F397740

General Info

Members Datasets Scaffolds Average Seq Length
304 200 287 230

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0004730|Ga0495650_0004730_6407_7192
Length 261
Sequence MQNCNAALQFCAFSSRAFLPKMATPITEDTMSETLTIKVADGSFHCYVARPSQAASAPVIVVLQEIFGVNAGIRSIADDYAAKGYIAVAPELFWRAEPGLDMSEDKPGDWARGFALYSAYNFDGGVDDIAAVVAAARTLPGASGKVGVTGYCLGGLLTYMTAARADADAFVAYYGGSTEKYAAEAGKVAKPLLYHLAEEDEYIGKDAQAVITAAFAGNPHIELHSYPGCNHAFARPGGNHYDAAAATLANARTDAFFKKYL

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738543018 Massilia sp. GV045 Isolate Unclassified
7 2738543030 Massilia sp. GV097 Isolate Unclassified
8 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
9 2821131069 Duganella sp. 1224 Isolate Unclassified
10 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
11 2849560528 Caulobacter zeae 410 Isolate Unclassified
12 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
13 2851153111 Caulobacter radicis 736 Isolate Unclassified
14 2857558681 Duganella sp. R-74565 Isolate Unclassified
15 2857564685 Duganella sp. R-74599 Isolate Unclassified
16 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
17 2919404418 Luteibacter sp. 3190 Isolate Unclassified
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
191 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
196 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.08
Metatranscriptomes 0.33
Isolates 5.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.08
Nodule 0.33
Rhizoplane 2.96
Rhizosphere 66.45
Stem 0
Stem Tuber 0
Unclassified 11.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000250 3300001989 Bacteria 18085
2 JGI24737J22298_10003526 3300001990 Bacteria 5514
3 JGI24735J21928_10000409 3300002067 Bacteria 15021
4 JGI24738J21930_10000103 3300002075 Bacteria 19478
5 JGI25150J39212_1006975 3300002774 Bacteria 2297
6 rootH1_10124529 3300003316 Bacteria 1073
7 rootH1_10127838 3300003316 Bacteria 1479
8 Ga0006562J51391_1167517 3300003578 Bacteria 4770
9 Ga0055526_1000097 3300003771 Bacteria 79762
10 Ga0055526_1000368 3300003771 Bacteria 36399
11 Ga0055526_1001464 3300003771 Bacteria 16762
12 Ga0055526_1004987 3300003771 Bacteria 7787
13 Ga0055537_1000159 3300003773 Bacteria 50407
14 Ga0055537_1001451 3300003773 Bacteria 9232
15 Ga0055537_1008313 3300003773 Bacteria 2406
16 Ga0055524_1000877 3300003775 Bacteria 19613
17 Ga0055524_1005147 3300003775 Bacteria 5900
18 Ga0055524_1026480 3300003775 Bacteria 1790
19 Ga0055534_1000451 3300003784 Bacteria 24079
20 Ga0055534_1004267 3300003784 Bacteria 4203
21 Ga0055528_1000147 3300003790 Bacteria 57895
22 Ga0055530_10000313 3300003791 Bacteria 44170
23 Ga0055530_10000533 3300003791 Bacteria 33021
24 Ga0055530_10000678 3300003791 Bacteria 28928
25 Ga0055530_10008275 3300003791 Bacteria 4199
26 Ga0055531_10001359 3300003794 Bacteria 18195
27 Ga0055531_10002388 3300003794 Bacteria 12617
28 Ga0068869_100051322 3300005334 Bacteria 2993
29 Ga0070680_100417463 3300005336 Bacteria 1144
30 Ga0070668_100010163 3300005347 Bacteria 6979
31 Ga0070671_100171355 3300005355 Bacteria 1836
32 Ga0070673_100300934 3300005364 Bacteria 1412
33 Ga0070667_100084087 3300005367 Bacteria 2727
34 Ga0070678_100084600 3300005456 Bacteria 2415
35 Ga0070662_100012467 3300005457 Bacteria 5638
36 Ga0070662_100135238 3300005457 Bacteria 1905
37 Ga0070681_10153715 3300005458 Bacteria 2226
38 Ga0070679_100298805 3300005530 Bacteria 1561
39 Ga0068853_100036533 3300005539 Bacteria 4179
40 Ga0068853_100301910 3300005539 Bacteria 1480
41 Ga0070672_100218737 3300005543 Bacteria 1597
42 Ga0070665_100501399 3300005548 Bacteria 1225
43 Ga0068855_100064867 3300005563 Bacteria 4259
44 Ga0068855_100574522 3300005563 Bacteria 1218
45 Ga0068855_100681191 3300005563 Bacteria 1102
46 Ga0068856_100308852 3300005614 Bacteria 1599
47 Ga0068852_100064789 3300005616 Bacteria 3187
48 Ga0068852_100149926 3300005616 Bacteria 2168
49 Ga0068859_100052439 3300005617 Bacteria 4101
50 Ga0068864_100011668 3300005618 Bacteria 7255
51 Ga0068864_100335817 3300005618 Bacteria 1423
52 Ga0068864_100441632 3300005618 Bacteria 1243
53 Ga0068863_100062823 3300005841 Bacteria 3512
54 Ga0068863_100377677 3300005841 Bacteria 1384
55 Ga0068858_100245452 3300005842 Bacteria 1700
56 Ga0068860_100018094 3300005843 Bacteria 6862
57 Ga0068860_100548036 3300005843 Bacteria 1158
58 Ga0068862_100029394 3300005844 Bacteria 4631
59 Ga0068862_100034883 3300005844 Bacteria 4259
60 Ga0075366_10061356 3300006195 Bacteria 2234
61 Ga0097620_100052439 3300006931 Bacteria 4101
62 Ga0079104_1020135 3300006946 Bacteria 1846
63 Ga0099795_10015764 3300007788 Bacteria 2375
64 Ga0105244_10002027 3300009036 Bacteria 15622
65 Ga0105240_10050574 3300009093 Bacteria 5238
66 Ga0105240_10054598 3300009093 Bacteria 5006
67 Ga0105241_10243292 3300009174 Bacteria 1522
68 Ga0105248_10000789 3300009177 Bacteria 35531
69 Ga0105248_10057907 3300009177 Bacteria 4351
70 Ga0105248_10060681 3300009177 Bacteria 4246
71 Ga0105248_10460042 3300009177 Bacteria 1434
72 Ga0105249_10309963 3300009553 Bacteria 1586
73 Ga0105249_10326638 3300009553 Bacteria 1547
74 Ga0099796_10014380 3300010159 Bacteria 2285
75 Ga0105239_10446920 3300010375 Bacteria 1466
76 Ga0157373_10000879 3300013100 Bacteria 23263
77 Ga0157373_10015482 3300013100 Bacteria 5576
78 Ga0157371_10117909 3300013102 Bacteria 1887
79 Ga0157372_10116088 3300013307 Bacteria 3069
80 Ga0157372_10337170 3300013307 Bacteria 1756
81 Ga0157372_10351805 3300013307 Bacteria 1716
82 Ga0157375_10022923 3300013308 Bacteria 5753
83 Ga0163163_10097240 3300014325 Bacteria 2964
84 Ga0163163_10566075 3300014325 Bacteria 1199
85 Ga0157380_10511993 3300014326 Bacteria 1168
86 Ga0213876_10000081 3300021384 Bacteria 108997
87 Ga0209436_105592 3300025208 Bacteria 2864
88 Ga0207425_1000056 3300025245 Bacteria 151802
89 Ga0209129_1003131 3300025258 Bacteria 7426
90 Ga0209565_1000003 3300025263 Bacteria 1099648
91 Ga0209565_1000747 3300025263 Bacteria 19207
92 Ga0209565_1000756 3300025263 Bacteria 18994
93 Ga0209673_1000003 3300025273 Bacteria 980859
94 Ga0209130_1002119 3300025284 Bacteria 10549
95 Ga0209675_1000003 3300025291 Bacteria 1003982
96 Ga0209675_1000450 3300025291 Bacteria 31866
97 Ga0209675_1004503 3300025291 Bacteria 6173
98 Ga0209564_1000012 3300025295 Bacteria 792078
99 Ga0209564_1000026 3300025295 Bacteria 519154
100 Ga0209564_1000272 3300025295 Bacteria 108384
101 Ga0209564_1004585 3300025295 Bacteria 8363
102 Ga0209758_1001380 3300025297 Bacteria 28958
103 Ga0209050_1000011 3300025298 Bacteria 914037
104 Ga0209050_1000053 3300025298 Bacteria 349521
105 Ga0209050_1000164 3300025298 Bacteria 154628
106 Ga0209050_1000392 3300025298 Bacteria 82085
107 Ga0209050_1000470 3300025298 Bacteria 71502
108 Ga0209256_1000427 3300025299 Bacteria 66034
109 Ga0209256_1000697 3300025299 Bacteria 44617
110 Ga0209256_1002114 3300025299 Bacteria 17273
111 Ga0209256_1004512 3300025299 Bacteria 8691
112 Ga0209256_1006421 3300025299 Bacteria 6239
113 Ga0209257_1000003 3300025304 Bacteria 1702593
114 Ga0209257_1000419 3300025304 Bacteria 81956
115 Ga0207655_1028879 3300025728 Bacteria 2607
116 Ga0207647_10000782 3300025904 Bacteria 24751
117 Ga0207654_10196947 3300025911 Bacteria 1324
118 Ga0207707_10156050 3300025912 Bacteria 1996
119 Ga0207695_10005132 3300025913 Bacteria 17533
120 Ga0207695_10005524 3300025913 Bacteria 16736
121 Ga0207695_10093433 3300025913 Bacteria 3017
122 Ga0207660_10111675 3300025917 Bacteria 2058
123 Ga0207650_10033962 3300025925 Bacteria 3698
124 Ga0207644_10033844 3300025931 Bacteria 3574
125 Ga0207644_10075164 3300025931 Bacteria 2482
126 Ga0207706_10007212 3300025933 Bacteria 10277
127 Ga0207706_10150580 3300025933 Bacteria 2046
128 Ga0207691_10368802 3300025940 Bacteria 1227
129 Ga0207689_10161863 3300025942 Bacteria 1844
130 Ga0207679_10048240 3300025945 Bacteria 3099
131 Ga0207667_10078497 3300025949 Bacteria 3422
132 Ga0207667_10225364 3300025949 Bacteria 1920
133 Ga0207651_10295423 3300025960 Bacteria 1345
134 Ga0207668_10014489 3300025972 Bacteria 4881
135 Ga0207668_10015236 3300025972 Bacteria 4772
136 Ga0207668_10019715 3300025972 Bacteria 4269
137 Ga0207639_10016777 3300026041 Bacteria 5188
138 Ga0207639_10035704 3300026041 Bacteria 3679
139 Ga0207641_10033878 3300026088 Bacteria 4245
140 Ga0207676_10117970 3300026095 Bacteria 2233
141 Ga0207676_10179469 3300026095 Bacteria 1853
142 Ga0207675_100847692 3300026118 Bacteria 929
143 Ga0207698_10086273 3300026142 Bacteria 2552
144 Ga0207698_10371591 3300026142 Bacteria 1357
145 Ga0268266_10162776 3300028379 Bacteria 2020
146 Ga0268265_10094235 3300028380 Bacteria 2401
147 Ga0268264_10022053 3300028381 Bacteria 5197
148 Ga0265326_10090064 3300028558 Bacteria 869
149 Ga0265334_10048202 3300028573 Bacteria 1641
150 Ga0307517_10014862 3300028786 Bacteria 10407
151 Ga0265338_10062571 3300028800 Bacteria 3251
152 Ga0265338_10110459 3300028800 Bacteria 2216
153 Ga0307511_10004780 3300030521 Bacteria 13849
154 Ga0316181_1234462 3300030744 Bacteria 1650
155 Ga0265330_10018409 3300031235 Bacteria 3208
156 Ga0265330_10048624 3300031235 Bacteria 1865
157 Ga0265328_10130192 3300031239 Bacteria 941
158 Ga0265325_10008031 3300031241 Bacteria 6255
159 Ga0265325_10054997 3300031241 Bacteria 2036
160 Ga0265340_10027295 3300031247 Bacteria 2879
161 Ga0265339_10041460 3300031249 Bacteria 2555
162 Ga0265339_10052521 3300031249 Bacteria 2219
163 Ga0265327_10000331 3300031251 Bacteria 89636
164 Ga0307513_10000178 3300031456 Bacteria 91751
165 Ga0307513_10004553 3300031456 Bacteria 18488
166 Ga0307513_10006957 3300031456 Bacteria 14706
167 Ga0307513_10029439 3300031456 Bacteria 6260
168 Ga0307408_100000146 3300031548 Bacteria 78996
169 Ga0307408_100002048 3300031548 Bacteria 14511
170 Ga0307408_100024730 3300031548 Bacteria 4105
171 Ga0265314_10002412 3300031711 Bacteria 19188
172 Ga0307406_10254186 3300031901 Bacteria 1326
173 Ga0307411_10360711 3300032005 Bacteria 1188
174 Ga0373939_0057021 3300035114 Bacteria 1231
175 Ga0373935_0110820 3300035692 Bacteria 1822
176 Ga0395899_0000003 3300037312 Bacteria 1232684
177 Ga0395900_0133990 3300037418 Bacteria 2538
178 Ga0395900_0416614 3300037418 Bacteria 1305
179 Ga0395905_0106820 3300037471 Bacteria 2628
180 Ga0436364_0475998 3300037853 Bacteria 1530
181 Ga0436365_0016859 3300039437 Bacteria 1896
182 Ga0436365_0187494 3300039437 Bacteria 67801
183 Ga0436365_1464659 3300039437 Bacteria 8569
184 Ga0450890_021599 3300042127 Bacteria 877
185 Ga0466960_0188318 3300044901 Bacteria 1122
186 Ga0466959_0104565 3300045049 Bacteria 2025
187 Ga0495617_001178 3300046452 Bacteria 11807
188 Ga0495638_0027756 3300046460 Bacteria 3662
189 Ga0495638_0167193 3300046460 Bacteria 1264
190 Ga0495638_0287400 3300046460 Bacteria 891
191 Ga0495650_0000505 3300046471 Bacteria 58392
192 Ga0495650_0001480 3300046471 Bacteria 22521
193 Ga0495650_0004730 3300046471 Bacteria 9159
194 Ga0495650_0006432 3300046471 Bacteria 7321
195 Ga0495605_0000005 3300046474 Bacteria 376973
196 Ga0495639_0052735 3300046475 Bacteria 1852
197 Ga0495607_0005531 3300046501 Bacteria 9017
198 Ga0495583_0003911 3300046506 Bacteria 11025
199 Ga0495583_0034942 3300046506 Bacteria 2404
200 Ga0495606_0000030 3300046507 Bacteria 249484
201 Ga0495606_0000044 3300046507 Bacteria 212802
202 Ga0495606_0000524 3300046507 Bacteria 62049
203 Ga0495606_0003385 3300046507 Bacteria 16959
204 Ga0495606_0003578 3300046507 Bacteria 16380
205 Ga0495606_0014519 3300046507 Bacteria 6137
206 Ga0495610_0003472 3300046512 Bacteria 12266
207 Ga0495610_0003785 3300046512 Bacteria 11538
208 Ga0495610_0005310 3300046512 Bacteria 9206
209 Ga0495610_0017333 3300046512 Bacteria 4109
210 Ga0495616_0000150 3300046513 Bacteria 60876
211 Ga0495631_0000337 3300046518 Bacteria 32281
212 Ga0495637_0000049 3300046520 Bacteria 103081
213 Ga0495643_0000250 3300046522 Bacteria 78905
214 Ga0495644_0021881 3300046523 Bacteria 2437
215 Ga0495648_0221498 3300046524 Bacteria 932
216 Ga0495663_0048294 3300046525 Bacteria 1312
217 Ga0495654_0000005 3300046530 Bacteria 491381
218 Ga0495665_0023568 3300046531 Bacteria 3306
219 Ga0495609_0055405 3300046538 Bacteria 1759
220 Ga0495609_0225871 3300046538 Bacteria 776
221 Ga0495597_0000697 3300046542 Bacteria 26955
222 Ga0495622_0000027 3300046557 Bacteria 135256
223 Ga0495633_0000226 3300046558 Bacteria 69863
224 Ga0495633_0001977 3300046558 Bacteria 14844
225 Ga0495633_0028411 3300046558 Bacteria 2726
226 Ga0495668_0000147 3300046616 Bacteria 106018
227 Ga0495668_0002386 3300046616 Bacteria 15575
228 Ga0495611_0002187 3300046648 Bacteria 9108
229 Ga0495625_0006831 3300046660 Bacteria 10081
230 Ga0495625_0019379 3300046660 Bacteria 5279
231 Ga0495625_0205052 3300046660 Bacteria 1299
232 Ga0495625_0266464 3300046660 Bacteria 1107
233 Ga0495659_0000213 3300046664 Bacteria 24899
234 Ga0495671_0000374 3300046692 Bacteria 36687
235 Ga0495671_0039419 3300046692 Bacteria 2385
236 Ga0495649_0001773 3300046694 Bacteria 15910
237 Ga0495649_0006666 3300046694 Bacteria 7168
238 Ga0495649_0075188 3300046694 Bacteria 1809
239 Ga0495589_0002249 3300046794 Bacteria 10841
240 Ga0495660_0000339 3300046810 Bacteria 41484
241 Ga0495636_0224041 3300047318 Bacteria 864
242 Ga0495672_0000169 3300047320 Bacteria 94803
243 Ga0495672_0000363 3300047320 Bacteria 58040
244 Ga0495683_0007540 3300047323 Bacteria 5871
245 Ga0495677_0082974 3300047445 Bacteria 1203
246 Ga0495673_0000033 3300047469 Bacteria 354152
247 Ga0495673_0000236 3300047469 Bacteria 79618
248 Ga0495681_0030749 3300047470 Bacteria 2729
249 Ga0495686_0011896 3300047472 Bacteria 6116
250 Ga0495686_0390825 3300047472 Bacteria 748
251 Ga0495626_0033078 3300048091 Bacteria 2479
252 Ga0496100_0184085 3300048903 Bacteria 1512
253 Ga0496101_0082231 3300048904 Bacteria 2383
254 Ga0496102_0026094 3300048905 Bacteria 5208
255 Ga0496103_0223092 3300048906 Bacteria 1212
256 Ga0496107_0423750 3300048910 Bacteria 989
257 Ga0496109_0004453 3300048912 Bacteria 11699
258 Ga0496110_0147765 3300048913 Bacteria 2127
259 Ga0496112_0082806 3300048915 Bacteria 3173
260 Ga0496112_0144267 3300048915 Bacteria 2350
261 Ga0496122_0037323 3300048925 Bacteria 3913
262 Ga0496123_0005973 3300048926 Bacteria 11981
263 Ga0496124_0166417 3300048927 Bacteria 1713
264 Ga0496124_0294702 3300048927 Bacteria 1175
265 Ga0496125_0057747 3300048928 Bacteria 3140
266 Ga0495678_000060 3300049459 Bacteria 142851
267 Ga0495678_000095 3300049459 Bacteria 109532
268 Ga0495682_0000035 3300049460 Bacteria 126349
269 Ga0501033_0047656 3300049570 Bacteria 3186
270 Ga0501034_0122011 3300049571 Bacteria 2592
271 Ga0501043_0435873 3300049579 Bacteria 987
272 Ga0501047_0027138 3300049581 Bacteria 5516
273 Ga0501047_0107685 3300049581 Bacteria 2669
274 Ga0501047_0687971 3300049581 Bacteria 841
275 Ga0501238_014121 3300049671 Bacteria 1092
276 Ga0501257_003474 3300049686 Bacteria 3381
277 Ga0501035_0179797 3300049822 Bacteria 1823
278 Ga0501044_0052934 3300049823 Bacteria 4178
279 nmdc:mga0k408_67265_c1 3300050493 Bacteria 2088
280 Ga0500554_001176 3300053102 Bacteria 5071
281 Ga0500562_000606 3300053108 Bacteria 8652
282 Ga0500562_008599 3300053108 Bacteria 2579
283 Ga0500608_110991 3300053122 Bacteria 1257
284 Ga0500559_0000009 3300053136 Bacteria 174153
285 Ga0500559_0142382 3300053136 Bacteria 1123
286 Ga0500586_002147 3300053145 Bacteria 4368
287 Ga0500616_0005541 3300053153 Bacteria 8550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003791 Ga0055530_10008275 Ga0055530_100082753 210
2 3300002774 JGI25150J39212_1006975 JGI25150J39212_10069752 211
3 3300003316 rootH1_10127838 rootH1_101278381 211
4 3300003771 Ga0055526_1001464 Ga0055526_100146410 211
5 3300003773 Ga0055537_1008313 Ga0055537_10083133 211
6 3300003791 Ga0055530_10000533 Ga0055530_1000053311 211
7 3300025245 Ga0207425_1000056 Ga0207425_100005663 211
8 3300025258 Ga0209129_1003131 Ga0209129_10031313 211
9 3300025291 Ga0209675_1000450 Ga0209675_100045011 211
10 3300025295 Ga0209564_1000272 Ga0209564_100027261 211
11 3300025298 Ga0209050_1000164 Ga0209050_1000164135 211
12 3300025299 Ga0209256_1000427 Ga0209256_100042721 211
13 3300053153 Ga0500616_0005541 Ga0500616_0005541_6075_6776 212
14 3300003771 Ga0055526_1004987 Ga0055526_10049873 213
15 3300003773 Ga0055537_1001451 Ga0055537_10014516 213
16 3300003784 Ga0055534_1004267 Ga0055534_10042672 213
17 3300003794 Ga0055531_10001359 Ga0055531_100013593 213
18 3300025208 Ga0209436_105592 Ga0209436_1055923 213
19 3300025263 Ga0209565_1000747 Ga0209565_100074714 213
20 3300025263 Ga0209565_1000756 Ga0209565_10007562 213
21 3300025284 Ga0209130_1002119 Ga0209130_10021198 213
22 3300025291 Ga0209675_1004503 Ga0209675_10045033 213
23 3300025295 Ga0209564_1004585 Ga0209564_10045853 213
24 3300025298 Ga0209050_1000011 Ga0209050_1000011141 213
25 3300025298 Ga0209050_1000470 Ga0209050_100047013 213
26 3300025299 Ga0209256_1004512 Ga0209256_10045123 213
27 3300025304 Ga0209257_1000003 Ga0209257_1000003913 213
28 3300047472 Ga0495686_0390825 Ga0495686_0390825_94_738 213
29 3300003791 Ga0055530_10000678 Ga0055530_100006784 215
30 3300025298 Ga0209050_1000392 Ga0209050_100039215 215
31 3300031548 Ga0307408_100024730 Ga0307408_1000247303 215
32 3300042127 Ga0450890_021599 Ga0450890_021599_150_845 215
33 3300046506 Ga0495583_0003911 Ga0495583_0003911_1313_2011 215
34 3300046513 Ga0495616_0000150 Ga0495616_0000150_9194_9892 215
35 3300046518 Ga0495631_0000337 Ga0495631_0000337_13316_14014 215
36 3300046523 Ga0495644_0021881 Ga0495644_0021881_946_1644 215
37 3300046648 Ga0495611_0002187 Ga0495611_0002187_217_915 215
38 3300046660 Ga0495625_0205052 Ga0495625_0205052_326_1024 215
39 3300046694 Ga0495649_0006666 Ga0495649_0006666_5046_5744 215
40 3300046794 Ga0495589_0002249 Ga0495589_0002249_1160_1858 215
41 3300047323 Ga0495683_0007540 Ga0495683_0007540_4917_5615 215
42 3300047470 Ga0495681_0030749 Ga0495681_0030749_782_1480 215
43 3300048091 Ga0495626_0033078 Ga0495626_0033078_1596_2294 215
44 3300049459 Ga0495678_000060 Ga0495678_000060_103404_104102 215
45 3300049460 Ga0495682_0000035 Ga0495682_0000035_73687_74385 215
46 3300006195 Ga0075366_10061356 Ga0075366_100613563 216
47 3300031548 Ga0307408_100000146 Ga0307408_10000014644 216
48 3300031548 Ga0307408_100002048 Ga0307408_1000020489 216
49 3300050493 nmdc:mga0k408_67265_c1 nmdc:mga0k408_67265_c1_1182_1877 216
50 3300049671 Ga0501238_014121 Ga0501238_014121_65_766 217
51 3300003775 Ga0055524_1000877 Ga0055524_100087713 218
52 iso_pu_bacteria 2791355048 2792460842 225
53 iso_pu_bacteria 2843744320 2843745498 225
54 iso_pu_bacteria 2849560528 2849561112 225
55 iso_pu_bacteria 2849573788 2849578578 225
56 iso_pu_bacteria 2851153111 2851157148 225
57 iso_pu_bacteria 2898329390 2898332806 225
58 iso_pu_bacteria 2821131069 2821131682 226
59 iso_pu_bacteria 2857564685 2857566096 226
60 iso_pu_bacteria 2643221598 2643999643 227
61 iso_pu_bacteria 2643221614 2644087629 227
62 iso_pu_bacteria 2643221661 2644344327 227
63 iso_pu_bacteria 2643221666 2644366988 227
64 iso_pu_bacteria 2738541280 2738740557 227
65 iso_pu_bacteria 2738543018 2739272178 227
66 iso_pu_bacteria 2738543030 2739341222 227
67 iso_pu_bacteria 2857558681 2857562313 227
68 iso_pu_bacteria 2919404418 2919405712 227
69 3300003771 Ga0055526_1000368 Ga0055526_100036820 229
70 3300003773 Ga0055537_1000159 Ga0055537_100015925 229
71 3300003775 Ga0055524_1026480 Ga0055524_10264802 229
72 3300003784 Ga0055534_1000451 Ga0055534_100045117 229
73 3300003790 Ga0055528_1000147 Ga0055528_100014753 229
74 3300025263 Ga0209565_1000003 Ga0209565_1000003421 229
75 3300025273 Ga0209673_1000003 Ga0209673_1000003307 229
76 3300025291 Ga0209675_1000003 Ga0209675_1000003617 229
77 3300025295 Ga0209564_1000012 Ga0209564_1000012425 229
78 3300025299 Ga0209256_1000697 Ga0209256_10006974 229
79 3300025299 Ga0209256_1006421 Ga0209256_10064214 229
80 3300031241 Ga0265325_10054997 Ga0265325_100549972 229
81 3300049571 Ga0501034_0122011 Ga0501034_0122011_260_952 229
82 3300031456 Ga0307513_10000178 Ga0307513_1000017878 230
83 3300046452 Ga0495617_001178 Ga0495617_001178_2295_3062 230
84 3300046471 Ga0495650_0004730 Ga0495650_0004730_6407_7192 230
85 3300046471 Ga0495650_0006432 Ga0495650_0006432_1371_2066 230
86 3300046507 Ga0495606_0000030 Ga0495606_0000030_243230_243925 230
87 3300046507 Ga0495606_0000524 Ga0495606_0000524_14962_15660 230
88 3300046512 Ga0495610_0003472 Ga0495610_0003472_1834_2532 230
89 3300046520 Ga0495637_0000049 Ga0495637_0000049_34665_35360 230
90 3300046522 Ga0495643_0000250 Ga0495643_0000250_34466_35164 230
91 3300046524 Ga0495648_0221498 Ga0495648_0221498_211_909 230
92 3300046530 Ga0495654_0000005 Ga0495654_0000005_295261_295956 230
93 3300046538 Ga0495609_0055405 Ga0495609_0055405_456_1154 230
94 3300046558 Ga0495633_0000226 Ga0495633_0000226_52586_53281 230
95 3300046558 Ga0495633_0001977 Ga0495633_0001977_13426_14130 230
96 3300046692 Ga0495671_0000374 Ga0495671_0000374_33049_33744 230
97 3300046692 Ga0495671_0039419 Ga0495671_0039419_16_714 230
98 3300046694 Ga0495649_0001773 Ga0495649_0001773_11091_11789 230
99 3300046694 Ga0495649_0075188 Ga0495649_0075188_1022_1717 230
100 3300047320 Ga0495672_0000363 Ga0495672_0000363_14781_15479 230
101 3300047469 Ga0495673_0000033 Ga0495673_0000033_327412_328107 230
102 3300047469 Ga0495673_0000236 Ga0495673_0000236_14929_15663 230
103 3300048925 Ga0496122_0037323 Ga0496122_0037323_3164_3859 230
104 3300048926 Ga0496123_0005973 Ga0496123_0005973_5829_6524 230
105 3300049459 Ga0495678_000095 Ga0495678_000095_41735_42433 230
106 3300053145 Ga0500586_002147 Ga0500586_002147_2674_3378 230
107 3300003578 Ga0006562J51391_1167517 Ga0006562J51391_11675172 231
108 3300003771 Ga0055526_1000097 Ga0055526_100009737 231
109 3300003775 Ga0055524_1005147 Ga0055524_10051475 231
110 3300003791 Ga0055530_10000313 Ga0055530_1000031312 231
111 3300003794 Ga0055531_10002388 Ga0055531_1000238813 231
112 3300005334 Ga0068869_100051322 Ga0068869_1000513223 231
113 3300005336 Ga0070680_100417463 Ga0070680_1004174632 231
114 3300005347 Ga0070668_100010163 Ga0070668_1000101634 231
115 3300005355 Ga0070671_100171355 Ga0070671_1001713552 231
116 3300005364 Ga0070673_100300934 Ga0070673_1003009343 231
117 3300005367 Ga0070667_100084087 Ga0070667_1000840872 231
118 3300005456 Ga0070678_100084600 Ga0070678_1000846003 231
119 3300005457 Ga0070662_100135238 Ga0070662_1001352382 231
120 3300005458 Ga0070681_10153715 Ga0070681_101537153 231
121 3300005530 Ga0070679_100298805 Ga0070679_1002988052 231
122 3300005539 Ga0068853_100036533 Ga0068853_1000365334 231
123 3300005543 Ga0070672_100218737 Ga0070672_1002187371 231
124 3300005548 Ga0070665_100501399 Ga0070665_1005013992 231
125 3300005563 Ga0068855_100064867 Ga0068855_1000648675 231
126 3300005563 Ga0068855_100681191 Ga0068855_1006811912 231
127 3300005614 Ga0068856_100308852 Ga0068856_1003088522 231
128 3300005616 Ga0068852_100064789 Ga0068852_1000647892 231
129 3300005617 Ga0068859_100052439 Ga0068859_1000524393 231
130 3300005618 Ga0068864_100011668 Ga0068864_1000116688 231
131 3300005618 Ga0068864_100335817 Ga0068864_1003358172 231
132 3300005618 Ga0068864_100441632 Ga0068864_1004416323 231
133 3300005841 Ga0068863_100062823 Ga0068863_1000628233 231
134 3300005841 Ga0068863_100377677 Ga0068863_1003776772 231
135 3300005842 Ga0068858_100245452 Ga0068858_1002454522 231
136 3300005843 Ga0068860_100018094 Ga0068860_1000180944 231
137 3300005843 Ga0068860_100548036 Ga0068860_1005480363 231
138 3300005844 Ga0068862_100029394 Ga0068862_1000293943 231
139 3300005844 Ga0068862_100034883 Ga0068862_1000348834 231
140 3300006931 Ga0097620_100052439 Ga0097620_1000524393 231
141 3300006946 Ga0079104_1020135 Ga0079104_10201351 231
142 3300007788 Ga0099795_10015764 Ga0099795_100157641 231
143 3300009036 Ga0105244_10002027 Ga0105244_1000202711 231
144 3300009093 Ga0105240_10050574 Ga0105240_100505742 231
145 3300009093 Ga0105240_10054598 Ga0105240_100545983 231
146 3300009174 Ga0105241_10243292 Ga0105241_102432922 231
147 3300009177 Ga0105248_10000789 Ga0105248_1000078914 231
148 3300009177 Ga0105248_10057907 Ga0105248_100579073 231
149 3300009177 Ga0105248_10060681 Ga0105248_100606816 231
150 3300009177 Ga0105248_10460042 Ga0105248_104600422 231
151 3300009553 Ga0105249_10309963 Ga0105249_103099633 231
152 3300009553 Ga0105249_10326638 Ga0105249_103266383 231
153 3300010159 Ga0099796_10014380 Ga0099796_100143802 231
154 3300010375 Ga0105239_10446920 Ga0105239_104469202 231
155 3300013100 Ga0157373_10000879 Ga0157373_100008794 231
156 3300013100 Ga0157373_10015482 Ga0157373_100154822 231
157 3300013307 Ga0157372_10116088 Ga0157372_101160883 231
158 3300013308 Ga0157375_10022923 Ga0157375_100229234 231
159 3300014325 Ga0163163_10097240 Ga0163163_100972403 231
160 3300014325 Ga0163163_10566075 Ga0163163_105660752 231
161 3300014326 Ga0157380_10511993 Ga0157380_105119932 231
162 3300021384 Ga0213876_10000081 Ga0213876_1000008142 231
163 3300025295 Ga0209564_1000026 Ga0209564_1000026148 231
164 3300025297 Ga0209758_1001380 Ga0209758_100138010 231
165 3300025298 Ga0209050_1000053 Ga0209050_100005382 231
166 3300025299 Ga0209256_1002114 Ga0209256_10021143 231
167 3300025304 Ga0209257_1000419 Ga0209257_100041966 231
168 3300025728 Ga0207655_1028879 Ga0207655_10288792 231
169 3300025911 Ga0207654_10196947 Ga0207654_101969472 231
170 3300025912 Ga0207707_10156050 Ga0207707_101560503 231
171 3300025913 Ga0207695_10005132 Ga0207695_1000513216 231
172 3300025913 Ga0207695_10005524 Ga0207695_1000552415 231
173 3300025913 Ga0207695_10093433 Ga0207695_100934332 231
174 3300025917 Ga0207660_10111675 Ga0207660_101116752 231
175 3300025925 Ga0207650_10033962 Ga0207650_100339622 231
176 3300025931 Ga0207644_10033844 Ga0207644_100338443 231
177 3300025931 Ga0207644_10075164 Ga0207644_100751643 231
178 3300025933 Ga0207706_10150580 Ga0207706_101505803 231
179 3300025940 Ga0207691_10368802 Ga0207691_103688022 231
180 3300025942 Ga0207689_10161863 Ga0207689_101618632 231
181 3300025945 Ga0207679_10048240 Ga0207679_100482403 231
182 3300025949 Ga0207667_10078497 Ga0207667_100784972 231
183 3300025949 Ga0207667_10225364 Ga0207667_102253642 231
184 3300025960 Ga0207651_10295423 Ga0207651_102954232 231
185 3300025972 Ga0207668_10014489 Ga0207668_100144892 231
186 3300025972 Ga0207668_10015236 Ga0207668_100152364 231
187 3300025972 Ga0207668_10019715 Ga0207668_100197154 231
188 3300026041 Ga0207639_10016777 Ga0207639_100167774 231
189 3300026088 Ga0207641_10033878 Ga0207641_100338783 231
190 3300026095 Ga0207676_10117970 Ga0207676_101179702 231
191 3300026095 Ga0207676_10179469 Ga0207676_101794693 231
192 3300026118 Ga0207675_100847692 Ga0207675_1008476922 231
193 3300026142 Ga0207698_10086273 Ga0207698_100862733 231
194 3300028379 Ga0268266_10162776 Ga0268266_101627762 231
195 3300028380 Ga0268265_10094235 Ga0268265_100942353 231
196 3300028381 Ga0268264_10022053 Ga0268264_100220533 231
197 3300028558 Ga0265326_10090064 Ga0265326_100900642 231
198 3300028573 Ga0265334_10048202 Ga0265334_100482023 231
199 3300028786 Ga0307517_10014862 Ga0307517_1001486210 231
200 3300028800 Ga0265338_10062571 Ga0265338_100625712 231
201 3300028800 Ga0265338_10110459 Ga0265338_101104592 231
202 3300030521 Ga0307511_10004780 Ga0307511_100047802 231
203 3300030744 Ga0316181_1234462 Ga0316181_12344622 231
204 3300031235 Ga0265330_10018409 Ga0265330_100184093 231
205 3300031235 Ga0265330_10048624 Ga0265330_100486242 231
206 3300031239 Ga0265328_10130192 Ga0265328_101301922 231
207 3300031241 Ga0265325_10008031 Ga0265325_100080314 231
208 3300031247 Ga0265340_10027295 Ga0265340_100272952 231
209 3300031249 Ga0265339_10041460 Ga0265339_100414602 231
210 3300031249 Ga0265339_10052521 Ga0265339_100525212 231
211 3300031251 Ga0265327_10000331 Ga0265327_1000033194 231
212 3300031456 Ga0307513_10004553 Ga0307513_1000455312 231
213 3300031456 Ga0307513_10006957 Ga0307513_1000695711 231
214 3300031456 Ga0307513_10029439 Ga0307513_100294395 231
215 3300031711 Ga0265314_10002412 Ga0265314_1000241212 231
216 3300031901 Ga0307406_10254186 Ga0307406_102541862 231
217 3300032005 Ga0307411_10360711 Ga0307411_103607112 231
218 3300035114 Ga0373939_0057021 Ga0373939_0057021_295_993 231
219 3300035692 Ga0373935_0110820 Ga0373935_0110820_322_1062 231
220 3300037312 Ga0395899_0000003 Ga0395899_0000003_860295_860996 231
221 3300037418 Ga0395900_0133990 Ga0395900_0133990_1632_2336 231
222 3300037418 Ga0395900_0416614 Ga0395900_0416614_468_1163 231
223 3300037471 Ga0395905_0106820 Ga0395905_0106820_315_1010 231
224 3300037853 Ga0436364_0475998 Ga0436364_0475998_119_814 231
225 3300039437 Ga0436365_0016859 Ga0436365_0016859_614_1324 231
226 3300039437 Ga0436365_0187494 Ga0436365_0187494_40029_40724 231
227 3300039437 Ga0436365_1464659 Ga0436365_1464659_4407_5108 231
228 3300044901 Ga0466960_0188318 Ga0466960_0188318_107_802 231
229 3300045049 Ga0466959_0104565 Ga0466959_0104565_240_941 231
230 3300046460 Ga0495638_0027756 Ga0495638_0027756_2252_2956 231
231 3300046460 Ga0495638_0167193 Ga0495638_0167193_20_727 231
232 3300046460 Ga0495638_0287400 Ga0495638_0287400_80_775 231
233 3300046471 Ga0495650_0000505 Ga0495650_0000505_42592_43290 231
234 3300046471 Ga0495650_0001480 Ga0495650_0001480_10847_11551 231
235 3300046474 Ga0495605_0000005 Ga0495605_0000005_357830_358528 231
236 3300046475 Ga0495639_0052735 Ga0495639_0052735_924_1664 231
237 3300046501 Ga0495607_0005531 Ga0495607_0005531_6529_7227 231
238 3300046506 Ga0495583_0034942 Ga0495583_0034942_1459_2214 231
239 3300046507 Ga0495606_0000044 Ga0495606_0000044_193743_194441 231
240 3300046507 Ga0495606_0003385 Ga0495606_0003385_3093_3806 231
241 3300046507 Ga0495606_0003578 Ga0495606_0003578_1945_2658 231
242 3300046507 Ga0495606_0014519 Ga0495606_0014519_5026_5724 231
243 3300046512 Ga0495610_0003785 Ga0495610_0003785_10535_11233 231
244 3300046512 Ga0495610_0005310 Ga0495610_0005310_3435_4211 231
245 3300046512 Ga0495610_0017333 Ga0495610_0017333_2607_3320 231
246 3300046525 Ga0495663_0048294 Ga0495663_0048294_279_1031 231
247 3300046531 Ga0495665_0023568 Ga0495665_0023568_655_1395 231
248 3300046538 Ga0495609_0225871 Ga0495609_0225871_14_712 231
249 3300046542 Ga0495597_0000697 Ga0495597_0000697_13177_13884 231
250 3300046557 Ga0495622_0000027 Ga0495622_0000027_120139_120840 231
251 3300046558 Ga0495633_0028411 Ga0495633_0028411_431_1129 231
252 3300046616 Ga0495668_0000147 Ga0495668_0000147_69602_70300 231
253 3300046616 Ga0495668_0002386 Ga0495668_0002386_12684_13382 231
254 3300046660 Ga0495625_0006831 Ga0495625_0006831_2953_3651 231
255 3300046660 Ga0495625_0019379 Ga0495625_0019379_2492_3202 231
256 3300046660 Ga0495625_0266464 Ga0495625_0266464_67_765 231
257 3300046664 Ga0495659_0000213 Ga0495659_0000213_15405_16103 231
258 3300046810 Ga0495660_0000339 Ga0495660_0000339_3934_4632 231
259 3300047318 Ga0495636_0224041 Ga0495636_0224041_84_788 231
260 3300047320 Ga0495672_0000169 Ga0495672_0000169_47536_48234 231
261 3300047445 Ga0495677_0082974 Ga0495677_0082974_332_1027 231
262 3300047472 Ga0495686_0011896 Ga0495686_0011896_4147_4842 231
263 3300048903 Ga0496100_0184085 Ga0496100_0184085_87_839 231
264 3300048904 Ga0496101_0082231 Ga0496101_0082231_1000_1752 231
265 3300048905 Ga0496102_0026094 Ga0496102_0026094_686_1438 231
266 3300048906 Ga0496103_0223092 Ga0496103_0223092_308_1060 231
267 3300048910 Ga0496107_0423750 Ga0496107_0423750_130_882 231
268 3300048912 Ga0496109_0004453 Ga0496109_0004453_3314_4066 231
269 3300048913 Ga0496110_0147765 Ga0496110_0147765_850_1602 231
270 3300048915 Ga0496112_0082806 Ga0496112_0082806_1454_2206 231
271 3300048915 Ga0496112_0144267 Ga0496112_0144267_1633_2328 231
272 3300048927 Ga0496124_0166417 Ga0496124_0166417_93_791 231
273 3300048927 Ga0496124_0294702 Ga0496124_0294702_14_712 231
274 3300048928 Ga0496125_0057747 Ga0496125_0057747_1023_1718 231
275 3300049570 Ga0501033_0047656 Ga0501033_0047656_1188_1883 231
276 3300049579 Ga0501043_0435873 Ga0501043_0435873_192_887 231
277 3300049581 Ga0501047_0027138 Ga0501047_0027138_1832_2527 231
278 3300049581 Ga0501047_0107685 Ga0501047_0107685_1201_1896 231
279 3300049581 Ga0501047_0687971 Ga0501047_0687971_122_817 231
280 3300049686 Ga0501257_003474 Ga0501257_003474_2655_3350 231
281 3300049822 Ga0501035_0179797 Ga0501035_0179797_525_1220 231
282 3300049823 Ga0501044_0052934 Ga0501044_0052934_1594_2289 231
283 3300053102 Ga0500554_001176 Ga0500554_001176_435_1130 231
284 3300053108 Ga0500562_000606 Ga0500562_000606_1378_2076 231
285 3300053108 Ga0500562_008599 Ga0500562_008599_231_926 231
286 3300053122 Ga0500608_110991 Ga0500608_110991_68_766 231
287 3300053136 Ga0500559_0000009 Ga0500559_0000009_81859_82557 231
288 3300053136 Ga0500559_0142382 Ga0500559_0142382_227_922 231
289 3300001989 JGI24739J22299_10000250 JGI24739J22299_100002507 233
290 3300001990 JGI24737J22298_10003526 JGI24737J22298_100035262 233
291 3300002067 JGI24735J21928_10000409 JGI24735J21928_100004092 233
292 3300002075 JGI24738J21930_10000103 JGI24738J21930_100001039 233
293 3300003316 rootH1_10124529 rootH1_101245291 233
294 3300005457 Ga0070662_100012467 Ga0070662_1000124674 233
295 3300005539 Ga0068853_100301910 Ga0068853_1003019103 233
296 3300005563 Ga0068855_100574522 Ga0068855_1005745222 233
297 3300005616 Ga0068852_100149926 Ga0068852_1001499264 233
298 3300013102 Ga0157371_10117909 Ga0157371_101179092 233
299 3300013307 Ga0157372_10337170 Ga0157372_103371702 233
300 3300013307 Ga0157372_10351805 Ga0157372_103518053 233
301 3300025904 Ga0207647_10000782 Ga0207647_1000078224 233
302 3300025933 Ga0207706_10007212 Ga0207706_100072124 233
303 3300026041 Ga0207639_10035704 Ga0207639_100357043 233
304 3300026142 Ga0207698_10371591 Ga0207698_103715912 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

44

261

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zix-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (e36d, r105h, c123s, g211d, k234n)- 1.8 a 0.9571 5 231
1din-assembly1.cif.gz_A dienelactone hydrolase at 2.8 angstroms 0.9568 5 231
1zi8-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a 0.9567 5 231
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.9565 5 231
1zi9-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (e36d, c123s) mutant- 1.5 a 0.9557 5 231
ID Description Score Start End Superfamily
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9557 5 231 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9356 5 231 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8855 18 230 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8751 1 230 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8738 1 223 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A173KV13-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.9867 1 230 GO:0008806
AF-A0A127V9R3-F1-model_v4 Carboxymethylenebutenolidase 0.9867 1 231 GO:0016787
AF-A0A6P0XN74-F1-model_v4 Dienelactone hydrolase family protein 0.9853 119 231 GO:0016787
AF-J2WVJ6-F1-model_v4 deleted 0.9845 1 231
AF-A0A127V9R3-F1-model_v4 Carboxymethylenebutenolidase 0.9825 1 231 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.39 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map