F397765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 213 | 284 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300047318|Ga0495636_0019647|Ga0495636_0019647_70_1107 |
| Length | 345 |
| Sequence | MSALDGIVVVDPSYLKRNLPGIVITTKTTMFMITGIHHVTAMASDSQKNLDFYTGILGLRLIKKTVNFDAPDIYHFYYGDSTGTPGSILTFFPFEGLTRGRHGKGMLNTTTFSVPTSSLDFWLTRLKRFGINHKQPQDRFEGEAVVYFEDEDGLGLELVFSEKDKREGFTTGNIPPEHSIRGFYNVEIWEEGYERTAALLTEQLDHMLIAEKSNRFRFAVRDSPGCYVDILCVPDSMKGLPGSGTVHHIAFATPSHETQEQIRIKIAQRMLNPTPVLDRNYFTSIYFREPGGVLFEVATEGPGFAVDEDPSHLGEALKLPQQYEKNRKDIEKVLRPVTVDLGKYK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 4 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 5 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 6 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 7 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 8 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 9 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 10 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 11 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 12 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 13 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 14 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 15 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 16 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 17 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 18 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 19 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 20 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 21 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 22 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 23 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 24 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 27 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 30 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 31 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 153 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 154 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 156 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 161 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 162 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 163 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 164 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 165 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 166 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 167 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 168 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 169 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 183 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 184 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 185 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 186 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 187 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 188 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 189 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 190 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 203 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 207 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 211 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 212 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 213 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.42 |
| Metatranscriptomes | 0 |
| Isolates | 6.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.58 |
| Nodule | 0.33 |
| Rhizoplane | 0.99 |
| Rhizosphere | 79.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2869587 | 2162886007 | Bacteria | 1820 |
| 2 | MRS1b_contig_6498775 | 2162886011 | Bacteria | 1571 |
| 3 | JGI24740J21852_10002179 | 3300001979 | Bacteria | 8954 |
| 4 | JGI24739J22299_10000159 | 3300001989 | Bacteria | 21947 |
| 5 | JGI25154J39366_1000042 | 3300002738 | Bacteria | 143170 |
| 6 | JGI25406J46586_10000523 | 3300003203 | Bacteria | 17970 |
| 7 | JGI25153J46596_10030803 | 3300003215 | Unclassified | 1818 |
| 8 | rootH2_10150111 | 3300003320 | Bacteria | 2361 |
| 9 | rootH2_10250916 | 3300003320 | Unclassified | 1535 |
| 10 | rootL2_10012779 | 3300003322 | Bacteria | 7271 |
| 11 | rootL2_10173821 | 3300003322 | Bacteria | 3399 |
| 12 | rootH1_10127978 | 3300003323 | Bacteria | 3012 |
| 13 | rootH1_10155989 | 3300003323 | Bacteria | 1290 |
| 14 | rootH1_10163754 | 3300003323 | Bacteria | 5173 |
| 15 | JGI25160J50197_1010088 | 3300003354 | Unclassified | 3445 |
| 16 | Ga0055526_1006543 | 3300003771 | Bacteria | 6290 |
| 17 | Ga0055526_1007411 | 3300003771 | Bacteria | 5705 |
| 18 | Ga0055528_1000386 | 3300003790 | Bacteria | 35904 |
| 19 | Ga0055530_10000288 | 3300003791 | Bacteria | 45971 |
| 20 | Ga0055531_10014535 | 3300003794 | Bacteria | 3537 |
| 21 | Ga0065165_1000128 | 3300005262 | Bacteria | 129513 |
| 22 | Ga0065714_10078603 | 3300005288 | Bacteria | 2575 |
| 23 | Ga0065704_10070994 | 3300005289 | Bacteria | 13893 |
| 24 | Ga0065704_10085203 | 3300005289 | Bacteria | 3248 |
| 25 | Ga0065712_10091205 | 3300005290 | Bacteria | 2386 |
| 26 | Ga0070658_10059847 | 3300005327 | Bacteria | 3101 |
| 27 | Ga0070676_10032586 | 3300005328 | Bacteria | 2986 |
| 28 | Ga0070676_10065006 | 3300005328 | Bacteria | 2177 |
| 29 | Ga0070683_100069397 | 3300005329 | Bacteria | 3286 |
| 30 | Ga0070690_100098813 | 3300005330 | Bacteria | 1932 |
| 31 | Ga0070670_100239770 | 3300005331 | Bacteria | 1579 |
| 32 | Ga0068869_100002433 | 3300005334 | Bacteria | 11226 |
| 33 | Ga0068869_100017575 | 3300005334 | Bacteria | 4851 |
| 34 | Ga0068869_100074459 | 3300005334 | Bacteria | 2520 |
| 35 | Ga0070666_10000047 | 3300005335 | Bacteria | 106512 |
| 36 | Ga0070666_10053360 | 3300005335 | Unclassified | 2726 |
| 37 | Ga0070666_10071785 | 3300005335 | Bacteria | 2356 |
| 38 | Ga0070682_100000122 | 3300005337 | Bacteria | 69084 |
| 39 | Ga0068868_100011227 | 3300005338 | Bacteria | 6522 |
| 40 | Ga0068868_100115630 | 3300005338 | Bacteria | 2184 |
| 41 | Ga0070660_100004013 | 3300005339 | Bacteria | 10161 |
| 42 | Ga0070689_100059645 | 3300005340 | Bacteria | 2966 |
| 43 | Ga0070661_100098851 | 3300005344 | Bacteria | 2167 |
| 44 | Ga0070661_100129487 | 3300005344 | Bacteria | 1895 |
| 45 | Ga0070669_100000065 | 3300005353 | Bacteria | 105999 |
| 46 | Ga0070675_100009535 | 3300005354 | Bacteria | 7552 |
| 47 | Ga0070675_100016656 | 3300005354 | Bacteria | 5836 |
| 48 | Ga0070675_100107646 | 3300005354 | Bacteria | 2354 |
| 49 | Ga0070675_100246814 | 3300005354 | Bacteria | 1561 |
| 50 | Ga0070671_100069619 | 3300005355 | Bacteria | 2935 |
| 51 | Ga0070673_100033176 | 3300005364 | Bacteria | 3895 |
| 52 | Ga0070688_100014747 | 3300005365 | Bacteria | 4433 |
| 53 | Ga0070688_100165699 | 3300005365 | Bacteria | 1521 |
| 54 | Ga0070659_100057998 | 3300005366 | Bacteria | 3054 |
| 55 | Ga0070667_100136328 | 3300005367 | Bacteria | 2146 |
| 56 | Ga0070667_100173495 | 3300005367 | Bacteria | 1904 |
| 57 | Ga0070663_100169550 | 3300005455 | Bacteria | 1686 |
| 58 | Ga0070663_100395038 | 3300005455 | Bacteria | 1129 |
| 59 | Ga0070662_100023263 | 3300005457 | Bacteria | 4255 |
| 60 | Ga0070685_10243156 | 3300005466 | Bacteria | 1189 |
| 61 | Ga0070679_100218478 | 3300005530 | Bacteria | 1867 |
| 62 | Ga0070684_100017886 | 3300005535 | Bacteria | 5826 |
| 63 | Ga0070672_100054056 | 3300005543 | Bacteria | 3142 |
| 64 | Ga0070672_100112839 | 3300005543 | Bacteria | 2218 |
| 65 | Ga0070672_100208244 | 3300005543 | Unclassified | 1637 |
| 66 | Ga0068855_100043046 | 3300005563 | Bacteria | 5350 |
| 67 | Ga0070664_100031724 | 3300005564 | Bacteria | 4417 |
| 68 | Ga0068856_100004590 | 3300005614 | Bacteria | 13736 |
| 69 | Ga0068852_100015024 | 3300005616 | Bacteria | 5986 |
| 70 | Ga0068852_100062421 | 3300005616 | Bacteria | 3241 |
| 71 | Ga0068852_100113288 | 3300005616 | Bacteria | 2470 |
| 72 | Ga0068852_100423387 | 3300005616 | Bacteria | 1314 |
| 73 | Ga0068859_100000030 | 3300005617 | Bacteria | 175435 |
| 74 | Ga0068859_100570019 | 3300005617 | Bacteria | 1226 |
| 75 | Ga0068864_100009350 | 3300005618 | Bacteria | 8085 |
| 76 | Ga0068861_100149992 | 3300005719 | Bacteria | 1912 |
| 77 | Ga0068851_10011899 | 3300005834 | Bacteria | 4092 |
| 78 | Ga0068851_10040546 | 3300005834 | Bacteria | 2340 |
| 79 | Ga0068851_10129045 | 3300005834 | Bacteria | 1366 |
| 80 | Ga0068863_100001320 | 3300005841 | Bacteria | 24709 |
| 81 | Ga0068863_100145703 | 3300005841 | Bacteria | 2265 |
| 82 | Ga0068858_100016413 | 3300005842 | Bacteria | 6953 |
| 83 | Ga0068860_100002795 | 3300005843 | Bacteria | 18152 |
| 84 | Ga0068860_100411325 | 3300005843 | Bacteria | 1339 |
| 85 | Ga0081539_10000382 | 3300005985 | Bacteria | 96235 |
| 86 | Ga0075364_10018204 | 3300006051 | Bacteria | 4396 |
| 87 | Ga0097621_100011133 | 3300006237 | Bacteria | 6618 |
| 88 | Ga0097621_100421562 | 3300006237 | Bacteria | 1198 |
| 89 | Ga0068871_100112256 | 3300006358 | Bacteria | 2293 |
| 90 | Ga0075431_100029944 | 3300006847 | Bacteria | 5605 |
| 91 | Ga0075434_100011641 | 3300006871 | Bacteria | 8308 |
| 92 | Ga0068865_100161590 | 3300006881 | Bacteria | 1709 |
| 93 | Ga0097620_100000030 | 3300006931 | Bacteria | 175435 |
| 94 | Ga0097620_100570016 | 3300006931 | Bacteria | 1226 |
| 95 | Ga0105244_10000010 | 3300009036 | Bacteria | 265799 |
| 96 | Ga0105240_10000846 | 3300009093 | Bacteria | 55115 |
| 97 | Ga0105240_10028059 | 3300009093 | Bacteria | 7360 |
| 98 | Ga0105240_10165527 | 3300009093 | Bacteria | 2623 |
| 99 | Ga0105247_10007077 | 3300009101 | Bacteria | 6891 |
| 100 | Ga0105243_10000201 | 3300009148 | Bacteria | 69844 |
| 101 | Ga0105243_10507648 | 3300009148 | Bacteria | 1144 |
| 102 | Ga0105241_10000604 | 3300009174 | Bacteria | 27074 |
| 103 | Ga0105241_10006081 | 3300009174 | Bacteria | 8898 |
| 104 | Ga0105241_10421375 | 3300009174 | Bacteria | 1175 |
| 105 | Ga0105237_10002280 | 3300009545 | Bacteria | 23870 |
| 106 | Ga0105237_10002650 | 3300009545 | Bacteria | 22003 |
| 107 | Ga0105238_10238026 | 3300009551 | Bacteria | 1798 |
| 108 | Ga0105249_10015410 | 3300009553 | Bacteria | 6765 |
| 109 | Ga0105249_10043452 | 3300009553 | Bacteria | 4086 |
| 110 | Ga0105249_10049773 | 3300009553 | Bacteria | 3821 |
| 111 | Ga0105239_10009914 | 3300010375 | Bacteria | 10697 |
| 112 | Ga0105239_10312500 | 3300010375 | Bacteria | 1771 |
| 113 | Ga0105239_10317499 | 3300010375 | Bacteria | 1756 |
| 114 | Ga0105246_10010264 | 3300011119 | Bacteria | 5787 |
| 115 | Ga0105246_10179784 | 3300011119 | Bacteria | 1628 |
| 116 | Ga0157373_10000019 | 3300013100 | Bacteria | 166579 |
| 117 | Ga0157373_10001845 | 3300013100 | Bacteria | 16096 |
| 118 | Ga0157371_10066022 | 3300013102 | Bacteria | 2563 |
| 119 | Ga0157371_10082249 | 3300013102 | Unclassified | 2280 |
| 120 | Ga0157371_10130613 | 3300013102 | Bacteria | 1787 |
| 121 | Ga0157370_10004214 | 3300013104 | Bacteria | 16631 |
| 122 | Ga0157370_10141758 | 3300013104 | Bacteria | 2239 |
| 123 | Ga0157369_10028156 | 3300013105 | Bacteria | 6220 |
| 124 | Ga0157374_10017489 | 3300013296 | Bacteria | 6314 |
| 125 | Ga0157374_10025442 | 3300013296 | Bacteria | 5315 |
| 126 | Ga0157374_10184284 | 3300013296 | Bacteria | 2040 |
| 127 | Ga0157374_10234712 | 3300013296 | Bacteria | 1803 |
| 128 | Ga0157378_10168488 | 3300013297 | Bacteria | 2052 |
| 129 | Ga0163162_10001435 | 3300013306 | Bacteria | 22200 |
| 130 | Ga0163162_10129880 | 3300013306 | Unclassified | 2628 |
| 131 | Ga0163162_10183827 | 3300013306 | Bacteria | 2217 |
| 132 | Ga0163162_10305272 | 3300013306 | Bacteria | 1724 |
| 133 | Ga0157372_10083383 | 3300013307 | Bacteria | 3621 |
| 134 | Ga0157372_10089642 | 3300013307 | Bacteria | 3494 |
| 135 | Ga0157372_10179995 | 3300013307 | Bacteria | 2447 |
| 136 | Ga0157372_10187486 | 3300013307 | Bacteria | 2395 |
| 137 | Ga0157375_10008186 | 3300013308 | Bacteria | 9154 |
| 138 | Ga0157375_10198196 | 3300013308 | Bacteria | 2163 |
| 139 | Ga0163163_10006767 | 3300014325 | Bacteria | 10050 |
| 140 | Ga0163163_10157836 | 3300014325 | Bacteria | 2313 |
| 141 | Ga0157380_10075578 | 3300014326 | Bacteria | 2738 |
| 142 | Ga0182008_10000015 | 3300014497 | Bacteria | 243121 |
| 143 | Ga0157377_10096054 | 3300014745 | Bacteria | 1758 |
| 144 | Ga0157379_10137072 | 3300014968 | Bacteria | 2205 |
| 145 | Ga0157376_10004130 | 3300014969 | Bacteria | 10063 |
| 146 | Ga0157376_10019671 | 3300014969 | Bacteria | 5209 |
| 147 | Ga0157376_10087213 | 3300014969 | Bacteria | 2693 |
| 148 | Ga0157376_10121212 | 3300014969 | Unclassified | 2318 |
| 149 | Ga0163161_10025366 | 3300017792 | Bacteria | 4195 |
| 150 | Ga0163161_10081249 | 3300017792 | Unclassified | 2386 |
| 151 | Ga0213876_10062842 | 3300021384 | Bacteria | 1960 |
| 152 | Ga0209646_1000017 | 3300025246 | Bacteria | 488265 |
| 153 | Ga0209026_1000721 | 3300025250 | Bacteria | 19458 |
| 154 | Ga0209673_1000085 | 3300025273 | Bacteria | 215647 |
| 155 | Ga0209675_1000094 | 3300025291 | Bacteria | 138083 |
| 156 | Ga0209564_1002760 | 3300025295 | Bacteria | 13199 |
| 157 | Ga0209564_1005109 | 3300025295 | Bacteria | 7635 |
| 158 | Ga0209758_1009023 | 3300025297 | Bacteria | 6302 |
| 159 | Ga0209050_1000524 | 3300025298 | Bacteria | 63793 |
| 160 | Ga0207426_1001174 | 3300025302 | Bacteria | 23427 |
| 161 | Ga0209257_1001638 | 3300025304 | Bacteria | 25639 |
| 162 | Ga0207697_10056286 | 3300025315 | Bacteria | 1631 |
| 163 | Ga0207656_10006093 | 3300025321 | Bacteria | 4316 |
| 164 | Ga0207656_10085257 | 3300025321 | Unclassified | 1426 |
| 165 | Ga0207655_1000347 | 3300025728 | Bacteria | 67127 |
| 166 | Ga0207710_10008371 | 3300025900 | Bacteria | 4362 |
| 167 | Ga0207645_10042168 | 3300025907 | Bacteria | 2920 |
| 168 | Ga0207654_10013169 | 3300025911 | Bacteria | 4250 |
| 169 | Ga0207695_10000687 | 3300025913 | Bacteria | 66305 |
| 170 | Ga0207695_10034868 | 3300025913 | Bacteria | 5465 |
| 171 | Ga0207671_10001884 | 3300025914 | Bacteria | 23313 |
| 172 | Ga0207671_10002245 | 3300025914 | Bacteria | 20915 |
| 173 | Ga0207671_10049143 | 3300025914 | Bacteria | 3122 |
| 174 | Ga0207657_10004306 | 3300025919 | Bacteria | 15087 |
| 175 | Ga0207649_10060503 | 3300025920 | Bacteria | 2380 |
| 176 | Ga0207681_10000021 | 3300025923 | Bacteria | 236982 |
| 177 | Ga0207681_10427032 | 3300025923 | Bacteria | 1075 |
| 178 | Ga0207694_10007575 | 3300025924 | Bacteria | 8229 |
| 179 | Ga0207694_10244154 | 3300025924 | Bacteria | 1468 |
| 180 | Ga0207659_10029295 | 3300025926 | Bacteria | 3751 |
| 181 | Ga0207659_10067921 | 3300025926 | Bacteria | 2591 |
| 182 | Ga0207706_10012755 | 3300025933 | Bacteria | 7649 |
| 183 | Ga0207706_10067423 | 3300025933 | Bacteria | 3148 |
| 184 | Ga0207686_10175800 | 3300025934 | Bacteria | 1514 |
| 185 | Ga0207709_10000312 | 3300025935 | Bacteria | 52932 |
| 186 | Ga0207704_10203441 | 3300025938 | Unclassified | 1451 |
| 187 | Ga0207691_10040616 | 3300025940 | Unclassified | 4297 |
| 188 | Ga0207691_10348771 | 3300025940 | Unclassified | 1267 |
| 189 | Ga0207689_10027541 | 3300025942 | Bacteria | 4756 |
| 190 | Ga0207689_10046433 | 3300025942 | Bacteria | 3590 |
| 191 | Ga0207661_10022255 | 3300025944 | Bacteria | 4769 |
| 192 | Ga0207661_10343543 | 3300025944 | Bacteria | 1345 |
| 193 | Ga0207679_10023633 | 3300025945 | Bacteria | 4205 |
| 194 | Ga0207712_10008308 | 3300025961 | Bacteria | 6563 |
| 195 | Ga0207668_10010633 | 3300025972 | Bacteria | 5567 |
| 196 | Ga0207658_10148894 | 3300025986 | Bacteria | 1904 |
| 197 | Ga0207658_10222069 | 3300025986 | Bacteria | 1590 |
| 198 | Ga0207703_10022982 | 3300026035 | Bacteria | 4895 |
| 199 | Ga0207703_10035122 | 3300026035 | Bacteria | 3983 |
| 200 | Ga0207678_10423206 | 3300026067 | Bacteria | 1155 |
| 201 | Ga0207702_10193230 | 3300026078 | Bacteria | 1882 |
| 202 | Ga0207641_10000061 | 3300026088 | Bacteria | 160161 |
| 203 | Ga0207676_10014035 | 3300026095 | Bacteria | 5753 |
| 204 | Ga0207674_10212757 | 3300026116 | Bacteria | 1882 |
| 205 | Ga0207675_100045820 | 3300026118 | Bacteria | 4084 |
| 206 | Ga0207698_10062533 | 3300026142 | Bacteria | 2908 |
| 207 | Ga0207698_10482278 | 3300026142 | Bacteria | 1203 |
| 208 | Ga0268264_10003332 | 3300028381 | Bacteria | 13881 |
| 209 | Ga0268264_10007686 | 3300028381 | Bacteria | 8983 |
| 210 | Ga0307509_10355288 | 3300031507 | Bacteria | 1187 |
| 211 | Ga0307414_10177198 | 3300032004 | Unclassified | 1711 |
| 212 | Ga0373935_0332473 | 3300035692 | Bacteria | 1080 |
| 213 | Ga0373947_0077434 | 3300035725 | Bacteria | 2051 |
| 214 | Ga0373937_0319161 | 3300036401 | Bacteria | 1470 |
| 215 | Ga0395900_0052032 | 3300037418 | Unclassified | 4217 |
| 216 | Ga0395905_0028906 | 3300037471 | Bacteria | 5225 |
| 217 | Ga0395905_0087590 | 3300037471 | Bacteria | 2919 |
| 218 | Ga0395905_0177823 | 3300037471 | Bacteria | 1997 |
| 219 | Ga0436365_0215388 | 3300039437 | Bacteria | 20742 |
| 220 | Ga0439439_0000869 | 3300041406 | Bacteria | 5563 |
| 221 | Ga0439431_0004569 | 3300041997 | Bacteria | 3042 |
| 222 | Ga0439445_0008296 | 3300042004 | Bacteria | 2429 |
| 223 | Ga0439449_0015386 | 3300042007 | Unclassified | 2874 |
| 224 | Ga0439457_002577 | 3300042014 | Bacteria | 5133 |
| 225 | Ga0451577_0000557 | 3300042876 | Bacteria | 60863 |
| 226 | Ga0466972_0045641 | 3300044658 | Unclassified | 2123 |
| 227 | Ga0453684_0000024 | 3300044712 | Bacteria | 819351 |
| 228 | Ga0466957_0001781 | 3300044842 | Bacteria | 11334 |
| 229 | Ga0495596_0000877 | 3300046500 | Bacteria | 18134 |
| 230 | Ga0495618_0258890 | 3300046514 | Bacteria | 1090 |
| 231 | Ga0495632_0005404 | 3300046519 | Bacteria | 8453 |
| 232 | Ga0495643_0056305 | 3300046522 | Bacteria | 2099 |
| 233 | Ga0495609_0000025 | 3300046538 | Bacteria | 256898 |
| 234 | Ga0495633_0008534 | 3300046558 | Bacteria | 5759 |
| 235 | Ga0495668_0005139 | 3300046616 | Bacteria | 8995 |
| 236 | Ga0495625_0001869 | 3300046660 | Bacteria | 23924 |
| 237 | Ga0495625_0162066 | 3300046660 | Bacteria | 1498 |
| 238 | Ga0495670_0098875 | 3300046691 | Bacteria | 1501 |
| 239 | Ga0495636_0019647 | 3300047318 | Bacteria | 2717 |
| 240 | Ga0495686_0000151 | 3300047472 | Bacteria | 135048 |
| 241 | Ga0496102_0007675 | 3300048905 | Bacteria | 9218 |
| 242 | Ga0496108_0441207 | 3300048911 | Bacteria | 1137 |
| 243 | Ga0496113_0090824 | 3300048916 | Bacteria | 2353 |
| 244 | Ga0496116_0000006 | 3300048919 | Bacteria | 811937 |
| 245 | Ga0496117_0000023 | 3300048920 | Bacteria | 438585 |
| 246 | Ga0496117_0093364 | 3300048920 | Bacteria | 1930 |
| 247 | Ga0496118_0000388 | 3300048921 | Bacteria | 74358 |
| 248 | Ga0496119_0000010 | 3300048922 | Bacteria | 438534 |
| 249 | Ga0496120_0116137 | 3300048923 | Bacteria | 1390 |
| 250 | Ga0496121_0000011 | 3300048924 | Bacteria | 792193 |
| 251 | Ga0496121_0018752 | 3300048924 | Bacteria | 6955 |
| 252 | Ga0496122_0000066 | 3300048925 | Bacteria | 231473 |
| 253 | Ga0496122_0000091 | 3300048925 | Bacteria | 204567 |
| 254 | Ga0496122_0000458 | 3300048925 | Bacteria | 84794 |
| 255 | Ga0496122_0003230 | 3300048925 | Bacteria | 21662 |
| 256 | Ga0496122_0010627 | 3300048925 | Bacteria | 9456 |
| 257 | Ga0496123_0000294 | 3300048926 | Bacteria | 97574 |
| 258 | Ga0496123_0006185 | 3300048926 | Bacteria | 11703 |
| 259 | Ga0496123_0014857 | 3300048926 | Bacteria | 6426 |
| 260 | Ga0496124_0000418 | 3300048927 | Bacteria | 76015 |
| 261 | Ga0496125_0000181 | 3300048928 | Bacteria | 138133 |
| 262 | Ga0496125_0007980 | 3300048928 | Bacteria | 11181 |
| 263 | Ga0496126_0001022 | 3300048929 | Bacteria | 47547 |
| 264 | Ga0496126_0117196 | 3300048929 | Bacteria | 2314 |
| 265 | Ga0501032_0013869 | 3300049569 | Bacteria | 5717 |
| 266 | Ga0501034_0059782 | 3300049571 | Bacteria | 3828 |
| 267 | Ga0501036_0186758 | 3300049572 | Bacteria | 1744 |
| 268 | Ga0501037_0006592 | 3300049573 | Bacteria | 8490 |
| 269 | Ga0501038_0038791 | 3300049574 | Bacteria | 4169 |
| 270 | Ga0501039_0106932 | 3300049575 | Bacteria | 2185 |
| 271 | Ga0501043_0008195 | 3300049579 | Bacteria | 8239 |
| 272 | Ga0501047_0027328 | 3300049581 | Bacteria | 5496 |
| 273 | Ga0501219_000779 | 3300049703 | Bacteria | 4257 |
| 274 | Ga0501080_0143006 | 3300049742 | Bacteria | 2212 |
| 275 | Ga0501035_0012853 | 3300049822 | Bacteria | 7731 |
| 276 | Ga0501044_0016580 | 3300049823 | Bacteria | 7907 |
| 277 | Ga0501284_00181 | 3300050005 | Bacteria | 4901 |
| 278 | nmdc:mga06r32_60578_c1 | 3300050510 | Bacteria | 3643 |
| 279 | nmdc:mga0n895_128183_c1 | 3300050512 | Bacteria | 2562 |
| 280 | nmdc:mga0n895_15609_c1 | 3300050512 | Bacteria | 6934 |
| 281 | nmdc:mga08x19_61933_c1 | 3300050514 | Bacteria | 2425 |
| 282 | Ga0500573_0023147 | 3300053140 | Bacteria | 3568 |
| 283 | Ga0500616_0005533 | 3300053153 | Bacteria | 8557 |
| 284 | Ga0500645_070462 | 3300053730 | Bacteria | 1004 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041406 | Ga0439439_0000869 | Ga0439439_0000869_495_1328 | 276 |
| 2 | 3300053730 | Ga0500645_070462 | Ga0500645_070462_50_910 | 285 |
| 3 | 3300053140 | Ga0500573_0023147 | Ga0500573_0023147_1170_2093 | 286 |
| 4 | 3300005353 | Ga0070669_100000065 | Ga0070669_10000006572 | 297 |
| 5 | 3300025923 | Ga0207681_10000021 | Ga0207681_1000002197 | 297 |
| 6 | 3300035692 | Ga0373935_0332473 | Ga0373935_0332473_75_1040 | 302 |
| 7 | 3300035725 | Ga0373947_0077434 | Ga0373947_0077434_475_1440 | 302 |
| 8 | 3300006051 | Ga0075364_10018204 | Ga0075364_100182043 | 313 |
| 9 | 3300009093 | Ga0105240_10165527 | Ga0105240_101655272 | 313 |
| 10 | 3300036401 | Ga0373937_0319161 | Ga0373937_0319161_150_1112 | 313 |
| 11 | iso_pu_bacteria | 2582581278 | 2585145178 | 313 |
| 12 | iso_pu_bacteria | 2585428045 | 2587677923 | 313 |
| 13 | iso_pu_bacteria | 2585428182 | 2588209812 | 313 |
| 14 | iso_pu_bacteria | 2585428183 | 2588215035 | 313 |
| 15 | iso_pu_bacteria | 2585428184 | 2588218230 | 313 |
| 16 | iso_pu_bacteria | 2585428185 | 2588222458 | 313 |
| 17 | iso_pu_bacteria | 2585428187 | 2588234003 | 313 |
| 18 | iso_pu_bacteria | 2588254255 | 2590604110 | 313 |
| 19 | iso_pu_bacteria | 2751185877 | 2753670954 | 313 |
| 20 | iso_pu_bacteria | 2765235839 | 2765573567 | 313 |
| 21 | iso_pu_bacteria | 2772190705 | 2772605935 | 313 |
| 22 | iso_pu_bacteria | 2816332188 | 2816873929 | 313 |
| 23 | iso_pu_bacteria | 2871720351 | 2871722875 | 313 |
| 24 | iso_pu_bacteria | 2889290771 | 2889295840 | 313 |
| 25 | iso_pu_bacteria | 2905999023 | 2905999726 | 313 |
| 26 | iso_pu_bacteria | 2945924605 | 2945928214 | 313 |
| 27 | iso_pu_bacteria | 2946019816 | 2946022151 | 313 |
| 28 | iso_pu_bacteria | 2993372514 | 2993372867 | 313 |
| 29 | 3300005354 | Ga0070675_100246814 | Ga0070675_1002468142 | 314 |
| 30 | 3300006871 | Ga0075434_100011641 | Ga0075434_1000116414 | 314 |
| 31 | 3300009093 | Ga0105240_10028059 | Ga0105240_100280593 | 314 |
| 32 | 3300009545 | Ga0105237_10002650 | Ga0105237_1000265015 | 314 |
| 33 | 3300010375 | Ga0105239_10009914 | Ga0105239_100099143 | 314 |
| 34 | 3300025913 | Ga0207695_10034868 | Ga0207695_100348686 | 314 |
| 35 | 3300025914 | Ga0207671_10049143 | Ga0207671_100491432 | 314 |
| 36 | 3300028381 | Ga0268264_10003332 | Ga0268264_1000333214 | 314 |
| 37 | 3300041997 | Ga0439431_0004569 | Ga0439431_0004569_186_1133 | 314 |
| 38 | 3300042004 | Ga0439445_0008296 | Ga0439445_0008296_677_1624 | 314 |
| 39 | 3300050512 | nmdc:mga0n895_128183_c1 | nmdc:mga0n895_128183_c1_1470_2432 | 314 |
| 40 | 3300050512 | nmdc:mga0n895_15609_c1 | nmdc:mga0n895_15609_c1_3780_4742 | 314 |
| 41 | 3300050514 | nmdc:mga08x19_61933_c1 | nmdc:mga08x19_61933_c1_253_1215 | 314 |
| 42 | iso_pu_bacteria | 2929921140 | 2929925338 | 314 |
| 43 | iso_pu_bacteria | 8003151029 | 8003154173 | 314 |
| 44 | 3300005288 | Ga0065714_10078603 | Ga0065714_100786032 | 315 |
| 45 | 3300005354 | Ga0070675_100009535 | Ga0070675_1000095354 | 315 |
| 46 | 3300005616 | Ga0068852_100113288 | Ga0068852_1001132881 | 315 |
| 47 | 3300006847 | Ga0075431_100029944 | Ga0075431_1000299447 | 315 |
| 48 | 3300006881 | Ga0068865_100161590 | Ga0068865_1001615902 | 315 |
| 49 | 3300013307 | Ga0157372_10187486 | Ga0157372_101874862 | 315 |
| 50 | 3300014326 | Ga0157380_10075578 | Ga0157380_100755783 | 315 |
| 51 | 3300014969 | Ga0157376_10004130 | Ga0157376_100041304 | 315 |
| 52 | 3300014969 | Ga0157376_10087213 | Ga0157376_100872133 | 315 |
| 53 | 3300014969 | Ga0157376_10121212 | Ga0157376_101212122 | 315 |
| 54 | 3300025923 | Ga0207681_10427032 | Ga0207681_104270321 | 315 |
| 55 | 3300025926 | Ga0207659_10067921 | Ga0207659_100679212 | 315 |
| 56 | 3300025938 | Ga0207704_10203441 | Ga0207704_102034412 | 315 |
| 57 | 3300026142 | Ga0207698_10062533 | Ga0207698_100625332 | 315 |
| 58 | 3300031507 | Ga0307509_10355288 | Ga0307509_103552881 | 315 |
| 59 | 3300042876 | Ga0451577_0000557 | Ga0451577_0000557_22834_23793 | 315 |
| 60 | 3300044712 | Ga0453684_0000024 | Ga0453684_0000024_248007_248966 | 315 |
| 61 | 3300046691 | Ga0495670_0098875 | Ga0495670_0098875_339_1298 | 315 |
| 62 | 3300049569 | Ga0501032_0013869 | Ga0501032_0013869_2046_2996 | 315 |
| 63 | 3300049571 | Ga0501034_0059782 | Ga0501034_0059782_890_1840 | 315 |
| 64 | 3300049572 | Ga0501036_0186758 | Ga0501036_0186758_534_1484 | 315 |
| 65 | 3300049573 | Ga0501037_0006592 | Ga0501037_0006592_5545_6495 | 315 |
| 66 | 3300049574 | Ga0501038_0038791 | Ga0501038_0038791_1729_2679 | 315 |
| 67 | 3300049575 | Ga0501039_0106932 | Ga0501039_0106932_1150_2100 | 315 |
| 68 | 3300049579 | Ga0501043_0008195 | Ga0501043_0008195_1696_2646 | 315 |
| 69 | 3300049581 | Ga0501047_0027328 | Ga0501047_0027328_3070_4020 | 315 |
| 70 | 3300049742 | Ga0501080_0143006 | Ga0501080_0143006_1053_2000 | 315 |
| 71 | 3300049822 | Ga0501035_0012853 | Ga0501035_0012853_1973_2923 | 315 |
| 72 | 3300049823 | Ga0501044_0016580 | Ga0501044_0016580_250_1200 | 315 |
| 73 | 3300050510 | nmdc:mga06r32_60578_c1 | nmdc:mga06r32_60578_c1_2076_3026 | 315 |
| 74 | 2162886011 | MRS1b_contig_6498775 | MRS1b_0657.00003360 | 316 |
| 75 | 3300001989 | JGI24739J22299_10000159 | JGI24739J22299_100001595 | 316 |
| 76 | 3300003203 | JGI25406J46586_10000523 | JGI25406J46586_100005236 | 316 |
| 77 | 3300003215 | JGI25153J46596_10030803 | JGI25153J46596_100308032 | 316 |
| 78 | 3300003320 | rootH2_10150111 | rootH2_101501112 | 316 |
| 79 | 3300003320 | rootH2_10250916 | rootH2_102509162 | 316 |
| 80 | 3300003322 | rootL2_10012779 | rootL2_100127795 | 316 |
| 81 | 3300003322 | rootL2_10173821 | rootL2_101738212 | 316 |
| 82 | 3300003323 | rootH1_10127978 | rootH1_101279783 | 316 |
| 83 | 3300003323 | rootH1_10155989 | rootH1_101559891 | 316 |
| 84 | 3300003354 | JGI25160J50197_1010088 | JGI25160J50197_10100886 | 316 |
| 85 | 3300003771 | Ga0055526_1006543 | Ga0055526_10065437 | 316 |
| 86 | 3300003771 | Ga0055526_1007411 | Ga0055526_10074111 | 316 |
| 87 | 3300003790 | Ga0055528_1000386 | Ga0055528_100038613 | 316 |
| 88 | 3300003791 | Ga0055530_10000288 | Ga0055530_1000028825 | 316 |
| 89 | 3300003794 | Ga0055531_10014535 | Ga0055531_100145353 | 316 |
| 90 | 3300005262 | Ga0065165_1000128 | Ga0065165_100012824 | 316 |
| 91 | 3300005290 | Ga0065712_10091205 | Ga0065712_100912053 | 316 |
| 92 | 3300005327 | Ga0070658_10059847 | Ga0070658_100598473 | 316 |
| 93 | 3300005328 | Ga0070676_10032586 | Ga0070676_100325862 | 316 |
| 94 | 3300005328 | Ga0070676_10065006 | Ga0070676_100650062 | 316 |
| 95 | 3300005329 | Ga0070683_100069397 | Ga0070683_1000693973 | 316 |
| 96 | 3300005330 | Ga0070690_100098813 | Ga0070690_1000988132 | 316 |
| 97 | 3300005331 | Ga0070670_100239770 | Ga0070670_1002397702 | 316 |
| 98 | 3300005334 | Ga0068869_100002433 | Ga0068869_10000243312 | 316 |
| 99 | 3300005334 | Ga0068869_100017575 | Ga0068869_1000175754 | 316 |
| 100 | 3300005334 | Ga0068869_100074459 | Ga0068869_1000744592 | 316 |
| 101 | 3300005335 | Ga0070666_10000047 | Ga0070666_1000004769 | 316 |
| 102 | 3300005335 | Ga0070666_10053360 | Ga0070666_100533603 | 316 |
| 103 | 3300005335 | Ga0070666_10071785 | Ga0070666_100717851 | 316 |
| 104 | 3300005338 | Ga0068868_100011227 | Ga0068868_1000112276 | 316 |
| 105 | 3300005338 | Ga0068868_100115630 | Ga0068868_1001156301 | 316 |
| 106 | 3300005339 | Ga0070660_100004013 | Ga0070660_1000040136 | 316 |
| 107 | 3300005340 | Ga0070689_100059645 | Ga0070689_1000596453 | 316 |
| 108 | 3300005344 | Ga0070661_100098851 | Ga0070661_1000988512 | 316 |
| 109 | 3300005344 | Ga0070661_100129487 | Ga0070661_1001294872 | 316 |
| 110 | 3300005354 | Ga0070675_100016656 | Ga0070675_1000166566 | 316 |
| 111 | 3300005354 | Ga0070675_100107646 | Ga0070675_1001076462 | 316 |
| 112 | 3300005355 | Ga0070671_100069619 | Ga0070671_1000696194 | 316 |
| 113 | 3300005364 | Ga0070673_100033176 | Ga0070673_1000331764 | 316 |
| 114 | 3300005365 | Ga0070688_100014747 | Ga0070688_1000147472 | 316 |
| 115 | 3300005365 | Ga0070688_100165699 | Ga0070688_1001656992 | 316 |
| 116 | 3300005366 | Ga0070659_100057998 | Ga0070659_1000579983 | 316 |
| 117 | 3300005367 | Ga0070667_100136328 | Ga0070667_1001363282 | 316 |
| 118 | 3300005367 | Ga0070667_100173495 | Ga0070667_1001734951 | 316 |
| 119 | 3300005455 | Ga0070663_100395038 | Ga0070663_1003950381 | 316 |
| 120 | 3300005457 | Ga0070662_100023263 | Ga0070662_1000232635 | 316 |
| 121 | 3300005466 | Ga0070685_10243156 | Ga0070685_102431561 | 316 |
| 122 | 3300005530 | Ga0070679_100218478 | Ga0070679_1002184783 | 316 |
| 123 | 3300005535 | Ga0070684_100017886 | Ga0070684_1000178862 | 316 |
| 124 | 3300005543 | Ga0070672_100054056 | Ga0070672_1000540562 | 316 |
| 125 | 3300005543 | Ga0070672_100112839 | Ga0070672_1001128392 | 316 |
| 126 | 3300005543 | Ga0070672_100208244 | Ga0070672_1002082442 | 316 |
| 127 | 3300005563 | Ga0068855_100043046 | Ga0068855_1000430462 | 316 |
| 128 | 3300005564 | Ga0070664_100031724 | Ga0070664_1000317242 | 316 |
| 129 | 3300005614 | Ga0068856_100004590 | Ga0068856_1000045909 | 316 |
| 130 | 3300005616 | Ga0068852_100015024 | Ga0068852_1000150242 | 316 |
| 131 | 3300005616 | Ga0068852_100062421 | Ga0068852_1000624212 | 316 |
| 132 | 3300005616 | Ga0068852_100423387 | Ga0068852_1004233872 | 316 |
| 133 | 3300005617 | Ga0068859_100000030 | Ga0068859_10000003075 | 316 |
| 134 | 3300005617 | Ga0068859_100570019 | Ga0068859_1005700192 | 316 |
| 135 | 3300005618 | Ga0068864_100009350 | Ga0068864_1000093504 | 316 |
| 136 | 3300005719 | Ga0068861_100149992 | Ga0068861_1001499922 | 316 |
| 137 | 3300005834 | Ga0068851_10011899 | Ga0068851_100118993 | 316 |
| 138 | 3300005834 | Ga0068851_10040546 | Ga0068851_100405462 | 316 |
| 139 | 3300005834 | Ga0068851_10129045 | Ga0068851_101290451 | 316 |
| 140 | 3300005841 | Ga0068863_100001320 | Ga0068863_10000132010 | 316 |
| 141 | 3300005841 | Ga0068863_100145703 | Ga0068863_1001457033 | 316 |
| 142 | 3300005842 | Ga0068858_100016413 | Ga0068858_1000164134 | 316 |
| 143 | 3300005843 | Ga0068860_100002795 | Ga0068860_1000027957 | 316 |
| 144 | 3300005843 | Ga0068860_100411325 | Ga0068860_1004113252 | 316 |
| 145 | 3300005985 | Ga0081539_10000382 | Ga0081539_1000038227 | 316 |
| 146 | 3300006237 | Ga0097621_100011133 | Ga0097621_1000111337 | 316 |
| 147 | 3300006237 | Ga0097621_100421562 | Ga0097621_1004215622 | 316 |
| 148 | 3300006358 | Ga0068871_100112256 | Ga0068871_1001122563 | 316 |
| 149 | 3300006931 | Ga0097620_100000030 | Ga0097620_10000003070 | 316 |
| 150 | 3300006931 | Ga0097620_100570016 | Ga0097620_1005700162 | 316 |
| 151 | 3300009093 | Ga0105240_10000846 | Ga0105240_1000084626 | 316 |
| 152 | 3300009101 | Ga0105247_10007077 | Ga0105247_100070774 | 316 |
| 153 | 3300009148 | Ga0105243_10507648 | Ga0105243_105076481 | 316 |
| 154 | 3300009174 | Ga0105241_10000604 | Ga0105241_1000060413 | 316 |
| 155 | 3300009174 | Ga0105241_10006081 | Ga0105241_100060817 | 316 |
| 156 | 3300009174 | Ga0105241_10421375 | Ga0105241_104213752 | 316 |
| 157 | 3300009545 | Ga0105237_10002280 | Ga0105237_1000228010 | 316 |
| 158 | 3300009551 | Ga0105238_10238026 | Ga0105238_102380262 | 316 |
| 159 | 3300009553 | Ga0105249_10015410 | Ga0105249_100154104 | 316 |
| 160 | 3300009553 | Ga0105249_10043452 | Ga0105249_100434523 | 316 |
| 161 | 3300009553 | Ga0105249_10049773 | Ga0105249_100497733 | 316 |
| 162 | 3300010375 | Ga0105239_10312500 | Ga0105239_103125003 | 316 |
| 163 | 3300010375 | Ga0105239_10317499 | Ga0105239_103174992 | 316 |
| 164 | 3300011119 | Ga0105246_10010264 | Ga0105246_100102644 | 316 |
| 165 | 3300011119 | Ga0105246_10179784 | Ga0105246_101797842 | 316 |
| 166 | 3300013100 | Ga0157373_10001845 | Ga0157373_100018458 | 316 |
| 167 | 3300013102 | Ga0157371_10082249 | Ga0157371_100822493 | 316 |
| 168 | 3300013102 | Ga0157371_10130613 | Ga0157371_101306132 | 316 |
| 169 | 3300013105 | Ga0157369_10028156 | Ga0157369_100281563 | 316 |
| 170 | 3300013296 | Ga0157374_10017489 | Ga0157374_100174896 | 316 |
| 171 | 3300013296 | Ga0157374_10025442 | Ga0157374_100254424 | 316 |
| 172 | 3300013296 | Ga0157374_10184284 | Ga0157374_101842842 | 316 |
| 173 | 3300013296 | Ga0157374_10234712 | Ga0157374_102347123 | 316 |
| 174 | 3300013297 | Ga0157378_10168488 | Ga0157378_101684881 | 316 |
| 175 | 3300013306 | Ga0163162_10001435 | Ga0163162_1000143512 | 316 |
| 176 | 3300013306 | Ga0163162_10129880 | Ga0163162_101298802 | 316 |
| 177 | 3300013306 | Ga0163162_10183827 | Ga0163162_101838272 | 316 |
| 178 | 3300013306 | Ga0163162_10305272 | Ga0163162_103052721 | 316 |
| 179 | 3300013307 | Ga0157372_10083383 | Ga0157372_100833833 | 316 |
| 180 | 3300013307 | Ga0157372_10089642 | Ga0157372_100896423 | 316 |
| 181 | 3300013307 | Ga0157372_10179995 | Ga0157372_101799951 | 316 |
| 182 | 3300013308 | Ga0157375_10008186 | Ga0157375_100081866 | 316 |
| 183 | 3300013308 | Ga0157375_10198196 | Ga0157375_101981962 | 316 |
| 184 | 3300014325 | Ga0163163_10006767 | Ga0163163_100067673 | 316 |
| 185 | 3300014325 | Ga0163163_10157836 | Ga0163163_101578362 | 316 |
| 186 | 3300014745 | Ga0157377_10096054 | Ga0157377_100960542 | 316 |
| 187 | 3300014968 | Ga0157379_10137072 | Ga0157379_101370722 | 316 |
| 188 | 3300014969 | Ga0157376_10019671 | Ga0157376_100196717 | 316 |
| 189 | 3300017792 | Ga0163161_10025366 | Ga0163161_100253668 | 316 |
| 190 | 3300017792 | Ga0163161_10081249 | Ga0163161_100812492 | 316 |
| 191 | 3300021384 | Ga0213876_10062842 | Ga0213876_100628422 | 316 |
| 192 | 3300025273 | Ga0209673_1000085 | Ga0209673_1000085108 | 316 |
| 193 | 3300025295 | Ga0209564_1002760 | Ga0209564_10027605 | 316 |
| 194 | 3300025295 | Ga0209564_1005109 | Ga0209564_10051097 | 316 |
| 195 | 3300025297 | Ga0209758_1009023 | Ga0209758_10090236 | 316 |
| 196 | 3300025298 | Ga0209050_1000524 | Ga0209050_100052428 | 316 |
| 197 | 3300025302 | Ga0207426_1001174 | Ga0207426_100117421 | 316 |
| 198 | 3300025304 | Ga0209257_1001638 | Ga0209257_100163812 | 316 |
| 199 | 3300025315 | Ga0207697_10056286 | Ga0207697_100562862 | 316 |
| 200 | 3300025321 | Ga0207656_10006093 | Ga0207656_100060934 | 316 |
| 201 | 3300025321 | Ga0207656_10085257 | Ga0207656_100852572 | 316 |
| 202 | 3300025900 | Ga0207710_10008371 | Ga0207710_100083712 | 316 |
| 203 | 3300025907 | Ga0207645_10042168 | Ga0207645_100421683 | 316 |
| 204 | 3300025911 | Ga0207654_10013169 | Ga0207654_100131692 | 316 |
| 205 | 3300025913 | Ga0207695_10000687 | Ga0207695_1000068723 | 316 |
| 206 | 3300025914 | Ga0207671_10001884 | Ga0207671_100018847 | 316 |
| 207 | 3300025914 | Ga0207671_10002245 | Ga0207671_100022453 | 316 |
| 208 | 3300025919 | Ga0207657_10004306 | Ga0207657_100043066 | 316 |
| 209 | 3300025920 | Ga0207649_10060503 | Ga0207649_100605032 | 316 |
| 210 | 3300025924 | Ga0207694_10007575 | Ga0207694_100075753 | 316 |
| 211 | 3300025924 | Ga0207694_10244154 | Ga0207694_102441542 | 316 |
| 212 | 3300025926 | Ga0207659_10029295 | Ga0207659_100292952 | 316 |
| 213 | 3300025933 | Ga0207706_10012755 | Ga0207706_100127553 | 316 |
| 214 | 3300025933 | Ga0207706_10067423 | Ga0207706_100674234 | 316 |
| 215 | 3300025934 | Ga0207686_10175800 | Ga0207686_101758001 | 316 |
| 216 | 3300025940 | Ga0207691_10040616 | Ga0207691_100406167 | 316 |
| 217 | 3300025940 | Ga0207691_10348771 | Ga0207691_103487712 | 316 |
| 218 | 3300025942 | Ga0207689_10027541 | Ga0207689_100275412 | 316 |
| 219 | 3300025942 | Ga0207689_10046433 | Ga0207689_100464333 | 316 |
| 220 | 3300025944 | Ga0207661_10022255 | Ga0207661_100222552 | 316 |
| 221 | 3300025944 | Ga0207661_10343543 | Ga0207661_103435431 | 316 |
| 222 | 3300025945 | Ga0207679_10023633 | Ga0207679_100236334 | 316 |
| 223 | 3300025961 | Ga0207712_10008308 | Ga0207712_100083084 | 316 |
| 224 | 3300025972 | Ga0207668_10010633 | Ga0207668_100106333 | 316 |
| 225 | 3300025986 | Ga0207658_10148894 | Ga0207658_101488942 | 316 |
| 226 | 3300025986 | Ga0207658_10222069 | Ga0207658_102220692 | 316 |
| 227 | 3300026035 | Ga0207703_10022982 | Ga0207703_100229822 | 316 |
| 228 | 3300026035 | Ga0207703_10035122 | Ga0207703_100351223 | 316 |
| 229 | 3300026067 | Ga0207678_10423206 | Ga0207678_104232061 | 316 |
| 230 | 3300026078 | Ga0207702_10193230 | Ga0207702_101932301 | 316 |
| 231 | 3300026088 | Ga0207641_10000061 | Ga0207641_100000618 | 316 |
| 232 | 3300026095 | Ga0207676_10014035 | Ga0207676_100140354 | 316 |
| 233 | 3300026116 | Ga0207674_10212757 | Ga0207674_102127572 | 316 |
| 234 | 3300026118 | Ga0207675_100045820 | Ga0207675_1000458202 | 316 |
| 235 | 3300026142 | Ga0207698_10482278 | Ga0207698_104822782 | 316 |
| 236 | 3300028381 | Ga0268264_10007686 | Ga0268264_100076864 | 316 |
| 237 | 3300032004 | Ga0307414_10177198 | Ga0307414_101771982 | 316 |
| 238 | 3300037418 | Ga0395900_0052032 | Ga0395900_0052032_31_984 | 316 |
| 239 | 3300037471 | Ga0395905_0028906 | Ga0395905_0028906_3415_4368 | 316 |
| 240 | 3300037471 | Ga0395905_0087590 | Ga0395905_0087590_365_1348 | 316 |
| 241 | 3300037471 | Ga0395905_0177823 | Ga0395905_0177823_274_1227 | 316 |
| 242 | 3300039437 | Ga0436365_0215388 | Ga0436365_0215388_15999_16949 | 316 |
| 243 | 3300042007 | Ga0439449_0015386 | Ga0439449_0015386_548_1501 | 316 |
| 244 | 3300042014 | Ga0439457_002577 | Ga0439457_002577_2056_3009 | 316 |
| 245 | 3300044658 | Ga0466972_0045641 | Ga0466972_0045641_193_1146 | 316 |
| 246 | 3300044842 | Ga0466957_0001781 | Ga0466957_0001781_3490_4443 | 316 |
| 247 | 3300046514 | Ga0495618_0258890 | Ga0495618_0258890_56_1009 | 316 |
| 248 | 3300046616 | Ga0495668_0005139 | Ga0495668_0005139_5722_6675 | 316 |
| 249 | 3300046660 | Ga0495625_0162066 | Ga0495625_0162066_313_1266 | 316 |
| 250 | 3300047318 | Ga0495636_0019647 | Ga0495636_0019647_70_1107 | 316 |
| 251 | 3300048911 | Ga0496108_0441207 | Ga0496108_0441207_58_1011 | 316 |
| 252 | 3300048924 | Ga0496121_0000011 | Ga0496121_0000011_655047_656006 | 316 |
| 253 | 3300049703 | Ga0501219_000779 | Ga0501219_000779_2548_3507 | 316 |
| 254 | 3300050005 | Ga0501284_00181 | Ga0501284_00181_1048_2007 | 316 |
| 255 | 3300053153 | Ga0500616_0005533 | Ga0500616_0005533_3369_4322 | 316 |
| 256 | 2162886007 | SwRhRL2b_contig_2869587 | SwRhRL2b_0274.00002440 | 317 |
| 257 | 3300001979 | JGI24740J21852_10002179 | JGI24740J21852_100021795 | 317 |
| 258 | 3300002738 | JGI25154J39366_1000042 | JGI25154J39366_1000042121 | 317 |
| 259 | 3300003323 | rootH1_10163754 | rootH1_101637542 | 317 |
| 260 | 3300005289 | Ga0065704_10070994 | Ga0065704_100709944 | 317 |
| 261 | 3300005289 | Ga0065704_10085203 | Ga0065704_100852032 | 317 |
| 262 | 3300005337 | Ga0070682_100000122 | Ga0070682_10000012251 | 317 |
| 263 | 3300005455 | Ga0070663_100169550 | Ga0070663_1001695501 | 317 |
| 264 | 3300009036 | Ga0105244_10000010 | Ga0105244_1000001038 | 317 |
| 265 | 3300009148 | Ga0105243_10000201 | Ga0105243_1000020143 | 317 |
| 266 | 3300013100 | Ga0157373_10000019 | Ga0157373_10000019131 | 317 |
| 267 | 3300013102 | Ga0157371_10066022 | Ga0157371_100660223 | 317 |
| 268 | 3300013104 | Ga0157370_10004214 | Ga0157370_100042143 | 317 |
| 269 | 3300013104 | Ga0157370_10141758 | Ga0157370_101417582 | 317 |
| 270 | 3300014497 | Ga0182008_10000015 | Ga0182008_1000001519 | 317 |
| 271 | 3300025246 | Ga0209646_1000017 | Ga0209646_100001715 | 317 |
| 272 | 3300025250 | Ga0209026_1000721 | Ga0209026_10007218 | 317 |
| 273 | 3300025291 | Ga0209675_1000094 | Ga0209675_100009449 | 317 |
| 274 | 3300025728 | Ga0207655_1000347 | Ga0207655_100034728 | 317 |
| 275 | 3300025935 | Ga0207709_10000312 | Ga0207709_1000031225 | 317 |
| 276 | 3300046500 | Ga0495596_0000877 | Ga0495596_0000877_1650_2603 | 317 |
| 277 | 3300046519 | Ga0495632_0005404 | Ga0495632_0005404_1904_2857 | 317 |
| 278 | 3300046522 | Ga0495643_0056305 | Ga0495643_0056305_176_1129 | 317 |
| 279 | 3300046538 | Ga0495609_0000025 | Ga0495609_0000025_188519_189472 | 317 |
| 280 | 3300046558 | Ga0495633_0008534 | Ga0495633_0008534_2889_3842 | 317 |
| 281 | 3300046660 | Ga0495625_0001869 | Ga0495625_0001869_21118_22071 | 317 |
| 282 | 3300047472 | Ga0495686_0000151 | Ga0495686_0000151_8816_9769 | 317 |
| 283 | 3300048905 | Ga0496102_0007675 | Ga0496102_0007675_5851_6804 | 317 |
| 284 | 3300048916 | Ga0496113_0090824 | Ga0496113_0090824_241_1194 | 317 |
| 285 | 3300048919 | Ga0496116_0000006 | Ga0496116_0000006_634155_635108 | 317 |
| 286 | 3300048920 | Ga0496117_0000023 | Ga0496117_0000023_185915_186868 | 317 |
| 287 | 3300048920 | Ga0496117_0093364 | Ga0496117_0093364_496_1449 | 317 |
| 288 | 3300048921 | Ga0496118_0000388 | Ga0496118_0000388_71475_72428 | 317 |
| 289 | 3300048922 | Ga0496119_0000010 | Ga0496119_0000010_251728_252681 | 317 |
| 290 | 3300048923 | Ga0496120_0116137 | Ga0496120_0116137_90_1043 | 317 |
| 291 | 3300048924 | Ga0496121_0018752 | Ga0496121_0018752_2530_3483 | 317 |
| 292 | 3300048925 | Ga0496122_0000066 | Ga0496122_0000066_105055_106008 | 317 |
| 293 | 3300048925 | Ga0496122_0000091 | Ga0496122_0000091_70980_71933 | 317 |
| 294 | 3300048925 | Ga0496122_0000458 | Ga0496122_0000458_31907_32860 | 317 |
| 295 | 3300048925 | Ga0496122_0003230 | Ga0496122_0003230_17227_18180 | 317 |
| 296 | 3300048925 | Ga0496122_0010627 | Ga0496122_0010627_1713_2666 | 317 |
| 297 | 3300048926 | Ga0496123_0000294 | Ga0496123_0000294_95434_96387 | 317 |
| 298 | 3300048926 | Ga0496123_0006185 | Ga0496123_0006185_658_1611 | 317 |
| 299 | 3300048926 | Ga0496123_0014857 | Ga0496123_0014857_856_1809 | 317 |
| 300 | 3300048927 | Ga0496124_0000418 | Ga0496124_0000418_35500_36453 | 317 |
| 301 | 3300048928 | Ga0496125_0000181 | Ga0496125_0000181_133457_134410 | 317 |
| 302 | 3300048928 | Ga0496125_0007980 | Ga0496125_0007980_9846_10799 | 317 |
| 303 | 3300048929 | Ga0496126_0001022 | Ga0496126_0001022_20776_21729 | 317 |
| 304 | 3300048929 | Ga0496126_0117196 | Ga0496126_0117196_897_1850 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oaj-assembly1.cif.gz_A | crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 | 0.9518 | 1 | 313 |
| 3oaj-assembly1.cif.gz_A | crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 | 0.9458 | 1 | 313 |
| 4huz-assembly1.cif.gz_A-2 | 2,6-dichloro-p-hydroquinone 1,2-dioxygenase | 0.9338 | 1 | 304 |
| 1zsw-assembly1.cif.gz_A | crystal structure of bacillus cereus metallo protein from glyoxalase family | 0.9259 | 4 | 310 |
| 1zsw-assembly1.cif.gz_A | crystal structure of bacillus cereus metallo protein from glyoxalase family | 0.8949 | 4 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3oajB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9752 | 4 | 313 | 3.10.180.10 |
| 1zswA01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9744 | 4 | 310 | 3.10.180.10 |
| 3oajB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9463 | 4 | 313 | 3.10.180.10 |
| af_Q2G137_30_308_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9333 | 31 | 308 | 3.10.180.10 |
| 4huzA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9323 | 67 | 211 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0FUU2-F1-model_v4 | Ring-cleaving dioxygenase | 0.9952 | 1 | 316 |
GO:0051213
|
| AF-A0A1G9THG6-F1-model_v4 | Glyoxalase family protein | 0.9944 | 1 | 317 |
|
| AF-U5C5S7-F1-model_v4 | Diguanylate cyclase | 0.994 | 2 | 317 |
|
| AF-A0A562SHY6-F1-model_v4 | Glyoxalase family protein | 0.9938 | 1 | 315 |
|
| AF-A0A1A9I565-F1-model_v4 | Diguanylate cyclase | 0.9935 | 1 | 317 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar