F397802

General Info

Members Datasets Scaffolds Average Seq Length
304 212 608 512

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0009479|Ga0501076_0009479_2373_3890
Length 505
Sequence MTNSLLWTPLAFGLVGLFLPKRASGWWATLGALVTLALAXXXVFDFDSGSSGLQHTVDVTWIAGLGVDYSLGIDGLNVFLVLLTAVLWVGGVAFAAFRQQERPQLFFFLMLVAETATIGAFLAQDLLLFVLFFDFMLVPFYFLFGIWGSDRSGEGGLTAPAATLKMIVYTLIGSLLMLVAAIATAIIAADGGHLTFSIAELQRQGIGIDSQRWIFWFFAAAFLVKMPAFMLHGWMPDAYRAAPLPALIVFSGVLAKVGAYGFLRVVLPLFPDATVEFQEVILVIALASVLYGSVMAFTQTNVRLIAGYSSVAQLGFITLGIFALRADGSDGAVLQMVNHGLVVAPIFVIVALLLERTGTEDIREMGGLATRAPVLAALFLVVAMGTLAIPGSANFIGEFYILNGLFQAKIVYACIAISGVAMSAYYALRMYQATMHNRLPAQQRAGYASREIGLRDGIVLAPLVLCIVALAFYPQLILKRTNPTVQQTVAKVTRGDAPNARLAER

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
106 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 12.83
Rhizosphere 82.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0009479 3300049592 Bacteria 7192
2 JGI24746J21847_1000115 3300001977 Bacteria 9443
3 JGI24740J21852_10000401 3300001979 Bacteria 18644
4 JGI24748J21848_1000702 3300002074 Bacteria 3607
5 JGI24034J26672_10000088 3300002239 Bacteria 17296
6 JGI24742J22300_10001625 3300002244 Bacteria 3573
7 JGI25404J52841_10000194 3300003659 Bacteria 7181
8 Ga0070683_100034604 3300005329 Bacteria 4616
9 Ga0070690_100091322 3300005330 Bacteria 2006
10 Ga0070670_100106872 3300005331 Bacteria 2412
11 Ga0070677_10000107 3300005333 Bacteria 27160
12 Ga0070666_10002746 3300005335 Bacteria 10630
13 Ga0070666_10124985 3300005335 Bacteria 1785
14 Ga0070680_100026504 3300005336 Bacteria 4637
15 Ga0070682_100000103 3300005337 Bacteria 76169
16 Ga0068868_100000299 3300005338 Bacteria 33344
17 Ga0068868_100019223 3300005338 Bacteria 5118
18 Ga0070691_10000319 3300005341 Bacteria 17019
19 Ga0070691_10000675 3300005341 Bacteria 13287
20 Ga0070661_100000045 3300005344 Bacteria 94702
21 Ga0070668_100001863 3300005347 Bacteria 15406
22 Ga0070675_100000209 3300005354 Bacteria 37434
23 Ga0070674_100000011 3300005356 Bacteria 134886
24 Ga0070674_100000810 3300005356 Bacteria 16128
25 Ga0070673_100002476 3300005364 Bacteria 11272
26 Ga0070688_100000076 3300005365 Bacteria 49151
27 Ga0070659_100027318 3300005366 Bacteria 4397
28 Ga0070667_100001291 3300005367 Bacteria 22638
29 Ga0070667_100006640 3300005367 Bacteria 9617
30 Ga0070713_100000628 3300005436 Bacteria 22525
31 Ga0070711_100005854 3300005439 Bacteria 7378
32 Ga0070663_100001137 3300005455 Bacteria 14651
33 Ga0070662_100000109 3300005457 Bacteria 45782
34 Ga0070681_10044802 3300005458 Bacteria 4429
35 Ga0070685_10000062 3300005466 Bacteria 62782
36 Ga0070685_10000592 3300005466 Bacteria 20114
37 Ga0070679_100002387 3300005530 Bacteria 17026
38 Ga0070684_100014823 3300005535 Bacteria 6325
39 Ga0070684_100064355 3300005535 Bacteria 3217
40 Ga0070672_100000003 3300005543 Bacteria 159532
41 Ga0068854_100008518 3300005578 Bacteria 6599
42 Ga0068856_100065253 3300005614 Bacteria 3597
43 Ga0068856_100091481 3300005614 Bacteria 3026
44 Ga0068852_100000035 3300005616 Bacteria 99721
45 Ga0068864_100000159 3300005618 Bacteria 62636
46 Ga0068866_10000040 3300005718 Bacteria 49399
47 Ga0068866_10000475 3300005718 Bacteria 18415
48 Ga0068863_100000042 3300005841 Bacteria 154459
49 Ga0068863_100005232 3300005841 Bacteria 12801
50 Ga0068863_100069584 3300005841 Bacteria 3327
51 Ga0068858_100000244 3300005842 Bacteria 58744
52 Ga0068858_100000965 3300005842 Bacteria 29800
53 Ga0068860_100010843 3300005843 Bacteria 8994
54 Ga0068862_100019322 3300005844 Bacteria 5685
55 Ga0081455_10012902 3300005937 Bacteria 8291
56 Ga0081455_10052949 3300005937 Bacteria 3470
57 Ga0081538_10000407 3300005981 Bacteria 48780
58 Ga0081538_10009890 3300005981 Bacteria 7885
59 Ga0081540_1000490 3300005983 Bacteria 38898
60 Ga0081539_10004262 3300005985 Bacteria 16052
61 Ga0070715_10000036 3300006163 Bacteria 74811
62 Ga0075433_10000421 3300006852 Bacteria 27102
63 Ga0075433_10031153 3300006852 Bacteria 4557
64 Ga0068865_100000470 3300006881 Bacteria 22540
65 Ga0105245_10000291 3300009098 Bacteria 47913
66 Ga0105245_10000324 3300009098 Bacteria 44987
67 Ga0105245_10009522 3300009098 Bacteria 8471
68 Ga0105241_10039899 3300009174 Bacteria 3542
69 Ga0105242_10000415 3300009176 Bacteria 33960
70 Ga0105242_10004751 3300009176 Bacteria 10519
71 Ga0105242_10039738 3300009176 Bacteria 3788
72 Ga0105248_10003169 3300009177 Bacteria 18224
73 Ga0105238_10000051 3300009551 Bacteria 141705
74 Ga0105249_10000085 3300009553 Bacteria 133497
75 Ga0157370_10025887 3300013104 Bacteria 5800
76 Ga0157369_10000173 3300013105 Bacteria 90860
77 Ga0157374_10003397 3300013296 Bacteria 13386
78 Ga0157378_10030097 3300013297 Bacteria 4796
79 Ga0157375_10001056 3300013308 Bacteria 23764
80 Ga0157379_10066717 3300014968 Bacteria 3217
81 Ga0157376_10040694 3300014969 Bacteria 3799
82 Ga0163161_10000018 3300017792 Bacteria 228801
83 Ga0207656_10011412 3300025321 Bacteria 3357
84 Ga0207682_10000102 3300025893 Bacteria 38757
85 Ga0207642_10000001 3300025899 Bacteria 714030
86 Ga0207642_10000003 3300025899 Bacteria 650651
87 Ga0207642_10000086 3300025899 Bacteria 24454
88 Ga0207710_10000154 3300025900 Bacteria 73881
89 Ga0207710_10021478 3300025900 Bacteria 2767
90 Ga0207680_10067000 3300025903 Bacteria 2210
91 Ga0207685_10000001 3300025905 Bacteria 604473
92 Ga0207707_10049013 3300025912 Bacteria 3681
93 Ga0207693_10005251 3300025915 Bacteria 10836
94 Ga0207663_10005434 3300025916 Bacteria 6418
95 Ga0207660_10013518 3300025917 Bacteria 5350
96 Ga0207649_10000021 3300025920 Bacteria 209660
97 Ga0207652_10000444 3300025921 Bacteria 42675
98 Ga0207652_10002144 3300025921 Bacteria 16926
99 Ga0207694_10000035 3300025924 Bacteria 195870
100 Ga0207659_10000242 3300025926 Bacteria 33194
101 Ga0207687_10000027 3300025927 Bacteria 168505
102 Ga0207687_10000058 3300025927 Bacteria 85860
103 Ga0207687_10000713 3300025927 Bacteria 22529
104 Ga0207700_10000013 3300025928 Bacteria 230462
105 Ga0207706_10000413 3300025933 Bacteria 45740
106 Ga0207686_10000247 3300025934 Bacteria 41146
107 Ga0207686_10001699 3300025934 Bacteria 12260
108 Ga0207686_10040235 3300025934 Bacteria 2841
109 Ga0207709_10006427 3300025935 Bacteria 6596
110 Ga0207669_10000007 3300025937 Bacteria 169904
111 Ga0207669_10000099 3300025937 Bacteria 43726
112 Ga0207704_10000239 3300025938 Bacteria 27105
113 Ga0207691_10000005 3300025940 Bacteria 163117
114 Ga0207711_10000019 3300025941 Bacteria 412779
115 Ga0207661_10029523 3300025944 Bacteria 4213
116 Ga0207651_10001290 3300025960 Bacteria 11276
117 Ga0207712_10000033 3300025961 Bacteria 209336
118 Ga0207668_10072389 3300025972 Bacteria 2466
119 Ga0207640_10003204 3300025981 Bacteria 8813
120 Ga0207658_10001498 3300025986 Bacteria 18144
121 Ga0207658_10014661 3300025986 Bacteria 5369
122 Ga0207677_10004036 3300026023 Bacteria 7835
123 Ga0207677_10010765 3300026023 Bacteria 5186
124 Ga0207703_10000028 3300026035 Bacteria 208682
125 Ga0207703_10000411 3300026035 Bacteria 45579
126 Ga0207639_10011691 3300026041 Bacteria 6103
127 Ga0207678_10003342 3300026067 Bacteria 14467
128 Ga0207702_10000333 3300026078 Bacteria 54074
129 Ga0207702_10015114 3300026078 Bacteria 6400
130 Ga0207702_10041565 3300026078 Bacteria 3855
131 Ga0207641_10000066 3300026088 Bacteria 155638
132 Ga0207641_10029706 3300026088 Bacteria 4521
133 Ga0207641_10051174 3300026088 Bacteria 3498
134 Ga0207676_10000128 3300026095 Bacteria 66546
135 Ga0207683_10036161 3300026121 Bacteria 4298
136 Ga0207698_10000044 3300026142 Bacteria 94471
137 Ga0207698_10027891 3300026142 Bacteria 4017
138 Ga0268266_10000076 3300028379 Bacteria 217644
139 Ga0268266_10000424 3300028379 Bacteria 64091
140 Ga0268266_10001583 3300028379 Bacteria 26570
141 Ga0268265_10004041 3300028380 Bacteria 10326
142 Ga0268264_10002303 3300028381 Bacteria 16909
143 Ga0265337_1000044 3300028556 Bacteria 54694
144 Ga0265326_10000038 3300028558 Bacteria 88362
145 Ga0265319_1000102 3300028563 Bacteria 66477
146 Ga0265322_10000006 3300028654 Bacteria 231685
147 Ga0265336_10001989 3300028666 Bacteria 8726
148 Ga0265338_10000441 3300028800 Bacteria 74208
149 Ga0265324_10000171 3300029957 Bacteria 50487
150 Ga0265320_10000001 3300031240 Bacteria 847191
151 Ga0265325_10030327 3300031241 Bacteria 2900
152 Ga0265329_10004430 3300031242 Bacteria 5845
153 Ga0265331_10000624 3300031250 Bacteria 30780
154 Ga0265327_10000003 3300031251 Bacteria 852750
155 Ga0265316_10013013 3300031344 Bacteria 7424
156 Ga0265313_10038370 3300031595 Bacteria 2386
157 Ga0265314_10000103 3300031711 Bacteria 127956
158 Ga0373937_0040856 3300036401 Bacteria 4229
159 Ga0451853_3408443 3300041512 Bacteria 5446
160 Ga0466963_0000040 3300044694 Bacteria 41869
161 Ga0466957_0010082 3300044842 Bacteria 5407
162 Ga0495592_0000458 3300046454 Bacteria 30514
163 Ga0495603_0000167 3300046455 Bacteria 33276
164 Ga0495603_0000655 3300046455 Bacteria 19575
165 Ga0495603_0019700 3300046455 Bacteria 4085
166 Ga0495629_0000738 3300046459 Bacteria 26514
167 Ga0495641_0000001 3300046461 Bacteria 485224
168 Ga0495653_0081882 3300046463 Bacteria 2384
169 Ga0495582_0000007 3300046473 Bacteria 139882
170 Ga0495662_0000073 3300046476 Bacteria 35403
171 Ga0495662_0013315 3300046476 Bacteria 4002
172 Ga0495594_0000017 3300046499 Bacteria 88992
173 Ga0495606_0000131 3300046507 Bacteria 127298
174 Ga0495608_0001021 3300046511 Bacteria 19711
175 Ga0495608_0057300 3300046511 Bacteria 2572
176 Ga0495618_0000241 3300046514 Bacteria 39957
177 Ga0495620_0001188 3300046515 Bacteria 15939
178 Ga0495628_0014879 3300046516 Bacteria 6507
179 Ga0495628_0022079 3300046516 Bacteria 5231
180 Ga0495630_0000053 3300046517 Bacteria 93065
181 Ga0495630_0003260 3300046517 Bacteria 11314
182 Ga0495652_0000022 3300046529 Bacteria 178368
183 Ga0495652_0076028 3300046529 Bacteria 2787
184 Ga0495640_0014279 3300046533 Bacteria 6017
185 Ga0495640_0018708 3300046533 Bacteria 5128
186 Ga0495586_0002162 3300046535 Bacteria 10685
187 Ga0495587_0030442 3300046536 Bacteria 3273
188 Ga0495598_0005030 3300046537 Bacteria 2903
189 Ga0495645_0014181 3300046543 Bacteria 5650
190 Ga0495622_0000107 3300046557 Bacteria 72476
191 Ga0495667_0000044 3300046559 Bacteria 121910
192 Ga0495656_0000352 3300046615 Bacteria 15524
193 Ga0495634_0000013 3300046642 Bacteria 130546
194 Ga0495634_0000840 3300046642 Bacteria 29619
195 Ga0495634_0023759 3300046642 Bacteria 4306
196 Ga0495625_0000117 3300046660 Bacteria 121901
197 Ga0495635_0001966 3300046663 Bacteria 13977
198 Ga0495588_0000202 3300046674 Bacteria 59591
199 Ga0495647_0000003 3300046681 Bacteria 145235
200 Ga0495647_0004060 3300046681 Bacteria 4728
201 Ga0495658_0000007 3300046683 Bacteria 139822
202 Ga0495658_0003502 3300046683 Bacteria 7768
203 Ga0495669_0000065 3300046684 Bacteria 69983
204 Ga0495613_0000066 3300046689 Bacteria 102122
205 Ga0495613_0000122 3300046689 Bacteria 77044
206 Ga0495613_0156864 3300046689 Bacteria 1621
207 Ga0495624_0006180 3300046690 Bacteria 8515
208 Ga0495649_0001991 3300046694 Bacteria 14824
209 Ga0495600_0002102 3300046809 Bacteria 11260
210 Ga0495604_0000081 3300047317 Bacteria 82621
211 Ga0495604_0035008 3300047317 Bacteria 3967
212 Ga0495674_0000113 3300047319 Bacteria 60388
213 Ga0495676_0005348 3300047321 Bacteria 11757
214 Ga0495680_0000629 3300047322 Bacteria 39576
215 Ga0495680_0001777 3300047322 Bacteria 22849
216 Ga0495680_0006214 3300047322 Bacteria 11133
217 Ga0495593_0056934 3300047673 Bacteria 2054
218 Ga0495602_0000008 3300048088 Bacteria 260157
219 Ga0495602_0009086 3300048088 Bacteria 10348
220 Ga0496100_0000003 3300048903 Bacteria 360802
221 Ga0496100_0000046 3300048903 Bacteria 77660
222 Ga0496101_0000003 3300048904 Bacteria 406565
223 Ga0496101_0000124 3300048904 Bacteria 75495
224 Ga0496102_0000061 3300048905 Bacteria 167066
225 Ga0496103_0000044 3300048906 Bacteria 167066
226 Ga0496103_0066529 3300048906 Bacteria 2249
227 Ga0496104_0000007 3300048907 Bacteria 524804
228 Ga0496104_0000120 3300048907 Bacteria 72797
229 Ga0496104_0000491 3300048907 Bacteria 34073
230 Ga0496105_0000002 3300048908 Bacteria 753215
231 Ga0496105_0000020 3300048908 Bacteria 181484
232 Ga0496105_0000110 3300048908 Bacteria 56223
233 Ga0496105_0156363 3300048908 Bacteria 1872
234 Ga0496106_0000015 3300048909 Bacteria 187570
235 Ga0496106_0000059 3300048909 Bacteria 87781
236 Ga0496106_0000065 3300048909 Bacteria 84237
237 Ga0496107_0000018 3300048910 Bacteria 158433
238 Ga0496107_0000026 3300048910 Bacteria 108989
239 Ga0496108_0000025 3300048911 Bacteria 177919
240 Ga0496108_0000032 3300048911 Bacteria 158930
241 Ga0496108_0000163 3300048911 Bacteria 62902
242 Ga0496108_0003965 3300048911 Bacteria 11890
243 Ga0496109_0000155 3300048912 Bacteria 66634
244 Ga0496109_0000217 3300048912 Bacteria 56358
245 Ga0496109_0018444 3300048912 Bacteria 6129
246 Ga0496109_0133754 3300048912 Bacteria 2316
247 Ga0496110_0000003 3300048913 Bacteria 144124
248 Ga0496110_0024180 3300048913 Bacteria 5174
249 Ga0496111_0000058 3300048914 Bacteria 44867
250 Ga0496112_0000003 3300048915 Bacteria 660147
251 Ga0496112_0018107 3300048915 Bacteria 6628
252 Ga0496112_0164168 3300048915 Bacteria 2187
253 Ga0496113_0000207 3300048916 Bacteria 27349
254 Ga0496113_0004573 3300048916 Bacteria 8527
255 Ga0496113_0024590 3300048916 Bacteria 4283
256 Ga0496114_0000042 3300048917 Bacteria 133043
257 Ga0496115_0000005 3300048918 Bacteria 290756
258 Ga0496115_0003718 3300048918 Bacteria 10971
259 Ga0496116_0000814 3300048919 Bacteria 39470
260 Ga0496117_0004504 3300048920 Bacteria 15320
261 Ga0496118_0020448 3300048921 Bacteria 5869
262 Ga0496119_0013624 3300048922 Bacteria 6454
263 Ga0496119_0033454 3300048922 Bacteria 3406
264 Ga0496120_0007159 3300048923 Bacteria 8363
265 Ga0496121_0016519 3300048924 Bacteria 7614
266 Ga0496121_0046575 3300048924 Bacteria 3710
267 Ga0496125_0017662 3300048928 Bacteria 6792
268 Ga0496125_0103042 3300048928 Bacteria 2095
269 Ga0496126_0048028 3300048929 Bacteria 3905
270 Ga0501032_0010588 3300049569 Bacteria 6644
271 Ga0501033_0001259 3300049570 Bacteria 22655
272 Ga0501034_0047454 3300049571 Bacteria 4336
273 Ga0501036_0000290 3300049572 Bacteria 34813
274 Ga0501038_0001257 3300049574 Bacteria 23006
275 Ga0501043_0011637 3300049579 Bacteria 6885
276 Ga0501046_0001423 3300049580 Bacteria 23025
277 Ga0501047_0005727 3300049581 Bacteria 11695
278 Ga0501047_0059585 3300049581 Bacteria 3685
279 Ga0501048_0000843 3300049582 Bacteria 22584
280 Ga0501070_0014448 3300049586 Bacteria 6644
281 Ga0501073_0008515 3300049589 Bacteria 7608
282 Ga0501074_0072047 3300049590 Bacteria 2483
283 Ga0501075_0013457 3300049591 Bacteria 5838
284 Ga0501083_0040180 3300049744 Bacteria 3175
285 Ga0501035_0000368 3300049822 Bacteria 51908
286 Ga0501044_0025351 3300049823 Bacteria 6284
287 nmdc:mga0a205_19_c2 3300050515 Bacteria 74147
288 Ga0495601_0000061 3300053077 Bacteria 60136
289 Ga0495601_0000090 3300053077 Bacteria 49013
290 Ga0495601_0008741 3300053077 Bacteria 5976
291 Ga0495601_0023865 3300053077 Bacteria 3761
292 Ga0495612_0000116 3300053078 Bacteria 33433
293 Ga0495612_0001063 3300053078 Bacteria 11240
294 Ga0495655_0000003 3300053083 Bacteria 303053
295 Ga0495655_0000816 3300053083 Bacteria 4898
296 Ga0495595_0000083 3300053084 Bacteria 45482
297 Ga0495619_0000015 3300053085 Bacteria 252787
298 Ga0495619_0000869 3300053085 Bacteria 19824
299 Ga0495619_0001450 3300053085 Bacteria 15618
300 Ga0495619_0002049 3300053085 Bacteria 13384
301 Ga0495619_0020518 3300053085 Bacteria 4210
302 Ga0500641_0006228 3300053096 Bacteria 4234
303 Ga0500628_000002 3300053129 Bacteria 357687
304 Ga0501082_0008494 3300060353 Bacteria 8854
305 Ga0501076_0009479
306 JGI24746J21847_1000115
307 JGI24740J21852_10000401
308 JGI24748J21848_1000702
309 JGI24034J26672_10000088
310 JGI24742J22300_10001625
311 JGI25404J52841_10000194
312 Ga0070683_100034604
313 Ga0070690_100091322
314 Ga0070670_100106872
315 Ga0070677_10000107
316 Ga0070666_10002746
317 Ga0070666_10124985
318 Ga0070680_100026504
319 Ga0070682_100000103
320 Ga0068868_100000299
321 Ga0068868_100019223
322 Ga0070691_10000319
323 Ga0070691_10000675
324 Ga0070661_100000045
325 Ga0070668_100001863
326 Ga0070675_100000209
327 Ga0070674_100000011
328 Ga0070674_100000810
329 Ga0070673_100002476
330 Ga0070688_100000076
331 Ga0070659_100027318
332 Ga0070667_100001291
333 Ga0070667_100006640
334 Ga0070713_100000628
335 Ga0070711_100005854
336 Ga0070663_100001137
337 Ga0070662_100000109
338 Ga0070681_10044802
339 Ga0070685_10000062
340 Ga0070685_10000592
341 Ga0070679_100002387
342 Ga0070684_100014823
343 Ga0070684_100064355
344 Ga0070672_100000003
345 Ga0068854_100008518
346 Ga0068856_100065253
347 Ga0068856_100091481
348 Ga0068852_100000035
349 Ga0068864_100000159
350 Ga0068866_10000040
351 Ga0068866_10000475
352 Ga0068863_100000042
353 Ga0068863_100005232
354 Ga0068863_100069584
355 Ga0068858_100000244
356 Ga0068858_100000965
357 Ga0068860_100010843
358 Ga0068862_100019322
359 Ga0081455_10012902
360 Ga0081455_10052949
361 Ga0081538_10000407
362 Ga0081538_10009890
363 Ga0081540_1000490
364 Ga0081539_10004262
365 Ga0070715_10000036
366 Ga0075433_10000421
367 Ga0075433_10031153
368 Ga0068865_100000470
369 Ga0105245_10000291
370 Ga0105245_10000324
371 Ga0105245_10009522
372 Ga0105241_10039899
373 Ga0105242_10000415
374 Ga0105242_10004751
375 Ga0105242_10039738
376 Ga0105248_10003169
377 Ga0105238_10000051
378 Ga0105249_10000085
379 Ga0157370_10025887
380 Ga0157369_10000173
381 Ga0157374_10003397
382 Ga0157378_10030097
383 Ga0157375_10001056
384 Ga0157379_10066717
385 Ga0157376_10040694
386 Ga0163161_10000018
387 Ga0207656_10011412
388 Ga0207682_10000102
389 Ga0207642_10000001
390 Ga0207642_10000003
391 Ga0207642_10000086
392 Ga0207710_10000154
393 Ga0207710_10021478
394 Ga0207680_10067000
395 Ga0207685_10000001
396 Ga0207707_10049013
397 Ga0207693_10005251
398 Ga0207663_10005434
399 Ga0207660_10013518
400 Ga0207649_10000021
401 Ga0207652_10000444
402 Ga0207652_10002144
403 Ga0207694_10000035
404 Ga0207659_10000242
405 Ga0207687_10000027
406 Ga0207687_10000058
407 Ga0207687_10000713
408 Ga0207700_10000013
409 Ga0207706_10000413
410 Ga0207686_10000247
411 Ga0207686_10001699
412 Ga0207686_10040235
413 Ga0207709_10006427
414 Ga0207669_10000007
415 Ga0207669_10000099
416 Ga0207704_10000239
417 Ga0207691_10000005
418 Ga0207711_10000019
419 Ga0207661_10029523
420 Ga0207651_10001290
421 Ga0207712_10000033
422 Ga0207668_10072389
423 Ga0207640_10003204
424 Ga0207658_10001498
425 Ga0207658_10014661
426 Ga0207677_10004036
427 Ga0207677_10010765
428 Ga0207703_10000028
429 Ga0207703_10000411
430 Ga0207639_10011691
431 Ga0207678_10003342
432 Ga0207702_10000333
433 Ga0207702_10015114
434 Ga0207702_10041565
435 Ga0207641_10000066
436 Ga0207641_10029706
437 Ga0207641_10051174
438 Ga0207676_10000128
439 Ga0207683_10036161
440 Ga0207698_10000044
441 Ga0207698_10027891
442 Ga0268266_10000076
443 Ga0268266_10000424
444 Ga0268266_10001583
445 Ga0268265_10004041
446 Ga0268264_10002303
447 Ga0265337_1000044
448 Ga0265326_10000038
449 Ga0265319_1000102
450 Ga0265322_10000006
451 Ga0265336_10001989
452 Ga0265338_10000441
453 Ga0265324_10000171
454 Ga0265320_10000001
455 Ga0265325_10030327
456 Ga0265329_10004430
457 Ga0265331_10000624
458 Ga0265327_10000003
459 Ga0265316_10013013
460 Ga0265313_10038370
461 Ga0265314_10000103
462 Ga0373937_0040856
463 Ga0451853_3408443
464 Ga0466963_0000040
465 Ga0466957_0010082
466 Ga0495592_0000458
467 Ga0495603_0000167
468 Ga0495603_0000655
469 Ga0495603_0019700
470 Ga0495629_0000738
471 Ga0495641_0000001
472 Ga0495653_0081882
473 Ga0495582_0000007
474 Ga0495662_0000073
475 Ga0495662_0013315
476 Ga0495594_0000017
477 Ga0495606_0000131
478 Ga0495608_0001021
479 Ga0495608_0057300
480 Ga0495618_0000241
481 Ga0495620_0001188
482 Ga0495628_0014879
483 Ga0495628_0022079
484 Ga0495630_0000053
485 Ga0495630_0003260
486 Ga0495652_0000022
487 Ga0495652_0076028
488 Ga0495640_0014279
489 Ga0495640_0018708
490 Ga0495586_0002162
491 Ga0495587_0030442
492 Ga0495598_0005030
493 Ga0495645_0014181
494 Ga0495622_0000107
495 Ga0495667_0000044
496 Ga0495656_0000352
497 Ga0495634_0000013
498 Ga0495634_0000840
499 Ga0495634_0023759
500 Ga0495625_0000117
501 Ga0495635_0001966
502 Ga0495588_0000202
503 Ga0495647_0000003
504 Ga0495647_0004060
505 Ga0495658_0000007
506 Ga0495658_0003502
507 Ga0495669_0000065
508 Ga0495613_0000066
509 Ga0495613_0000122
510 Ga0495613_0156864
511 Ga0495624_0006180
512 Ga0495649_0001991
513 Ga0495600_0002102
514 Ga0495604_0000081
515 Ga0495604_0035008
516 Ga0495674_0000113
517 Ga0495676_0005348
518 Ga0495680_0000629
519 Ga0495680_0001777
520 Ga0495680_0006214
521 Ga0495593_0056934
522 Ga0495602_0000008
523 Ga0495602_0009086
524 Ga0496100_0000003
525 Ga0496100_0000046
526 Ga0496101_0000003
527 Ga0496101_0000124
528 Ga0496102_0000061
529 Ga0496103_0000044
530 Ga0496103_0066529
531 Ga0496104_0000007
532 Ga0496104_0000120
533 Ga0496104_0000491
534 Ga0496105_0000002
535 Ga0496105_0000020
536 Ga0496105_0000110
537 Ga0496105_0156363
538 Ga0496106_0000015
539 Ga0496106_0000059
540 Ga0496106_0000065
541 Ga0496107_0000018
542 Ga0496107_0000026
543 Ga0496108_0000025
544 Ga0496108_0000032
545 Ga0496108_0000163
546 Ga0496108_0003965
547 Ga0496109_0000155
548 Ga0496109_0000217
549 Ga0496109_0018444
550 Ga0496109_0133754
551 Ga0496110_0000003
552 Ga0496110_0024180
553 Ga0496111_0000058
554 Ga0496112_0000003
555 Ga0496112_0018107
556 Ga0496112_0164168
557 Ga0496113_0000207
558 Ga0496113_0004573
559 Ga0496113_0024590
560 Ga0496114_0000042
561 Ga0496115_0000005
562 Ga0496115_0003718
563 Ga0496116_0000814
564 Ga0496117_0004504
565 Ga0496118_0020448
566 Ga0496119_0013624
567 Ga0496119_0033454
568 Ga0496120_0007159
569 Ga0496121_0016519
570 Ga0496121_0046575
571 Ga0496125_0017662
572 Ga0496125_0103042
573 Ga0496126_0048028
574 Ga0501032_0010588
575 Ga0501033_0001259
576 Ga0501034_0047454
577 Ga0501036_0000290
578 Ga0501038_0001257
579 Ga0501043_0011637
580 Ga0501046_0001423
581 Ga0501047_0005727
582 Ga0501047_0059585
583 Ga0501048_0000843
584 Ga0501070_0014448
585 Ga0501073_0008515
586 Ga0501074_0072047
587 Ga0501075_0013457
588 Ga0501083_0040180
589 Ga0501035_0000368
590 Ga0501044_0025351
591 nmdc:mga0a205_19_c2
592 Ga0495601_0000061
593 Ga0495601_0000090
594 Ga0495601_0008741
595 Ga0495601_0023865
596 Ga0495612_0000116
597 Ga0495612_0001063
598 Ga0495655_0000003
599 Ga0495655_0000816
600 Ga0495595_0000083
601 Ga0495619_0000015
602 Ga0495619_0000869
603 Ga0495619_0001450
604 Ga0495619_0002049
605 Ga0495619_0020518
606 Ga0500641_0006228
607 Ga0500628_000002
608 Ga0501082_0008494

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00361

Proton_antipo_M

Proton-conducting membrane transporter

123

423

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aqq-assembly1.cif.gz_M cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.897 2 265
7aqq-assembly1.cif.gz_M cryo-em structure of arabidopsis thaliana complex-i (membrane core) 0.884 2 265
7wg5-assembly1.cif.gz_F cyclic electron transport supercomplex ndh-psi from arabidopsis 0.8543 3 431
6i1p-assembly2.cif.gz_U respiratory complex i from thermus thermophilus with bound nadh 0.8515 1 464
6zjy-assembly1.cif.gz_M respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.8465 1 467
ID Description Score Start End Superfamily
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9305 2 120 1.20.1070.10
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9232 3 121 1.20.1070.10
af_P0AFE8_1_132_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8835 2 120 1.20.1070.10
af_P26288_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8489 2 120 1.20.1070.10
af_M1FQK6_1_136_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8082 3 121 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7W1UQ06-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9449 2 133 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A2V7J423-F1-model_v4 NADH:quinone oxidoreductase/Mrp antiporter membrane subunit domain-containing protein 0.9391 2 291 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A528B264-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9387 2 302 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A4Q5QT70-F1-model_v4 NADH-quinone oxidoreductase subunit M 0.9384 2 246 GO:0003954
GO:0008137
GO:0012505
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A379CYL0-F1-model_v4 deleted 0.9368 2 294

Map