F397765

General Info

Members Datasets Scaffolds Average Seq Length
304 213 284 317

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0019647|Ga0495636_0019647_70_1107
Length 345
Sequence MSALDGIVVVDPSYLKRNLPGIVITTKTTMFMITGIHHVTAMASDSQKNLDFYTGILGLRLIKKTVNFDAPDIYHFYYGDSTGTPGSILTFFPFEGLTRGRHGKGMLNTTTFSVPTSSLDFWLTRLKRFGINHKQPQDRFEGEAVVYFEDEDGLGLELVFSEKDKREGFTTGNIPPEHSIRGFYNVEIWEEGYERTAALLTEQLDHMLIAEKSNRFRFAVRDSPGCYVDILCVPDSMKGLPGSGTVHHIAFATPSHETQEQIRIKIAQRMLNPTPVLDRNYFTSIYFREPGGVLFEVATEGPGFAVDEDPSHLGEALKLPQQYEKNRKDIEKVLRPVTVDLGKYK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
5 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
6 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
7 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
8 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
9 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
10 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
11 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
12 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
13 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
14 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
15 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
16 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
17 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
18 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
19 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
20 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
21 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
111 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
161 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
213 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0
Isolates 6.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.58
Nodule 0.33
Rhizoplane 0.99
Rhizosphere 79.61
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2869587 2162886007 Bacteria 1820
2 MRS1b_contig_6498775 2162886011 Bacteria 1571
3 JGI24740J21852_10002179 3300001979 Bacteria 8954
4 JGI24739J22299_10000159 3300001989 Bacteria 21947
5 JGI25154J39366_1000042 3300002738 Bacteria 143170
6 JGI25406J46586_10000523 3300003203 Bacteria 17970
7 JGI25153J46596_10030803 3300003215 Unclassified 1818
8 rootH2_10150111 3300003320 Bacteria 2361
9 rootH2_10250916 3300003320 Unclassified 1535
10 rootL2_10012779 3300003322 Bacteria 7271
11 rootL2_10173821 3300003322 Bacteria 3399
12 rootH1_10127978 3300003323 Bacteria 3012
13 rootH1_10155989 3300003323 Bacteria 1290
14 rootH1_10163754 3300003323 Bacteria 5173
15 JGI25160J50197_1010088 3300003354 Unclassified 3445
16 Ga0055526_1006543 3300003771 Bacteria 6290
17 Ga0055526_1007411 3300003771 Bacteria 5705
18 Ga0055528_1000386 3300003790 Bacteria 35904
19 Ga0055530_10000288 3300003791 Bacteria 45971
20 Ga0055531_10014535 3300003794 Bacteria 3537
21 Ga0065165_1000128 3300005262 Bacteria 129513
22 Ga0065714_10078603 3300005288 Bacteria 2575
23 Ga0065704_10070994 3300005289 Bacteria 13893
24 Ga0065704_10085203 3300005289 Bacteria 3248
25 Ga0065712_10091205 3300005290 Bacteria 2386
26 Ga0070658_10059847 3300005327 Bacteria 3101
27 Ga0070676_10032586 3300005328 Bacteria 2986
28 Ga0070676_10065006 3300005328 Bacteria 2177
29 Ga0070683_100069397 3300005329 Bacteria 3286
30 Ga0070690_100098813 3300005330 Bacteria 1932
31 Ga0070670_100239770 3300005331 Bacteria 1579
32 Ga0068869_100002433 3300005334 Bacteria 11226
33 Ga0068869_100017575 3300005334 Bacteria 4851
34 Ga0068869_100074459 3300005334 Bacteria 2520
35 Ga0070666_10000047 3300005335 Bacteria 106512
36 Ga0070666_10053360 3300005335 Unclassified 2726
37 Ga0070666_10071785 3300005335 Bacteria 2356
38 Ga0070682_100000122 3300005337 Bacteria 69084
39 Ga0068868_100011227 3300005338 Bacteria 6522
40 Ga0068868_100115630 3300005338 Bacteria 2184
41 Ga0070660_100004013 3300005339 Bacteria 10161
42 Ga0070689_100059645 3300005340 Bacteria 2966
43 Ga0070661_100098851 3300005344 Bacteria 2167
44 Ga0070661_100129487 3300005344 Bacteria 1895
45 Ga0070669_100000065 3300005353 Bacteria 105999
46 Ga0070675_100009535 3300005354 Bacteria 7552
47 Ga0070675_100016656 3300005354 Bacteria 5836
48 Ga0070675_100107646 3300005354 Bacteria 2354
49 Ga0070675_100246814 3300005354 Bacteria 1561
50 Ga0070671_100069619 3300005355 Bacteria 2935
51 Ga0070673_100033176 3300005364 Bacteria 3895
52 Ga0070688_100014747 3300005365 Bacteria 4433
53 Ga0070688_100165699 3300005365 Bacteria 1521
54 Ga0070659_100057998 3300005366 Bacteria 3054
55 Ga0070667_100136328 3300005367 Bacteria 2146
56 Ga0070667_100173495 3300005367 Bacteria 1904
57 Ga0070663_100169550 3300005455 Bacteria 1686
58 Ga0070663_100395038 3300005455 Bacteria 1129
59 Ga0070662_100023263 3300005457 Bacteria 4255
60 Ga0070685_10243156 3300005466 Bacteria 1189
61 Ga0070679_100218478 3300005530 Bacteria 1867
62 Ga0070684_100017886 3300005535 Bacteria 5826
63 Ga0070672_100054056 3300005543 Bacteria 3142
64 Ga0070672_100112839 3300005543 Bacteria 2218
65 Ga0070672_100208244 3300005543 Unclassified 1637
66 Ga0068855_100043046 3300005563 Bacteria 5350
67 Ga0070664_100031724 3300005564 Bacteria 4417
68 Ga0068856_100004590 3300005614 Bacteria 13736
69 Ga0068852_100015024 3300005616 Bacteria 5986
70 Ga0068852_100062421 3300005616 Bacteria 3241
71 Ga0068852_100113288 3300005616 Bacteria 2470
72 Ga0068852_100423387 3300005616 Bacteria 1314
73 Ga0068859_100000030 3300005617 Bacteria 175435
74 Ga0068859_100570019 3300005617 Bacteria 1226
75 Ga0068864_100009350 3300005618 Bacteria 8085
76 Ga0068861_100149992 3300005719 Bacteria 1912
77 Ga0068851_10011899 3300005834 Bacteria 4092
78 Ga0068851_10040546 3300005834 Bacteria 2340
79 Ga0068851_10129045 3300005834 Bacteria 1366
80 Ga0068863_100001320 3300005841 Bacteria 24709
81 Ga0068863_100145703 3300005841 Bacteria 2265
82 Ga0068858_100016413 3300005842 Bacteria 6953
83 Ga0068860_100002795 3300005843 Bacteria 18152
84 Ga0068860_100411325 3300005843 Bacteria 1339
85 Ga0081539_10000382 3300005985 Bacteria 96235
86 Ga0075364_10018204 3300006051 Bacteria 4396
87 Ga0097621_100011133 3300006237 Bacteria 6618
88 Ga0097621_100421562 3300006237 Bacteria 1198
89 Ga0068871_100112256 3300006358 Bacteria 2293
90 Ga0075431_100029944 3300006847 Bacteria 5605
91 Ga0075434_100011641 3300006871 Bacteria 8308
92 Ga0068865_100161590 3300006881 Bacteria 1709
93 Ga0097620_100000030 3300006931 Bacteria 175435
94 Ga0097620_100570016 3300006931 Bacteria 1226
95 Ga0105244_10000010 3300009036 Bacteria 265799
96 Ga0105240_10000846 3300009093 Bacteria 55115
97 Ga0105240_10028059 3300009093 Bacteria 7360
98 Ga0105240_10165527 3300009093 Bacteria 2623
99 Ga0105247_10007077 3300009101 Bacteria 6891
100 Ga0105243_10000201 3300009148 Bacteria 69844
101 Ga0105243_10507648 3300009148 Bacteria 1144
102 Ga0105241_10000604 3300009174 Bacteria 27074
103 Ga0105241_10006081 3300009174 Bacteria 8898
104 Ga0105241_10421375 3300009174 Bacteria 1175
105 Ga0105237_10002280 3300009545 Bacteria 23870
106 Ga0105237_10002650 3300009545 Bacteria 22003
107 Ga0105238_10238026 3300009551 Bacteria 1798
108 Ga0105249_10015410 3300009553 Bacteria 6765
109 Ga0105249_10043452 3300009553 Bacteria 4086
110 Ga0105249_10049773 3300009553 Bacteria 3821
111 Ga0105239_10009914 3300010375 Bacteria 10697
112 Ga0105239_10312500 3300010375 Bacteria 1771
113 Ga0105239_10317499 3300010375 Bacteria 1756
114 Ga0105246_10010264 3300011119 Bacteria 5787
115 Ga0105246_10179784 3300011119 Bacteria 1628
116 Ga0157373_10000019 3300013100 Bacteria 166579
117 Ga0157373_10001845 3300013100 Bacteria 16096
118 Ga0157371_10066022 3300013102 Bacteria 2563
119 Ga0157371_10082249 3300013102 Unclassified 2280
120 Ga0157371_10130613 3300013102 Bacteria 1787
121 Ga0157370_10004214 3300013104 Bacteria 16631
122 Ga0157370_10141758 3300013104 Bacteria 2239
123 Ga0157369_10028156 3300013105 Bacteria 6220
124 Ga0157374_10017489 3300013296 Bacteria 6314
125 Ga0157374_10025442 3300013296 Bacteria 5315
126 Ga0157374_10184284 3300013296 Bacteria 2040
127 Ga0157374_10234712 3300013296 Bacteria 1803
128 Ga0157378_10168488 3300013297 Bacteria 2052
129 Ga0163162_10001435 3300013306 Bacteria 22200
130 Ga0163162_10129880 3300013306 Unclassified 2628
131 Ga0163162_10183827 3300013306 Bacteria 2217
132 Ga0163162_10305272 3300013306 Bacteria 1724
133 Ga0157372_10083383 3300013307 Bacteria 3621
134 Ga0157372_10089642 3300013307 Bacteria 3494
135 Ga0157372_10179995 3300013307 Bacteria 2447
136 Ga0157372_10187486 3300013307 Bacteria 2395
137 Ga0157375_10008186 3300013308 Bacteria 9154
138 Ga0157375_10198196 3300013308 Bacteria 2163
139 Ga0163163_10006767 3300014325 Bacteria 10050
140 Ga0163163_10157836 3300014325 Bacteria 2313
141 Ga0157380_10075578 3300014326 Bacteria 2738
142 Ga0182008_10000015 3300014497 Bacteria 243121
143 Ga0157377_10096054 3300014745 Bacteria 1758
144 Ga0157379_10137072 3300014968 Bacteria 2205
145 Ga0157376_10004130 3300014969 Bacteria 10063
146 Ga0157376_10019671 3300014969 Bacteria 5209
147 Ga0157376_10087213 3300014969 Bacteria 2693
148 Ga0157376_10121212 3300014969 Unclassified 2318
149 Ga0163161_10025366 3300017792 Bacteria 4195
150 Ga0163161_10081249 3300017792 Unclassified 2386
151 Ga0213876_10062842 3300021384 Bacteria 1960
152 Ga0209646_1000017 3300025246 Bacteria 488265
153 Ga0209026_1000721 3300025250 Bacteria 19458
154 Ga0209673_1000085 3300025273 Bacteria 215647
155 Ga0209675_1000094 3300025291 Bacteria 138083
156 Ga0209564_1002760 3300025295 Bacteria 13199
157 Ga0209564_1005109 3300025295 Bacteria 7635
158 Ga0209758_1009023 3300025297 Bacteria 6302
159 Ga0209050_1000524 3300025298 Bacteria 63793
160 Ga0207426_1001174 3300025302 Bacteria 23427
161 Ga0209257_1001638 3300025304 Bacteria 25639
162 Ga0207697_10056286 3300025315 Bacteria 1631
163 Ga0207656_10006093 3300025321 Bacteria 4316
164 Ga0207656_10085257 3300025321 Unclassified 1426
165 Ga0207655_1000347 3300025728 Bacteria 67127
166 Ga0207710_10008371 3300025900 Bacteria 4362
167 Ga0207645_10042168 3300025907 Bacteria 2920
168 Ga0207654_10013169 3300025911 Bacteria 4250
169 Ga0207695_10000687 3300025913 Bacteria 66305
170 Ga0207695_10034868 3300025913 Bacteria 5465
171 Ga0207671_10001884 3300025914 Bacteria 23313
172 Ga0207671_10002245 3300025914 Bacteria 20915
173 Ga0207671_10049143 3300025914 Bacteria 3122
174 Ga0207657_10004306 3300025919 Bacteria 15087
175 Ga0207649_10060503 3300025920 Bacteria 2380
176 Ga0207681_10000021 3300025923 Bacteria 236982
177 Ga0207681_10427032 3300025923 Bacteria 1075
178 Ga0207694_10007575 3300025924 Bacteria 8229
179 Ga0207694_10244154 3300025924 Bacteria 1468
180 Ga0207659_10029295 3300025926 Bacteria 3751
181 Ga0207659_10067921 3300025926 Bacteria 2591
182 Ga0207706_10012755 3300025933 Bacteria 7649
183 Ga0207706_10067423 3300025933 Bacteria 3148
184 Ga0207686_10175800 3300025934 Bacteria 1514
185 Ga0207709_10000312 3300025935 Bacteria 52932
186 Ga0207704_10203441 3300025938 Unclassified 1451
187 Ga0207691_10040616 3300025940 Unclassified 4297
188 Ga0207691_10348771 3300025940 Unclassified 1267
189 Ga0207689_10027541 3300025942 Bacteria 4756
190 Ga0207689_10046433 3300025942 Bacteria 3590
191 Ga0207661_10022255 3300025944 Bacteria 4769
192 Ga0207661_10343543 3300025944 Bacteria 1345
193 Ga0207679_10023633 3300025945 Bacteria 4205
194 Ga0207712_10008308 3300025961 Bacteria 6563
195 Ga0207668_10010633 3300025972 Bacteria 5567
196 Ga0207658_10148894 3300025986 Bacteria 1904
197 Ga0207658_10222069 3300025986 Bacteria 1590
198 Ga0207703_10022982 3300026035 Bacteria 4895
199 Ga0207703_10035122 3300026035 Bacteria 3983
200 Ga0207678_10423206 3300026067 Bacteria 1155
201 Ga0207702_10193230 3300026078 Bacteria 1882
202 Ga0207641_10000061 3300026088 Bacteria 160161
203 Ga0207676_10014035 3300026095 Bacteria 5753
204 Ga0207674_10212757 3300026116 Bacteria 1882
205 Ga0207675_100045820 3300026118 Bacteria 4084
206 Ga0207698_10062533 3300026142 Bacteria 2908
207 Ga0207698_10482278 3300026142 Bacteria 1203
208 Ga0268264_10003332 3300028381 Bacteria 13881
209 Ga0268264_10007686 3300028381 Bacteria 8983
210 Ga0307509_10355288 3300031507 Bacteria 1187
211 Ga0307414_10177198 3300032004 Unclassified 1711
212 Ga0373935_0332473 3300035692 Bacteria 1080
213 Ga0373947_0077434 3300035725 Bacteria 2051
214 Ga0373937_0319161 3300036401 Bacteria 1470
215 Ga0395900_0052032 3300037418 Unclassified 4217
216 Ga0395905_0028906 3300037471 Bacteria 5225
217 Ga0395905_0087590 3300037471 Bacteria 2919
218 Ga0395905_0177823 3300037471 Bacteria 1997
219 Ga0436365_0215388 3300039437 Bacteria 20742
220 Ga0439439_0000869 3300041406 Bacteria 5563
221 Ga0439431_0004569 3300041997 Bacteria 3042
222 Ga0439445_0008296 3300042004 Bacteria 2429
223 Ga0439449_0015386 3300042007 Unclassified 2874
224 Ga0439457_002577 3300042014 Bacteria 5133
225 Ga0451577_0000557 3300042876 Bacteria 60863
226 Ga0466972_0045641 3300044658 Unclassified 2123
227 Ga0453684_0000024 3300044712 Bacteria 819351
228 Ga0466957_0001781 3300044842 Bacteria 11334
229 Ga0495596_0000877 3300046500 Bacteria 18134
230 Ga0495618_0258890 3300046514 Bacteria 1090
231 Ga0495632_0005404 3300046519 Bacteria 8453
232 Ga0495643_0056305 3300046522 Bacteria 2099
233 Ga0495609_0000025 3300046538 Bacteria 256898
234 Ga0495633_0008534 3300046558 Bacteria 5759
235 Ga0495668_0005139 3300046616 Bacteria 8995
236 Ga0495625_0001869 3300046660 Bacteria 23924
237 Ga0495625_0162066 3300046660 Bacteria 1498
238 Ga0495670_0098875 3300046691 Bacteria 1501
239 Ga0495636_0019647 3300047318 Bacteria 2717
240 Ga0495686_0000151 3300047472 Bacteria 135048
241 Ga0496102_0007675 3300048905 Bacteria 9218
242 Ga0496108_0441207 3300048911 Bacteria 1137
243 Ga0496113_0090824 3300048916 Bacteria 2353
244 Ga0496116_0000006 3300048919 Bacteria 811937
245 Ga0496117_0000023 3300048920 Bacteria 438585
246 Ga0496117_0093364 3300048920 Bacteria 1930
247 Ga0496118_0000388 3300048921 Bacteria 74358
248 Ga0496119_0000010 3300048922 Bacteria 438534
249 Ga0496120_0116137 3300048923 Bacteria 1390
250 Ga0496121_0000011 3300048924 Bacteria 792193
251 Ga0496121_0018752 3300048924 Bacteria 6955
252 Ga0496122_0000066 3300048925 Bacteria 231473
253 Ga0496122_0000091 3300048925 Bacteria 204567
254 Ga0496122_0000458 3300048925 Bacteria 84794
255 Ga0496122_0003230 3300048925 Bacteria 21662
256 Ga0496122_0010627 3300048925 Bacteria 9456
257 Ga0496123_0000294 3300048926 Bacteria 97574
258 Ga0496123_0006185 3300048926 Bacteria 11703
259 Ga0496123_0014857 3300048926 Bacteria 6426
260 Ga0496124_0000418 3300048927 Bacteria 76015
261 Ga0496125_0000181 3300048928 Bacteria 138133
262 Ga0496125_0007980 3300048928 Bacteria 11181
263 Ga0496126_0001022 3300048929 Bacteria 47547
264 Ga0496126_0117196 3300048929 Bacteria 2314
265 Ga0501032_0013869 3300049569 Bacteria 5717
266 Ga0501034_0059782 3300049571 Bacteria 3828
267 Ga0501036_0186758 3300049572 Bacteria 1744
268 Ga0501037_0006592 3300049573 Bacteria 8490
269 Ga0501038_0038791 3300049574 Bacteria 4169
270 Ga0501039_0106932 3300049575 Bacteria 2185
271 Ga0501043_0008195 3300049579 Bacteria 8239
272 Ga0501047_0027328 3300049581 Bacteria 5496
273 Ga0501219_000779 3300049703 Bacteria 4257
274 Ga0501080_0143006 3300049742 Bacteria 2212
275 Ga0501035_0012853 3300049822 Bacteria 7731
276 Ga0501044_0016580 3300049823 Bacteria 7907
277 Ga0501284_00181 3300050005 Bacteria 4901
278 nmdc:mga06r32_60578_c1 3300050510 Bacteria 3643
279 nmdc:mga0n895_128183_c1 3300050512 Bacteria 2562
280 nmdc:mga0n895_15609_c1 3300050512 Bacteria 6934
281 nmdc:mga08x19_61933_c1 3300050514 Bacteria 2425
282 Ga0500573_0023147 3300053140 Bacteria 3568
283 Ga0500616_0005533 3300053153 Bacteria 8557
284 Ga0500645_070462 3300053730 Bacteria 1004

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041406 Ga0439439_0000869 Ga0439439_0000869_495_1328 276
2 3300053730 Ga0500645_070462 Ga0500645_070462_50_910 285
3 3300053140 Ga0500573_0023147 Ga0500573_0023147_1170_2093 286
4 3300005353 Ga0070669_100000065 Ga0070669_10000006572 297
5 3300025923 Ga0207681_10000021 Ga0207681_1000002197 297
6 3300035692 Ga0373935_0332473 Ga0373935_0332473_75_1040 302
7 3300035725 Ga0373947_0077434 Ga0373947_0077434_475_1440 302
8 3300006051 Ga0075364_10018204 Ga0075364_100182043 313
9 3300009093 Ga0105240_10165527 Ga0105240_101655272 313
10 3300036401 Ga0373937_0319161 Ga0373937_0319161_150_1112 313
11 iso_pu_bacteria 2582581278 2585145178 313
12 iso_pu_bacteria 2585428045 2587677923 313
13 iso_pu_bacteria 2585428182 2588209812 313
14 iso_pu_bacteria 2585428183 2588215035 313
15 iso_pu_bacteria 2585428184 2588218230 313
16 iso_pu_bacteria 2585428185 2588222458 313
17 iso_pu_bacteria 2585428187 2588234003 313
18 iso_pu_bacteria 2588254255 2590604110 313
19 iso_pu_bacteria 2751185877 2753670954 313
20 iso_pu_bacteria 2765235839 2765573567 313
21 iso_pu_bacteria 2772190705 2772605935 313
22 iso_pu_bacteria 2816332188 2816873929 313
23 iso_pu_bacteria 2871720351 2871722875 313
24 iso_pu_bacteria 2889290771 2889295840 313
25 iso_pu_bacteria 2905999023 2905999726 313
26 iso_pu_bacteria 2945924605 2945928214 313
27 iso_pu_bacteria 2946019816 2946022151 313
28 iso_pu_bacteria 2993372514 2993372867 313
29 3300005354 Ga0070675_100246814 Ga0070675_1002468142 314
30 3300006871 Ga0075434_100011641 Ga0075434_1000116414 314
31 3300009093 Ga0105240_10028059 Ga0105240_100280593 314
32 3300009545 Ga0105237_10002650 Ga0105237_1000265015 314
33 3300010375 Ga0105239_10009914 Ga0105239_100099143 314
34 3300025913 Ga0207695_10034868 Ga0207695_100348686 314
35 3300025914 Ga0207671_10049143 Ga0207671_100491432 314
36 3300028381 Ga0268264_10003332 Ga0268264_1000333214 314
37 3300041997 Ga0439431_0004569 Ga0439431_0004569_186_1133 314
38 3300042004 Ga0439445_0008296 Ga0439445_0008296_677_1624 314
39 3300050512 nmdc:mga0n895_128183_c1 nmdc:mga0n895_128183_c1_1470_2432 314
40 3300050512 nmdc:mga0n895_15609_c1 nmdc:mga0n895_15609_c1_3780_4742 314
41 3300050514 nmdc:mga08x19_61933_c1 nmdc:mga08x19_61933_c1_253_1215 314
42 iso_pu_bacteria 2929921140 2929925338 314
43 iso_pu_bacteria 8003151029 8003154173 314
44 3300005288 Ga0065714_10078603 Ga0065714_100786032 315
45 3300005354 Ga0070675_100009535 Ga0070675_1000095354 315
46 3300005616 Ga0068852_100113288 Ga0068852_1001132881 315
47 3300006847 Ga0075431_100029944 Ga0075431_1000299447 315
48 3300006881 Ga0068865_100161590 Ga0068865_1001615902 315
49 3300013307 Ga0157372_10187486 Ga0157372_101874862 315
50 3300014326 Ga0157380_10075578 Ga0157380_100755783 315
51 3300014969 Ga0157376_10004130 Ga0157376_100041304 315
52 3300014969 Ga0157376_10087213 Ga0157376_100872133 315
53 3300014969 Ga0157376_10121212 Ga0157376_101212122 315
54 3300025923 Ga0207681_10427032 Ga0207681_104270321 315
55 3300025926 Ga0207659_10067921 Ga0207659_100679212 315
56 3300025938 Ga0207704_10203441 Ga0207704_102034412 315
57 3300026142 Ga0207698_10062533 Ga0207698_100625332 315
58 3300031507 Ga0307509_10355288 Ga0307509_103552881 315
59 3300042876 Ga0451577_0000557 Ga0451577_0000557_22834_23793 315
60 3300044712 Ga0453684_0000024 Ga0453684_0000024_248007_248966 315
61 3300046691 Ga0495670_0098875 Ga0495670_0098875_339_1298 315
62 3300049569 Ga0501032_0013869 Ga0501032_0013869_2046_2996 315
63 3300049571 Ga0501034_0059782 Ga0501034_0059782_890_1840 315
64 3300049572 Ga0501036_0186758 Ga0501036_0186758_534_1484 315
65 3300049573 Ga0501037_0006592 Ga0501037_0006592_5545_6495 315
66 3300049574 Ga0501038_0038791 Ga0501038_0038791_1729_2679 315
67 3300049575 Ga0501039_0106932 Ga0501039_0106932_1150_2100 315
68 3300049579 Ga0501043_0008195 Ga0501043_0008195_1696_2646 315
69 3300049581 Ga0501047_0027328 Ga0501047_0027328_3070_4020 315
70 3300049742 Ga0501080_0143006 Ga0501080_0143006_1053_2000 315
71 3300049822 Ga0501035_0012853 Ga0501035_0012853_1973_2923 315
72 3300049823 Ga0501044_0016580 Ga0501044_0016580_250_1200 315
73 3300050510 nmdc:mga06r32_60578_c1 nmdc:mga06r32_60578_c1_2076_3026 315
74 2162886011 MRS1b_contig_6498775 MRS1b_0657.00003360 316
75 3300001989 JGI24739J22299_10000159 JGI24739J22299_100001595 316
76 3300003203 JGI25406J46586_10000523 JGI25406J46586_100005236 316
77 3300003215 JGI25153J46596_10030803 JGI25153J46596_100308032 316
78 3300003320 rootH2_10150111 rootH2_101501112 316
79 3300003320 rootH2_10250916 rootH2_102509162 316
80 3300003322 rootL2_10012779 rootL2_100127795 316
81 3300003322 rootL2_10173821 rootL2_101738212 316
82 3300003323 rootH1_10127978 rootH1_101279783 316
83 3300003323 rootH1_10155989 rootH1_101559891 316
84 3300003354 JGI25160J50197_1010088 JGI25160J50197_10100886 316
85 3300003771 Ga0055526_1006543 Ga0055526_10065437 316
86 3300003771 Ga0055526_1007411 Ga0055526_10074111 316
87 3300003790 Ga0055528_1000386 Ga0055528_100038613 316
88 3300003791 Ga0055530_10000288 Ga0055530_1000028825 316
89 3300003794 Ga0055531_10014535 Ga0055531_100145353 316
90 3300005262 Ga0065165_1000128 Ga0065165_100012824 316
91 3300005290 Ga0065712_10091205 Ga0065712_100912053 316
92 3300005327 Ga0070658_10059847 Ga0070658_100598473 316
93 3300005328 Ga0070676_10032586 Ga0070676_100325862 316
94 3300005328 Ga0070676_10065006 Ga0070676_100650062 316
95 3300005329 Ga0070683_100069397 Ga0070683_1000693973 316
96 3300005330 Ga0070690_100098813 Ga0070690_1000988132 316
97 3300005331 Ga0070670_100239770 Ga0070670_1002397702 316
98 3300005334 Ga0068869_100002433 Ga0068869_10000243312 316
99 3300005334 Ga0068869_100017575 Ga0068869_1000175754 316
100 3300005334 Ga0068869_100074459 Ga0068869_1000744592 316
101 3300005335 Ga0070666_10000047 Ga0070666_1000004769 316
102 3300005335 Ga0070666_10053360 Ga0070666_100533603 316
103 3300005335 Ga0070666_10071785 Ga0070666_100717851 316
104 3300005338 Ga0068868_100011227 Ga0068868_1000112276 316
105 3300005338 Ga0068868_100115630 Ga0068868_1001156301 316
106 3300005339 Ga0070660_100004013 Ga0070660_1000040136 316
107 3300005340 Ga0070689_100059645 Ga0070689_1000596453 316
108 3300005344 Ga0070661_100098851 Ga0070661_1000988512 316
109 3300005344 Ga0070661_100129487 Ga0070661_1001294872 316
110 3300005354 Ga0070675_100016656 Ga0070675_1000166566 316
111 3300005354 Ga0070675_100107646 Ga0070675_1001076462 316
112 3300005355 Ga0070671_100069619 Ga0070671_1000696194 316
113 3300005364 Ga0070673_100033176 Ga0070673_1000331764 316
114 3300005365 Ga0070688_100014747 Ga0070688_1000147472 316
115 3300005365 Ga0070688_100165699 Ga0070688_1001656992 316
116 3300005366 Ga0070659_100057998 Ga0070659_1000579983 316
117 3300005367 Ga0070667_100136328 Ga0070667_1001363282 316
118 3300005367 Ga0070667_100173495 Ga0070667_1001734951 316
119 3300005455 Ga0070663_100395038 Ga0070663_1003950381 316
120 3300005457 Ga0070662_100023263 Ga0070662_1000232635 316
121 3300005466 Ga0070685_10243156 Ga0070685_102431561 316
122 3300005530 Ga0070679_100218478 Ga0070679_1002184783 316
123 3300005535 Ga0070684_100017886 Ga0070684_1000178862 316
124 3300005543 Ga0070672_100054056 Ga0070672_1000540562 316
125 3300005543 Ga0070672_100112839 Ga0070672_1001128392 316
126 3300005543 Ga0070672_100208244 Ga0070672_1002082442 316
127 3300005563 Ga0068855_100043046 Ga0068855_1000430462 316
128 3300005564 Ga0070664_100031724 Ga0070664_1000317242 316
129 3300005614 Ga0068856_100004590 Ga0068856_1000045909 316
130 3300005616 Ga0068852_100015024 Ga0068852_1000150242 316
131 3300005616 Ga0068852_100062421 Ga0068852_1000624212 316
132 3300005616 Ga0068852_100423387 Ga0068852_1004233872 316
133 3300005617 Ga0068859_100000030 Ga0068859_10000003075 316
134 3300005617 Ga0068859_100570019 Ga0068859_1005700192 316
135 3300005618 Ga0068864_100009350 Ga0068864_1000093504 316
136 3300005719 Ga0068861_100149992 Ga0068861_1001499922 316
137 3300005834 Ga0068851_10011899 Ga0068851_100118993 316
138 3300005834 Ga0068851_10040546 Ga0068851_100405462 316
139 3300005834 Ga0068851_10129045 Ga0068851_101290451 316
140 3300005841 Ga0068863_100001320 Ga0068863_10000132010 316
141 3300005841 Ga0068863_100145703 Ga0068863_1001457033 316
142 3300005842 Ga0068858_100016413 Ga0068858_1000164134 316
143 3300005843 Ga0068860_100002795 Ga0068860_1000027957 316
144 3300005843 Ga0068860_100411325 Ga0068860_1004113252 316
145 3300005985 Ga0081539_10000382 Ga0081539_1000038227 316
146 3300006237 Ga0097621_100011133 Ga0097621_1000111337 316
147 3300006237 Ga0097621_100421562 Ga0097621_1004215622 316
148 3300006358 Ga0068871_100112256 Ga0068871_1001122563 316
149 3300006931 Ga0097620_100000030 Ga0097620_10000003070 316
150 3300006931 Ga0097620_100570016 Ga0097620_1005700162 316
151 3300009093 Ga0105240_10000846 Ga0105240_1000084626 316
152 3300009101 Ga0105247_10007077 Ga0105247_100070774 316
153 3300009148 Ga0105243_10507648 Ga0105243_105076481 316
154 3300009174 Ga0105241_10000604 Ga0105241_1000060413 316
155 3300009174 Ga0105241_10006081 Ga0105241_100060817 316
156 3300009174 Ga0105241_10421375 Ga0105241_104213752 316
157 3300009545 Ga0105237_10002280 Ga0105237_1000228010 316
158 3300009551 Ga0105238_10238026 Ga0105238_102380262 316
159 3300009553 Ga0105249_10015410 Ga0105249_100154104 316
160 3300009553 Ga0105249_10043452 Ga0105249_100434523 316
161 3300009553 Ga0105249_10049773 Ga0105249_100497733 316
162 3300010375 Ga0105239_10312500 Ga0105239_103125003 316
163 3300010375 Ga0105239_10317499 Ga0105239_103174992 316
164 3300011119 Ga0105246_10010264 Ga0105246_100102644 316
165 3300011119 Ga0105246_10179784 Ga0105246_101797842 316
166 3300013100 Ga0157373_10001845 Ga0157373_100018458 316
167 3300013102 Ga0157371_10082249 Ga0157371_100822493 316
168 3300013102 Ga0157371_10130613 Ga0157371_101306132 316
169 3300013105 Ga0157369_10028156 Ga0157369_100281563 316
170 3300013296 Ga0157374_10017489 Ga0157374_100174896 316
171 3300013296 Ga0157374_10025442 Ga0157374_100254424 316
172 3300013296 Ga0157374_10184284 Ga0157374_101842842 316
173 3300013296 Ga0157374_10234712 Ga0157374_102347123 316
174 3300013297 Ga0157378_10168488 Ga0157378_101684881 316
175 3300013306 Ga0163162_10001435 Ga0163162_1000143512 316
176 3300013306 Ga0163162_10129880 Ga0163162_101298802 316
177 3300013306 Ga0163162_10183827 Ga0163162_101838272 316
178 3300013306 Ga0163162_10305272 Ga0163162_103052721 316
179 3300013307 Ga0157372_10083383 Ga0157372_100833833 316
180 3300013307 Ga0157372_10089642 Ga0157372_100896423 316
181 3300013307 Ga0157372_10179995 Ga0157372_101799951 316
182 3300013308 Ga0157375_10008186 Ga0157375_100081866 316
183 3300013308 Ga0157375_10198196 Ga0157375_101981962 316
184 3300014325 Ga0163163_10006767 Ga0163163_100067673 316
185 3300014325 Ga0163163_10157836 Ga0163163_101578362 316
186 3300014745 Ga0157377_10096054 Ga0157377_100960542 316
187 3300014968 Ga0157379_10137072 Ga0157379_101370722 316
188 3300014969 Ga0157376_10019671 Ga0157376_100196717 316
189 3300017792 Ga0163161_10025366 Ga0163161_100253668 316
190 3300017792 Ga0163161_10081249 Ga0163161_100812492 316
191 3300021384 Ga0213876_10062842 Ga0213876_100628422 316
192 3300025273 Ga0209673_1000085 Ga0209673_1000085108 316
193 3300025295 Ga0209564_1002760 Ga0209564_10027605 316
194 3300025295 Ga0209564_1005109 Ga0209564_10051097 316
195 3300025297 Ga0209758_1009023 Ga0209758_10090236 316
196 3300025298 Ga0209050_1000524 Ga0209050_100052428 316
197 3300025302 Ga0207426_1001174 Ga0207426_100117421 316
198 3300025304 Ga0209257_1001638 Ga0209257_100163812 316
199 3300025315 Ga0207697_10056286 Ga0207697_100562862 316
200 3300025321 Ga0207656_10006093 Ga0207656_100060934 316
201 3300025321 Ga0207656_10085257 Ga0207656_100852572 316
202 3300025900 Ga0207710_10008371 Ga0207710_100083712 316
203 3300025907 Ga0207645_10042168 Ga0207645_100421683 316
204 3300025911 Ga0207654_10013169 Ga0207654_100131692 316
205 3300025913 Ga0207695_10000687 Ga0207695_1000068723 316
206 3300025914 Ga0207671_10001884 Ga0207671_100018847 316
207 3300025914 Ga0207671_10002245 Ga0207671_100022453 316
208 3300025919 Ga0207657_10004306 Ga0207657_100043066 316
209 3300025920 Ga0207649_10060503 Ga0207649_100605032 316
210 3300025924 Ga0207694_10007575 Ga0207694_100075753 316
211 3300025924 Ga0207694_10244154 Ga0207694_102441542 316
212 3300025926 Ga0207659_10029295 Ga0207659_100292952 316
213 3300025933 Ga0207706_10012755 Ga0207706_100127553 316
214 3300025933 Ga0207706_10067423 Ga0207706_100674234 316
215 3300025934 Ga0207686_10175800 Ga0207686_101758001 316
216 3300025940 Ga0207691_10040616 Ga0207691_100406167 316
217 3300025940 Ga0207691_10348771 Ga0207691_103487712 316
218 3300025942 Ga0207689_10027541 Ga0207689_100275412 316
219 3300025942 Ga0207689_10046433 Ga0207689_100464333 316
220 3300025944 Ga0207661_10022255 Ga0207661_100222552 316
221 3300025944 Ga0207661_10343543 Ga0207661_103435431 316
222 3300025945 Ga0207679_10023633 Ga0207679_100236334 316
223 3300025961 Ga0207712_10008308 Ga0207712_100083084 316
224 3300025972 Ga0207668_10010633 Ga0207668_100106333 316
225 3300025986 Ga0207658_10148894 Ga0207658_101488942 316
226 3300025986 Ga0207658_10222069 Ga0207658_102220692 316
227 3300026035 Ga0207703_10022982 Ga0207703_100229822 316
228 3300026035 Ga0207703_10035122 Ga0207703_100351223 316
229 3300026067 Ga0207678_10423206 Ga0207678_104232061 316
230 3300026078 Ga0207702_10193230 Ga0207702_101932301 316
231 3300026088 Ga0207641_10000061 Ga0207641_100000618 316
232 3300026095 Ga0207676_10014035 Ga0207676_100140354 316
233 3300026116 Ga0207674_10212757 Ga0207674_102127572 316
234 3300026118 Ga0207675_100045820 Ga0207675_1000458202 316
235 3300026142 Ga0207698_10482278 Ga0207698_104822782 316
236 3300028381 Ga0268264_10007686 Ga0268264_100076864 316
237 3300032004 Ga0307414_10177198 Ga0307414_101771982 316
238 3300037418 Ga0395900_0052032 Ga0395900_0052032_31_984 316
239 3300037471 Ga0395905_0028906 Ga0395905_0028906_3415_4368 316
240 3300037471 Ga0395905_0087590 Ga0395905_0087590_365_1348 316
241 3300037471 Ga0395905_0177823 Ga0395905_0177823_274_1227 316
242 3300039437 Ga0436365_0215388 Ga0436365_0215388_15999_16949 316
243 3300042007 Ga0439449_0015386 Ga0439449_0015386_548_1501 316
244 3300042014 Ga0439457_002577 Ga0439457_002577_2056_3009 316
245 3300044658 Ga0466972_0045641 Ga0466972_0045641_193_1146 316
246 3300044842 Ga0466957_0001781 Ga0466957_0001781_3490_4443 316
247 3300046514 Ga0495618_0258890 Ga0495618_0258890_56_1009 316
248 3300046616 Ga0495668_0005139 Ga0495668_0005139_5722_6675 316
249 3300046660 Ga0495625_0162066 Ga0495625_0162066_313_1266 316
250 3300047318 Ga0495636_0019647 Ga0495636_0019647_70_1107 316
251 3300048911 Ga0496108_0441207 Ga0496108_0441207_58_1011 316
252 3300048924 Ga0496121_0000011 Ga0496121_0000011_655047_656006 316
253 3300049703 Ga0501219_000779 Ga0501219_000779_2548_3507 316
254 3300050005 Ga0501284_00181 Ga0501284_00181_1048_2007 316
255 3300053153 Ga0500616_0005533 Ga0500616_0005533_3369_4322 316
256 2162886007 SwRhRL2b_contig_2869587 SwRhRL2b_0274.00002440 317
257 3300001979 JGI24740J21852_10002179 JGI24740J21852_100021795 317
258 3300002738 JGI25154J39366_1000042 JGI25154J39366_1000042121 317
259 3300003323 rootH1_10163754 rootH1_101637542 317
260 3300005289 Ga0065704_10070994 Ga0065704_100709944 317
261 3300005289 Ga0065704_10085203 Ga0065704_100852032 317
262 3300005337 Ga0070682_100000122 Ga0070682_10000012251 317
263 3300005455 Ga0070663_100169550 Ga0070663_1001695501 317
264 3300009036 Ga0105244_10000010 Ga0105244_1000001038 317
265 3300009148 Ga0105243_10000201 Ga0105243_1000020143 317
266 3300013100 Ga0157373_10000019 Ga0157373_10000019131 317
267 3300013102 Ga0157371_10066022 Ga0157371_100660223 317
268 3300013104 Ga0157370_10004214 Ga0157370_100042143 317
269 3300013104 Ga0157370_10141758 Ga0157370_101417582 317
270 3300014497 Ga0182008_10000015 Ga0182008_1000001519 317
271 3300025246 Ga0209646_1000017 Ga0209646_100001715 317
272 3300025250 Ga0209026_1000721 Ga0209026_10007218 317
273 3300025291 Ga0209675_1000094 Ga0209675_100009449 317
274 3300025728 Ga0207655_1000347 Ga0207655_100034728 317
275 3300025935 Ga0207709_10000312 Ga0207709_1000031225 317
276 3300046500 Ga0495596_0000877 Ga0495596_0000877_1650_2603 317
277 3300046519 Ga0495632_0005404 Ga0495632_0005404_1904_2857 317
278 3300046522 Ga0495643_0056305 Ga0495643_0056305_176_1129 317
279 3300046538 Ga0495609_0000025 Ga0495609_0000025_188519_189472 317
280 3300046558 Ga0495633_0008534 Ga0495633_0008534_2889_3842 317
281 3300046660 Ga0495625_0001869 Ga0495625_0001869_21118_22071 317
282 3300047472 Ga0495686_0000151 Ga0495686_0000151_8816_9769 317
283 3300048905 Ga0496102_0007675 Ga0496102_0007675_5851_6804 317
284 3300048916 Ga0496113_0090824 Ga0496113_0090824_241_1194 317
285 3300048919 Ga0496116_0000006 Ga0496116_0000006_634155_635108 317
286 3300048920 Ga0496117_0000023 Ga0496117_0000023_185915_186868 317
287 3300048920 Ga0496117_0093364 Ga0496117_0093364_496_1449 317
288 3300048921 Ga0496118_0000388 Ga0496118_0000388_71475_72428 317
289 3300048922 Ga0496119_0000010 Ga0496119_0000010_251728_252681 317
290 3300048923 Ga0496120_0116137 Ga0496120_0116137_90_1043 317
291 3300048924 Ga0496121_0018752 Ga0496121_0018752_2530_3483 317
292 3300048925 Ga0496122_0000066 Ga0496122_0000066_105055_106008 317
293 3300048925 Ga0496122_0000091 Ga0496122_0000091_70980_71933 317
294 3300048925 Ga0496122_0000458 Ga0496122_0000458_31907_32860 317
295 3300048925 Ga0496122_0003230 Ga0496122_0003230_17227_18180 317
296 3300048925 Ga0496122_0010627 Ga0496122_0010627_1713_2666 317
297 3300048926 Ga0496123_0000294 Ga0496123_0000294_95434_96387 317
298 3300048926 Ga0496123_0006185 Ga0496123_0006185_658_1611 317
299 3300048926 Ga0496123_0014857 Ga0496123_0014857_856_1809 317
300 3300048927 Ga0496124_0000418 Ga0496124_0000418_35500_36453 317
301 3300048928 Ga0496125_0000181 Ga0496125_0000181_133457_134410 317
302 3300048928 Ga0496125_0007980 Ga0496125_0007980_9846_10799 317
303 3300048929 Ga0496126_0001022 Ga0496126_0001022_20776_21729 317
304 3300048929 Ga0496126_0117196 Ga0496126_0117196_897_1850 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

35

158

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.9518 1 313
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.9458 1 313
4huz-assembly1.cif.gz_A-2 2,6-dichloro-p-hydroquinone 1,2-dioxygenase 0.9338 1 304
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.9259 4 310
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.8949 4 310
ID Description Score Start End Superfamily
3oajB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9752 4 313 3.10.180.10
1zswA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9744 4 310 3.10.180.10
3oajB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9463 4 313 3.10.180.10
af_Q2G137_30_308_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9333 31 308 3.10.180.10
4huzA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9323 67 211 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W0FUU2-F1-model_v4 Ring-cleaving dioxygenase 0.9952 1 316 GO:0051213
AF-A0A1G9THG6-F1-model_v4 Glyoxalase family protein 0.9944 1 317
AF-U5C5S7-F1-model_v4 Diguanylate cyclase 0.994 2 317
AF-A0A562SHY6-F1-model_v4 Glyoxalase family protein 0.9938 1 315
AF-A0A1A9I565-F1-model_v4 Diguanylate cyclase 0.9935 1 317

Feature Viewer

pLDDT pTM Quality
95.04 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map