga0207658_10051260 3300025986 Bacteria 3041
118 Ga0207708_10001296 3300026075 Bacteria 18801
119 Ga0207675_100058184 3300026118 Bacteria 3607
120 Ga0207698_10022747 3300026142 Bacteria 4365
121 Ga0207428_10313819 3300027907 Bacteria 1159
122 Ga0207428_10323861 3300027907 Bacteria 1138
123 Ga0265337_1003979 3300028556 Bacteria 6253
124 Ga0265325_10054981 3300031241 Bacteria 2037
125 Ga0265340_10012862 3300031247 Bacteria 4412
126 Ga0265313_10000577 3300031595 Bacteria 38251
127 Ga0265313_10065654 3300031595 Bacteria 1684
128 Ga0265314_10053185 3300031711 Bacteria 2810
129 Ga0265342_10000464 3300031712 Bacteria 43974
130 Ga0316583_10009929 3300032133 Bacteria 3429
131 Ga0307510_10045012 3300033180 Bacteria 4772
132 Ga0373944_0017604 3300035089 Bacteria 2031
133 Ga0373945_0003525 3300035116 Bacteria 4930
134 Ga0373953_0009710 3300035117 Bacteria 3322
135 Ga0373954_0014363 3300035118 Bacteria 3531
136 Ga0373956_0021026 3300035119 Bacteria 2781
137 Ga0373960_0007112 3300035121 Bacteria 2643
138 Ga0373943_0002092 3300035170 Bacteria 9063
139 Ga0373946_0006291 3300035171 Bacteria 4302
140 Ga0373955_0063781 3300035172 Bacteria 2040
141 Ga0373924_0044418 3300035410 Bacteria 1826
142 Ga0373931_0068097 3300035691 Bacteria 1937
143 Ga0373935_0008707 3300035692 Bacteria 6077
144 Ga0373935_0092923 3300035692 Bacteria 1978
145 Ga0373935_0242101 3300035692 Bacteria 1260
146 Ga0373927_0002617 3300035695 Bacteria 13120
147 Ga0373927_0034422 3300035695 Bacteria 3295
148 Ga0373927_0166533 3300035695 Bacteria 1444
149 Ga0373927_0220971 3300035695 Bacteria 1244
150 Ga0373933_0032376 3300035724 Bacteria 3039
151 Ga0373933_0140234 3300035724 Bacteria 1526
152 Ga0373947_0000303 3300035725 Bacteria 27751
153 Ga0373947_0046323 3300035725 Bacteria 2604
154 Ga0373947_0066110 3300035725 Bacteria 2206
155 Ga0373947_0154914 3300035725 Bacteria 1478
156 Ga0373937_0032614 3300036401 Bacteria 4725
157 Ga0373937_0092165 3300036401 Bacteria 2808
158 Ga0373937_0101502 3300036401 Bacteria 2670
159 Ga0373937_0284543 3300036401 Unclassified 1562
160 Ga0373925_0049081 3300037068 Bacteria 3146
161 Ga0373925_0163540 3300037068 Bacteria 1754
162 Ga0436364_0931038 3300037853 Bacteria 1812
163 Ga0242420_009565 3300038996 Bacteria 1592
164 Ga0436365_1473399 3300039437 Bacteria 8261
165 Ga0436365_1703167 3300039437 Bacteria 2218
166 Ga0436360_0165678 3300039438 Bacteria 1002
167 Ga0436361_0829307 3300039447 Bacteria 1563
168 Ga0436363_1285858 3300039450 Bacteria 1161
169 Ga0466971_0171022 3300044719 Bacteria 1020
170 Ga0466960_0050236 3300044901 Bacteria 2010
171 Ga0466959_0235829 3300045049 Bacteria 1265
172 Ga0495592_0011187 3300046454 Bacteria 6779
173 Ga0495592_0322310 3300046454 Bacteria 998
174 Ga0495603_0040354 3300046455 Bacteria 2794
175 Ga0495603_0312928 3300046455 Bacteria 902
176 Ga0495629_0021736 3300046459 Bacteria 4578
177 Ga0495629_0150537 3300046459 Bacteria 1617
178 Ga0495651_0025932 3300046462 Bacteria 4564
179 Ga0495651_0051642 3300046462 Bacteria 3169
180 Ga0495651_0197468 3300046462 Bacteria 1411
181 Ga0495653_0049504 3300046463 Bacteria 3236
182 Ga0495580_0071122 3300046472 Bacteria 2430
183 Ga0495582_0061242 3300046473 Bacteria 2078
184 Ga0495639_0089919 3300046475 Bacteria 1439
185 Ga0495662_0007226 3300046476 Bacteria 5497
186 Ga0495664_0000202 3300046477 Bacteria 28893
187 Ga0495664_0311679 3300046477 Bacteria 949
188 Ga0495584_0117346 3300046491 Bacteria 1347
189 Ga0495608_0243620 3300046511 Bacteria 1122
190 Ga0495616_0081891 3300046513 Bacteria 1543
191 Ga0495618_0004996 3300046514 Bacteria 8105
192 Ga0495618_0015879 3300046514 Bacteria 4596
193 Ga0495648_0001044 3300046524 Bacteria 28102
194 Ga0495648_0006355 3300046524 Bacteria 9660
195 Ga0495666_0077509 3300046526 Bacteria 1575
196 Ga0495652_0019081 3300046529 Bacteria 6107
197 Ga0495652_0085601 3300046529 Bacteria 2590
198 Ga0495665_0033806 3300046531 Bacteria 2734
199 Ga0495665_0059616 3300046531 Bacteria 2014
200 Ga0495640_0001275 3300046533 Bacteria 19760
201 Ga0495640_0022955 3300046533 Bacteria 4556
202 Ga0495640_0111073 3300046533 Bacteria 1791
203 Ga0495586_0027053 3300046535 Bacteria 3069
204 Ga0495587_0014525 3300046536 Bacteria 4937
205 Ga0495587_0093623 3300046536 Bacteria 1735
206 Ga0495587_0130267 3300046536 Bacteria 1438
207 Ga0495645_0008678 3300046543 Bacteria 7099
208 Ga0495667_0010201 3300046559 Bacteria 6357
209 Ga0495656_0017589 3300046615 Bacteria 2730
210 Ga0495634_0003024 3300046642 Bacteria 13688
211 Ga0495634_0036286 3300046642 Bacteria 3372
212 Ga0495634_0050976 3300046642 Bacteria 2778
213 Ga0495635_0001332 3300046663 Bacteria 16434
214 Ga0495659_0041121 3300046664 Bacteria 1650
215 Ga0495657_0287555 3300046675 Bacteria 982
216 Ga0495599_0219071 3300046678 Bacteria 1165
217 Ga0495623_0138795 3300046679 Bacteria 1448
218 Ga0495623_0158977 3300046679 Bacteria 1329
219 Ga0495646_0017785 3300046680 Bacteria 4506
220 Ga0495658_0168716 3300046683 Bacteria 1353
221 Ga0495613_0066317 3300046689 Bacteria 2636
222 Ga0495613_0282783 3300046689 Bacteria 1152
223 Ga0495624_0010397 3300046690 Bacteria 6413
224 Ga0495624_0030534 3300046690 Bacteria 3509
225 Ga0495604_0057733 3300047317 Bacteria 2983
226 Ga0495604_0061971 3300047317 Bacteria 2859
227 Ga0495674_0065344 3300047319 Bacteria 3160
228 Ga0495680_0111769 3300047322 Bacteria 2024
229 Ga0495680_0173771 3300047322 Bacteria 1558
230 Ga0495675_0016456 3300047444 Bacteria 4678
231 Ga0495684_0010372 3300047471 Bacteria 7206
232 Ga0495684_0026865 3300047471 Bacteria 4422
233 Ga0495684_0140408 3300047471 Bacteria 1811
234 Ga0495684_0243515 3300047471 Bacteria 1310
235 Ga0495593_0042456 3300047673 Bacteria 2440
236 Ga0495602_0371668 3300048088 Bacteria 1026
237 Ga0496104_0083732 3300048907 Bacteria 3042
238 Ga0496104_0254980 3300048907 Bacteria 1667
239 Ga0496107_0069702 3300048910 Bacteria 2553
240 Ga0496107_0125145 3300048910 Unclassified 1895
241 Ga0496108_0004587 3300048911 Bacteria 11131
242 Ga0496109_0001606 3300048912 Bacteria 18869
243 Ga0496110_0124481 3300048913 Bacteria 2325
244 Ga0496110_0127109 3300048913 Bacteria 2300
245 Ga0496110_0229515 3300048913 Bacteria 1688
246 Ga0496110_0466719 3300048913 Unclassified 1150
247 Ga0496111_0003849 3300048914 Bacteria 9377
248 Ga0496113_0000122 3300048916 Bacteria 33708
249 Ga0496114_0160443 3300048917 Bacteria 1954
250 Ga0496114_0382984 3300048917 Bacteria 1245
251 Ga0496115_0021512 3300048918 Bacteria 4985
252 Ga0496115_0251411 3300048918 Bacteria 1455
253 Ga0501034_0015256 3300049571 Bacteria 7896
254 Ga0501034_0018661 3300049571 Bacteria 7109
255 Ga0501034_0529794 3300049571 Bacteria 1089
256 Ga0501036_0001733 3300049572 Bacteria 16942
257 Ga0501036_0317499 3300049572 Bacteria 1302
258 Ga0501037_0038753 3300049573 Bacteria 3510
259 Ga0501040_0256378 3300049576 Unclassified 1248
260 Ga0501043_0000800 3300049579 Bacteria 27945
261 Ga0501046_0019387 3300049580 Bacteria 5643
262 Ga0501047_0000136 3300049581 Bacteria 89236
263 Ga0501047_0020823 3300049581 Bacteria 6300
264 Ga0501048_0000039 3300049582 Bacteria 63521
265 Ga0501070_0019941 3300049586 Bacteria 5622
266 Ga0501072_0076485 3300049588 Bacteria 2649
267 Ga0501073_0018270 3300049589 Bacteria 5066
268 Ga0501073_0078246 3300049589 Bacteria 2301
269 Ga0501074_0005036 3300049590 Bacteria 9481
270 Ga0501074_0238835 3300049590 Bacteria 1293
271 Ga0501080_0000022 3300049742 Bacteria 90630
272 Ga0501083_0017951 3300049744 Bacteria 4934
273 Ga0501044_0009844 3300049823 Bacteria 10390
274 Ga0501044_0133703 3300049823 Bacteria 2473
275 nmdc:mga06z11_206351_c1 3300050494 Bacteria 1143
276 nmdc:mga07m45_55105_c2 3300050496 Bacteria 1903
277 nmdc:mga05p37_965690_c1 3300050507 Bacteria 910
278 nmdc:mga09592_172062_c1 3300050508 Bacteria 1873
279 nmdc:mga0qj67_7972_c1 3300050509 Bacteria 7831
280 nmdc:mga06r32_13372_c1 3300050510 Bacteria 7433
281 nmdc:mga06r32_9960_c1 3300050510 Bacteria 8577
282 nmdc:mga08y16_144820_c1 3300050511 Bacteria 2470
283 nmdc:mga08y16_156759_c1 3300050511 Bacteria 2366
284 nmdc:mga08y16_235356_c1 3300050511 Unclassified 1894
285 nmdc:mga0n895_48867_c1 3300050512 Bacteria 4143
286 Ga0495601_0001326 3300053077 Bacteria 13593
287 Ga0495601_0031702 3300053077 Bacteria 3286
288 Ga0495601_0031899 3300053077 Bacteria 3276
289 Ga0495612_0070569 3300053078 Bacteria 1456
290 Ga0500635_0004901 3300053080 Bacteria 3475
291 Ga0495595_0001054 3300053084 Bacteria 10648
292 Ga0495595_0014314 3300053084 Bacteria 3363
293 Ga0495595_0015875 3300053084 Bacteria 3215
294 Ga0495619_0006059 3300053085 Bacteria 7659
295 Ga0495619_0055713 3300053085 Bacteria 2619
296 Ga0500646_0085016 3300053090 Viruses 971
297 Ga0500641_0010825 3300053096 Bacteria 3304
298 Ga0500554_001201 3300053102 Bacteria 5027
299 Ga0500603_000963 3300053150 Bacteria 6805
300 Ga0500637_0008015 3300053178 Bacteria 5307
301 Ga0500657_137285 3300053728 Unclassified 936
302 Ga0501084_0369649 3300054114 Bacteria 1212
303 Ga0501082_0048067 3300060353 Bacteria 3677
304 Ga0501082_0161091 3300060353 Bacteria 1950

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10054090 Ga0081455_100540905 236
2 3300047444 Ga0495675_0016456 Ga0495675_0016456_49_768 236
3 3300047471 Ga0495684_0140408 Ga0495684_0140408_55_774 236
4 3300048088 Ga0495602_0371668 Ga0495602_0371668_54_773 236
5 3300005436 Ga0070713_100682376 Ga0070713_1006823761 241
6 3300035089 Ga0373944_0017604 Ga0373944_0017604_257_1078 241
7 3300035116 Ga0373945_0003525 Ga0373945_0003525_3576_4397 241
8 3300035170 Ga0373943_0002092 Ga0373943_0002092_6916_7737 241
9 3300035171 Ga0373946_0006291 Ga0373946_0006291_2509_3330 241
10 3300035410 Ga0373924_0044418 Ga0373924_0044418_688_1509 241
11 3300035692 Ga0373935_0008707 Ga0373935_0008707_3771_4592 241
12 3300035695 Ga0373927_0002617 Ga0373927_0002617_8467_9288 241
13 3300035725 Ga0373947_0000303 Ga0373947_0000303_16384_17205 241
14 3300046459 Ga0495629_0150537 Ga0495629_0150537_186_1007 241
15 3300046472 Ga0495580_0071122 Ga0495580_0071122_1080_1901 241
16 3300046475 Ga0495639_0089919 Ga0495639_0089919_148_969 241
17 3300046531 Ga0495665_0059616 Ga0495665_0059616_834_1673 241
18 3300046533 Ga0495640_0111073 Ga0495640_0111073_488_1309 241
19 3300046642 Ga0495634_0050976 Ga0495634_0050976_1636_2475 241
20 3300046683 Ga0495658_0168716 Ga0495658_0168716_156_977 241
21 3300046689 Ga0495613_0066317 Ga0495613_0066317_1269_2090 241
22 3300046690 Ga0495624_0010397 Ga0495624_0010397_4473_5294 241
23 3300047471 Ga0495684_0010372 Ga0495684_0010372_4748_5569 241
24 3300047471 Ga0495684_0243515 Ga0495684_0243515_349_1188 241
25 3300047673 Ga0495593_0042456 Ga0495593_0042456_476_1297 241
26 3300053728 Ga0500657_137285 Ga0500657_137285_103_924 241
27 3300009147 Ga0114129_10461860 Ga0114129_104618603 245
28 3300050494 nmdc:mga06z11_206351_c1 nmdc:mga06z11_206351_c1_327_1085 245
29 3300005937 Ga0081455_10005956 Ga0081455_100059567 252
30 3300003911 JGI25405J52794_10008474 JGI25405J52794_100084742 253
31 3300005290 Ga0065712_10070433 Ga0065712_100704333 253
32 3300005327 Ga0070658_10248064 Ga0070658_102480641 253
33 3300005331 Ga0070670_100167255 Ga0070670_1001672552 253
34 3300005336 Ga0070680_100260682 Ga0070680_1002606822 253
35 3300005354 Ga0070675_100066641 Ga0070675_1000666413 253
36 3300005355 Ga0070671_100143111 Ga0070671_1001431112 253
37 3300005441 Ga0070700_100001479 Ga0070700_1000014798 253
38 3300005466 Ga0070685_10079726 Ga0070685_100797262 253
39 3300005530 Ga0070679_100353151 Ga0070679_1003531511 253
40 3300005547 Ga0070693_100460563 Ga0070693_1004605631 253
41 3300005564 Ga0070664_100172884 Ga0070664_1001728841 253
42 3300005564 Ga0070664_100194310 Ga0070664_1001943102 253
43 3300005617 Ga0068859_100008041 Ga0068859_1000080412 253
44 3300005617 Ga0068859_100075510 Ga0068859_1000755104 253
45 3300005937 Ga0081455_10000031 Ga0081455_1000003197 253
46 3300006353 Ga0075370_10067599 Ga0075370_100675993 253
47 3300006871 Ga0075434_100463852 Ga0075434_1004638522 253
48 3300006931 Ga0097620_100008041 Ga0097620_10000804110 253
49 3300006931 Ga0097620_100075509 Ga0097620_1000755092 253
50 3300009101 Ga0105247_10090667 Ga0105247_100906671 253
51 3300009177 Ga0105248_10066779 Ga0105248_100667794 253
52 3300013297 Ga0157378_10328020 Ga0157378_103280202 253
53 3300014325 Ga0163163_10258168 Ga0163163_102581681 253
54 3300025904 Ga0207647_10005455 Ga0207647_100054553 253
55 3300025918 Ga0207662_10054658 Ga0207662_100546582 253
56 3300025921 Ga0207652_10032169 Ga0207652_100321692 253
57 3300025925 Ga0207650_10136398 Ga0207650_101363982 253
58 3300025936 Ga0207670_10023023 Ga0207670_100230232 253
59 3300025940 Ga0207691_10038807 Ga0207691_100388072 253
60 3300025941 Ga0207711_10097898 Ga0207711_100978983 253
61 3300025945 Ga0207679_10046232 Ga0207679_100462323 253
62 3300025945 Ga0207679_10132489 Ga0207679_101324892 253
63 3300025986 Ga0207658_10051260 Ga0207658_100512601 253
64 3300026075 Ga0207708_10001296 Ga0207708_1000129615 253
65 3300026118 Ga0207675_100058184 Ga0207675_1000581842 253
66 3300038996 Ga0242420_009565 Ga0242420_009565_55_867 253
67 3300048910 Ga0496107_0125145 Ga0496107_0125145_826_1638 253
68 3300048911 Ga0496108_0004587 Ga0496108_0004587_2029_2841 253
69 3300048912 Ga0496109_0001606 Ga0496109_0001606_8618_9430 253
70 3300048913 Ga0496110_0124481 Ga0496110_0124481_1054_1866 253
71 3300048914 Ga0496111_0003849 Ga0496111_0003849_7245_8057 253
72 3300048916 Ga0496113_0000122 Ga0496113_0000122_30474_31286 253
73 3300050496 nmdc:mga07m45_55105_c2 nmdc:mga07m45_55105_c2_443_1255 253
74 3300005435 Ga0070714_100058295 Ga0070714_1000582951 255
75 3300005563 Ga0068855_100526113 Ga0068855_1005261131 255
76 3300025929 Ga0207664_10258403 Ga0207664_102584032 255
77 3300025949 Ga0207667_10414291 Ga0207667_104142911 255
78 3300025949 Ga0207667_10702035 Ga0207667_107020352 255
79 3300050511 nmdc:mga08y16_235356_c1 nmdc:mga08y16_235356_c1_407_1219 255
80 3300005329 Ga0070683_100314548 Ga0070683_1003145482 257
81 3300005339 Ga0070660_100314710 Ga0070660_1003147101 257
82 3300005530 Ga0070679_100368501 Ga0070679_1003685012 257
83 3300005539 Ga0068853_100510117 Ga0068853_1005101171 257
84 3300005563 Ga0068855_100041664 Ga0068855_1000416643 257
85 3300005614 Ga0068856_100379931 Ga0068856_1003799312 257
86 3300005616 Ga0068852_100061975 Ga0068852_1000619752 257
87 3300009551 Ga0105238_10090475 Ga0105238_100904751 257
88 3300013105 Ga0157369_10269878 Ga0157369_102698781 257
89 3300025909 Ga0207705_10178857 Ga0207705_101788571 257
90 3300025919 Ga0207657_10249699 Ga0207657_102496992 257
91 3300025921 Ga0207652_10228983 Ga0207652_102289831 257
92 3300025924 Ga0207694_10038909 Ga0207694_100389096 257
93 3300025944 Ga0207661_10169432 Ga0207661_101694321 257
94 3300025949 Ga0207667_10047725 Ga0207667_100477256 257
95 3300026142 Ga0207698_10022747 Ga0207698_100227476 257
96 3300005336 Ga0070680_100574272 Ga0070680_1005742721 258
97 3300005458 Ga0070681_10114022 Ga0070681_101140222 258
98 3300036401 Ga0373937_0284543 Ga0373937_0284543_22_840 259
99 3300046536 Ga0495587_0130267 Ga0495587_0130267_344_1162 259
100 3300005327 Ga0070658_10007874 Ga0070658_100078746 260
101 3300005336 Ga0070680_100081901 Ga0070680_1000819012 260
102 3300005339 Ga0070660_100099252 Ga0070660_1000992522 260
103 3300005435 Ga0070714_100019188 Ga0070714_1000191884 260
104 3300005458 Ga0070681_10058843 Ga0070681_100588434 260
105 3300005530 Ga0070679_100110111 Ga0070679_1001101112 260
106 3300005563 Ga0068855_100164426 Ga0068855_1001644263 260
107 3300005616 Ga0068852_100142231 Ga0068852_1001422311 260
108 3300020081 Ga0206354_10798211 Ga0206354_107982111 260
109 3300025909 Ga0207705_10214861 Ga0207705_102148612 260
110 3300025912 Ga0207707_10048511 Ga0207707_100485114 260
111 3300025913 Ga0207695_10453642 Ga0207695_104536422 260
112 3300025917 Ga0207660_10395763 Ga0207660_103957631 260
113 3300025919 Ga0207657_10009131 Ga0207657_1000913110 260
114 3300025921 Ga0207652_10100921 Ga0207652_101009213 260
115 3300025929 Ga0207664_10015866 Ga0207664_100158663 260
116 3300028556 Ga0265337_1003979 Ga0265337_10039791 260
117 3300031595 Ga0265313_10065654 Ga0265313_100656541 260
118 3300031711 Ga0265314_10053185 Ga0265314_100531851 260
119 3300031712 Ga0265342_10000464 Ga0265342_1000046413 260
120 3300032133 Ga0316583_10009929 Ga0316583_100099291 260
121 3300044719 Ga0466971_0171022 Ga0466971_0171022_85_903 260
122 3300049571 Ga0501034_0529794 Ga0501034_0529794_159_977 260
123 3300049581 Ga0501047_0020823 Ga0501047_0020823_5398_6216 260
124 3300049590 Ga0501074_0238835 Ga0501074_0238835_351_1169 260
125 3300049823 Ga0501044_0133703 Ga0501044_0133703_1024_1842 260
126 3300035695 Ga0373927_0034422 Ga0373927_0034422_182_1003 262
127 3300035725 Ga0373947_0066110 Ga0373947_0066110_1065_1886 262
128 3300046454 Ga0495592_0322310 Ga0495592_0322310_112_933 262
129 3300046462 Ga0495651_0197468 Ga0495651_0197468_498_1319 262
130 3300046476 Ga0495662_0007226 Ga0495662_0007226_3504_4325 262
131 3300046477 Ga0495664_0000202 Ga0495664_0000202_22634_23455 262
132 3300046514 Ga0495618_0004996 Ga0495618_0004996_3805_4626 262
133 3300046531 Ga0495665_0033806 Ga0495665_0033806_1310_2131 262
134 3300046533 Ga0495640_0001275 Ga0495640_0001275_3721_4542 262
135 3300046543 Ga0495645_0008678 Ga0495645_0008678_5676_6497 262
136 3300046642 Ga0495634_0003024 Ga0495634_0003024_12641_13462 262
137 3300046663 Ga0495635_0001332 Ga0495635_0001332_11892_12710 262
138 3300046678 Ga0495599_0219071 Ga0495599_0219071_76_897 262
139 3300046690 Ga0495624_0030534 Ga0495624_0030534_1211_2032 262
140 3300047317 Ga0495604_0057733 Ga0495604_0057733_924_1745 262
141 3300047471 Ga0495684_0026865 Ga0495684_0026865_2286_3107 262
142 3300053077 Ga0495601_0001326 Ga0495601_0001326_5437_6258 262
143 3300053085 Ga0495619_0006059 Ga0495619_0006059_2169_2990 262
144 3300006844 Ga0075428_100297351 Ga0075428_1002973512 265
145 3300009147 Ga0114129_10025670 Ga0114129_100256706 265
146 3300050507 nmdc:mga05p37_965690_c1 nmdc:mga05p37_965690_c1_59_877 265
147 3300031241 Ga0265325_10054981 Ga0265325_100549812 266
148 3300036401 Ga0373937_0101502 Ga0373937_0101502_1671_2507 266
149 3300049571 Ga0501034_0015256 Ga0501034_0015256_6034_6936 266
150 3300049589 Ga0501073_0078246 Ga0501073_0078246_1232_2134 266
151 3300053084 Ga0495595_0014314 Ga0495595_0014314_1925_2761 266
152 3300053090 Ga0500646_0085016 Ga0500646_0085016_69_881 266
153 3300053096 Ga0500641_0010825 Ga0500641_0010825_162_974 266
154 3300060353 Ga0501082_0048067 Ga0501082_0048067_17_829 266
155 3300005937 Ga0081455_10067410 Ga0081455_100674103 267
156 3300005981 Ga0081538_10019479 Ga0081538_100194793 267
157 3300037853 Ga0436364_0931038 Ga0436364_0931038_526_1335 267
158 3300049576 Ga0501040_0256378 Ga0501040_0256378_17_859 267
159 3300049588 Ga0501072_0076485 Ga0501072_0076485_494_1336 267
160 3300005439 Ga0070711_100014051 Ga0070711_1000140515 268
161 3300005471 Ga0070698_100003731 Ga0070698_10000373115 268
162 3300005518 Ga0070699_100054242 Ga0070699_1000542424 268
163 3300005536 Ga0070697_100030866 Ga0070697_1000308664 268
164 3300005536 Ga0070697_100205215 Ga0070697_1002052152 268
165 3300005981 Ga0081538_10007058 Ga0081538_100070585 268
166 3300005981 Ga0081538_10008070 Ga0081538_100080701 268
167 3300005983 Ga0081540_1065179 Ga0081540_10651791 268
168 3300006178 Ga0075367_10214089 Ga0075367_102140892 268
169 3300006358 Ga0068871_100466773 Ga0068871_1004667732 268
170 3300006871 Ga0075434_100039278 Ga0075434_1000392784 268
171 3300007265 Ga0099794_10010561 Ga0099794_100105613 268
172 3300009094 Ga0111539_10068290 Ga0111539_100682903 268
173 3300010159 Ga0099796_10010685 Ga0099796_100106851 268
174 3300014969 Ga0157376_10452885 Ga0157376_104528851 268
175 3300021384 Ga0213876_10131612 Ga0213876_101316122 268
176 3300025913 Ga0207695_10309515 Ga0207695_103095151 268
177 3300025928 Ga0207700_10267643 Ga0207700_102676432 268
178 3300025929 Ga0207664_10153980 Ga0207664_101539802 268
179 3300027907 Ga0207428_10323861 Ga0207428_103238612 268
180 3300031595 Ga0265313_10000577 Ga0265313_1000057723 268
181 3300033180 Ga0307510_10045012 Ga0307510_100450122 268
182 3300035117 Ga0373953_0009710 Ga0373953_0009710_239_1054 268
183 3300035118 Ga0373954_0014363 Ga0373954_0014363_2120_2935 268
184 3300035119 Ga0373956_0021026 Ga0373956_0021026_1407_2222 268
185 3300035121 Ga0373960_0007112 Ga0373960_0007112_1213_2040 268
186 3300035172 Ga0373955_0063781 Ga0373955_0063781_286_1101 268
187 3300035691 Ga0373931_0068097 Ga0373931_0068097_178_1005 268
188 3300035692 Ga0373935_0092923 Ga0373935_0092923_215_1030 268
189 3300035692 Ga0373935_0242101 Ga0373935_0242101_250_1077 268
190 3300035695 Ga0373927_0220971 Ga0373927_0220971_236_1063 268
191 3300035724 Ga0373933_0032376 Ga0373933_0032376_2044_2859 268
192 3300035724 Ga0373933_0140234 Ga0373933_0140234_657_1472 268
193 3300035725 Ga0373947_0154914 Ga0373947_0154914_170_997 268
194 3300036401 Ga0373937_0032614 Ga0373937_0032614_2467_3285 268
195 3300036401 Ga0373937_0092165 Ga0373937_0092165_45_860 268
196 3300037068 Ga0373925_0163540 Ga0373925_0163540_542_1369 268
197 3300039437 Ga0436365_1473399 Ga0436365_1473399_1790_2617 268
198 3300039438 Ga0436360_0165678 Ga0436360_0165678_33_848 268
199 3300039447 Ga0436361_0829307 Ga0436361_0829307_626_1441 268
200 3300045049 Ga0466959_0235829 Ga0466959_0235829_409_1224 268
201 3300046454 Ga0495592_0011187 Ga0495592_0011187_2270_3085 268
202 3300046455 Ga0495603_0040354 Ga0495603_0040354_234_1076 268
203 3300046455 Ga0495603_0312928 Ga0495603_0312928_61_888 268
204 3300046459 Ga0495629_0021736 Ga0495629_0021736_236_1051 268
205 3300046462 Ga0495651_0025932 Ga0495651_0025932_2268_3083 268
206 3300046462 Ga0495651_0051642 Ga0495651_0051642_86_901 268
207 3300046463 Ga0495653_0049504 Ga0495653_0049504_468_1283 268
208 3300046473 Ga0495582_0061242 Ga0495582_0061242_868_1695 268
209 3300046477 Ga0495664_0311679 Ga0495664_0311679_56_871 268
210 3300046511 Ga0495608_0243620 Ga0495608_0243620_57_872 268
211 3300046514 Ga0495618_0015879 Ga0495618_0015879_317_1132 268
212 3300046524 Ga0495648_0001044 Ga0495648_0001044_594_1415 268
213 3300046524 Ga0495648_0006355 Ga0495648_0006355_7309_8124 268
214 3300046526 Ga0495666_0077509 Ga0495666_0077509_622_1449 268
215 3300046529 Ga0495652_0019081 Ga0495652_0019081_1293_2108 268
216 3300046529 Ga0495652_0085601 Ga0495652_0085601_596_1417 268
217 3300046533 Ga0495640_0022955 Ga0495640_0022955_3396_4211 268
218 3300046535 Ga0495586_0027053 Ga0495586_0027053_1816_2631 268
219 3300046536 Ga0495587_0014525 Ga0495587_0014525_3057_3872 268
220 3300046536 Ga0495587_0093623 Ga0495587_0093623_137_958 268
221 3300046559 Ga0495667_0010201 Ga0495667_0010201_4776_5591 268
222 3300046642 Ga0495634_0036286 Ga0495634_0036286_1610_2425 268
223 3300046675 Ga0495657_0287555 Ga0495657_0287555_115_930 268
224 3300046679 Ga0495623_0138795 Ga0495623_0138795_398_1219 268
225 3300046679 Ga0495623_0158977 Ga0495623_0158977_213_1028 268
226 3300046680 Ga0495646_0017785 Ga0495646_0017785_2066_2881 268
227 3300046689 Ga0495613_0282783 Ga0495613_0282783_165_992 268
228 3300047317 Ga0495604_0061971 Ga0495604_0061971_140_955 268
229 3300047319 Ga0495674_0065344 Ga0495674_0065344_1399_2214 268
230 3300047322 Ga0495680_0111769 Ga0495680_0111769_753_1568 268
231 3300047322 Ga0495680_0173771 Ga0495680_0173771_565_1386 268
232 3300048907 Ga0496104_0254980 Ga0496104_0254980_648_1475 268
233 3300048913 Ga0496110_0466719 Ga0496110_0466719_32_847 268
234 3300048917 Ga0496114_0160443 Ga0496114_0160443_439_1266 268
235 3300048918 Ga0496115_0251411 Ga0496115_0251411_353_1180 268
236 3300049571 Ga0501034_0018661 Ga0501034_0018661_5400_6227 268
237 3300049572 Ga0501036_0001733 Ga0501036_0001733_11237_12064 268
238 3300049573 Ga0501037_0038753 Ga0501037_0038753_2397_3224 268
239 3300049579 Ga0501043_0000800 Ga0501043_0000800_16521_17348 268
240 3300049580 Ga0501046_0019387 Ga0501046_0019387_2748_3575 268
241 3300049581 Ga0501047_0000136 Ga0501047_0000136_72362_73189 268
242 3300049582 Ga0501048_0000039 Ga0501048_0000039_24207_25034 268
243 3300049586 Ga0501070_0019941 Ga0501070_0019941_466_1293 268
244 3300049589 Ga0501073_0018270 Ga0501073_0018270_3379_4206 268
245 3300049590 Ga0501074_0005036 Ga0501074_0005036_4548_5375 268
246 3300049742 Ga0501080_0000022 Ga0501080_0000022_36698_37525 268
247 3300049744 Ga0501083_0017951 Ga0501083_0017951_2512_3339 268
248 3300049823 Ga0501044_0009844 Ga0501044_0009844_3564_4391 268
249 3300050511 nmdc:mga08y16_156759_c1 nmdc:mga08y16_156759_c1_1461_2288 268
250 3300050512 nmdc:mga0n895_48867_c1 nmdc:mga0n895_48867_c1_1268_2095 268
251 3300053077 Ga0495601_0031702 Ga0495601_0031702_1350_2165 268
252 3300053077 Ga0495601_0031899 Ga0495601_0031899_1388_2203 268
253 3300053078 Ga0495612_0070569 Ga0495612_0070569_423_1238 268
254 3300053080 Ga0500635_0004901 Ga0500635_0004901_633_1475 268
255 3300053084 Ga0495595_0001054 Ga0495595_0001054_2678_3496 268
256 3300053084 Ga0495595_0015875 Ga0495595_0015875_1807_2622 268
257 3300053085 Ga0495619_0055713 Ga0495619_0055713_891_1706 268
258 3300053102 Ga0500554_001201 Ga0500554_001201_223_1065 268
259 3300053150 Ga0500603_000963 Ga0500603_000963_216_1058 268
260 3300053178 Ga0500637_0008015 Ga0500637_0008015_244_1086 268
261 3300005434 Ga0070709_10188809 Ga0070709_101888091 269
262 3300005436 Ga0070713_100106946 Ga0070713_1001069463 269
263 3300005468 Ga0070707_100071696 Ga0070707_1000716964 269
264 3300005937 Ga0081455_10014661 Ga0081455_100146615 269
265 3300009147 Ga0114129_10614974 Ga0114129_106149742 269
266 3300014325 Ga0163163_10078637 Ga0163163_100786372 269
267 3300014968 Ga0157379_10127072 Ga0157379_101270723 269
268 3300025912 Ga0207707_10282688 Ga0207707_102826881 269
269 3300025913 Ga0207695_10002359 Ga0207695_1000235921 269
270 3300025915 Ga0207693_10330999 Ga0207693_103309992 269
271 3300025923 Ga0207681_10009572 Ga0207681_100095724 269
272 3300025924 Ga0207694_10391505 Ga0207694_103915052 269
273 3300025929 Ga0207664_10589562 Ga0207664_105895621 269
274 3300027907 Ga0207428_10313819 Ga0207428_103138192 269
275 3300031247 Ga0265340_10012862 Ga0265340_100128625 269
276 3300035695 Ga0373927_0166533 Ga0373927_0166533_308_1132 269
277 3300035725 Ga0373947_0046323 Ga0373947_0046323_705_1676 269
278 3300037068 Ga0373925_0049081 Ga0373925_0049081_1796_2617 269
279 3300039437 Ga0436365_1703167 Ga0436365_1703167_540_1424 269
280 3300039450 Ga0436363_1285858 Ga0436363_1285858_290_1102 269
281 3300044901 Ga0466960_0050236 Ga0466960_0050236_601_1413 269
282 3300046491 Ga0495584_0117346 Ga0495584_0117346_393_1223 269
283 3300046513 Ga0495616_0081891 Ga0495616_0081891_429_1259 269
284 3300046615 Ga0495656_0017589 Ga0495656_0017589_913_1743 269
285 3300046664 Ga0495659_0041121 Ga0495659_0041121_643_1473 269
286 3300048907 Ga0496104_0083732 Ga0496104_0083732_1387_2196 269
287 3300048910 Ga0496107_0069702 Ga0496107_0069702_1415_2224 269
288 3300048913 Ga0496110_0127109 Ga0496110_0127109_265_1095 269
289 3300048913 Ga0496110_0229515 Ga0496110_0229515_759_1574 269
290 3300048917 Ga0496114_0382984 Ga0496114_0382984_420_1229 269
291 3300048918 Ga0496115_0021512 Ga0496115_0021512_57_866 269
292 3300049572 Ga0501036_0317499 Ga0501036_0317499_67_909 269
293 3300050508 nmdc:mga09592_172062_c1 nmdc:mga09592_172062_c1_196_1071 269
294 3300050509 nmdc:mga0qj67_7972_c1 nmdc:mga0qj67_7972_c1_6322_7206 269
295 3300050510 nmdc:mga06r32_13372_c1 nmdc:mga06r32_13372_c1_1583_2467 269
296 3300050510 nmdc:mga06r32_9960_c1 nmdc:mga06r32_9960_c1_3592_4467 269
297 3300050511 nmdc:mga08y16_144820_c1 nmdc:mga08y16_144820_c1_1239_2066 269
298 3300054114 Ga0501084_0369649 Ga0501084_0369649_269_1111 269
299 3300060353 Ga0501082_0161091 Ga0501082_0161091_976_1818 269
300 3300003659 JGI25404J52841_10006864 JGI25404J52841_100068643 270
301 3300005983 Ga0081540_1001200 Ga0081540_100120020 270
302 3300006175 Ga0070712_100042462 Ga0070712_1000424622 270
303 3300020082 Ga0206353_10980335 Ga0206353_109803351 270
304 3300025928 Ga0207700_10529708 Ga0207700_105297081 270

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.7738 54 263
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.7634 54 263
6lfd-assembly3.cif.gz_C crystal structure of vmb-1 at ph5.5(bis-tris) 0.7585 53 270
5mmd-assembly2.cif.gz_F tmb-1. structural insights into tmb-1 and the role of residue 119 and 228 in substrate and inhibitor binding 0.7439 53 270
6lfd-assembly3.cif.gz_C crystal structure of vmb-1 at ph5.5(bis-tris) 0.7432 53 270
ID Description Score Start End Superfamily
af_Q2FV07_32_193_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7648 77 242 3.60.15.10
af_Q8RWE1_144_338_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7549 60 265 3.60.15.10
af_A0A1D6QA38_128_270_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7515 73 210 3.60.15.10
af_Q8RWE1_144_338_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7443 60 265 3.60.15.10
2p97B00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7318 50 264 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7C3QIA7-F1-model_v4 MBL fold metallo-hydrolase 0.9957 3 268 GO:0016787
AF-A0A7W1AX02-F1-model_v4 MBL fold metallo-hydrolase 0.9956 136 269 GO:0016787
AF-A0A140K036-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9944 123 270
AF-A0A6H2BUP6-F1-model_v4 deleted 0.9935 3 268
AF-A0A1T4REB5-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9923 3 268

Feature Viewer

pLDDT pTM Quality
96.28 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map