F397804
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 185 | 608 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300049705|Ga0501225_0022098|Ga0501225_0022098_197_1576 |
| Length | 459 |
| Sequence | MGITRYEQTNPLMTGWQPTKSNALNLWSYPNPNKFWYVSCKKDFDSLLAENFSHFKKSLEQMKLKGLNRRTFLRNVGLATAAHVVGCTKVIPELAALTSSNTYANTVSNNPGKNKLPKWKGFNIPDYFQPDPWYVGAPTPEEYFKWVADWGFDFIRLPVAYPNYLNLTPHQKFITAEDVYKIDESRVTKIEQTIYLAQKYNLHVSLNLHRAPGYCVSNGYNEPYNLWNEKNAQDAFYYHWSFWAKRFKNVSTSKISFDLVNEPCYRENVNDTMSKTTAVPGSTYHKVAKAATGVIRKENPNFYVIAEGNLGDAAPELADLNIGQSCRGYYPYEISHYKAPWVYPDPAYQPKPLWPGNMGGKYYNREVMSAYYKPWIDLVNKGVGVHCGECGCWKQTPHDVFLAWFGDVLDILTTNGIGFALWELKGDFGILNSNRSDIQYEDWYGHKLDRKLLKLLQSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 127 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 128 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 129 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 133 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 134 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 135 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 136 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 137 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 138 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 139 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 140 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 141 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 142 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 145 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 146 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 149 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 158 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 159 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 160 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 161 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 162 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 163 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 164 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 165 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 166 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 167 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 168 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 169 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 174 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 175 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 176 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 177 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 178 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 179 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 180 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 181 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 182 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 183 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 184 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 185 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 0 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.58 |
| Nodule | 0 |
| Rhizoplane | 0.99 |
| Rhizosphere | 82.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501225_0022098 | 3300049705 | Bacteria | 1756 |
| 2 | SwRhRL2b_contig_2522128 | 2162886007 | Bacteria | 3297 |
| 3 | JGI24740J21852_10000108 | 3300001979 | Bacteria | 29714 |
| 4 | JGI25154J39366_1000004 | 3300002738 | Bacteria | 346460 |
| 5 | JGI25157J39369_1003619 | 3300002741 | Bacteria | 3076 |
| 6 | JGI25153J46596_10002060 | 3300003215 | Bacteria | 11850 |
| 7 | rootH1_10035121 | 3300003316 | Bacteria | 9303 |
| 8 | rootH1_10070971 | 3300003316 | Bacteria | 3560 |
| 9 | rootH1_10175372 | 3300003316 | Bacteria | 1583 |
| 10 | rootH2_10292954 | 3300003320 | Bacteria | 2015 |
| 11 | rootL2_10012549 | 3300003322 | Bacteria | 2624 |
| 12 | rootL2_10055799 | 3300003322 | Bacteria | 4770 |
| 13 | rootL2_10129508 | 3300003322 | Bacteria | 3564 |
| 14 | rootL2_10325471 | 3300003322 | Bacteria | 1976 |
| 15 | rootH1_10011869 | 3300003323 | Bacteria | 39408 |
| 16 | rootH1_10065858 | 3300003323 | Bacteria | 8881 |
| 17 | rootH1_10217057 | 3300003323 | Bacteria | 3724 |
| 18 | JGI25160J50197_1002908 | 3300003354 | Bacteria | 7841 |
| 19 | Ga0055530_10022727 | 3300003791 | Bacteria | 1818 |
| 20 | Ga0065165_1026255 | 3300005262 | Bacteria | 1919 |
| 21 | Ga0065704_10072542 | 3300005289 | Bacteria | 8350 |
| 22 | Ga0070658_10068374 | 3300005327 | Bacteria | 2904 |
| 23 | Ga0070683_100005960 | 3300005329 | Bacteria | 10202 |
| 24 | Ga0070683_100051391 | 3300005329 | Bacteria | 3816 |
| 25 | Ga0068869_100001858 | 3300005334 | Bacteria | 12698 |
| 26 | Ga0068869_100022746 | 3300005334 | Unclassified | 4323 |
| 27 | Ga0070666_10010511 | 3300005335 | Bacteria | 5791 |
| 28 | Ga0070666_10017296 | 3300005335 | Unclassified | 4621 |
| 29 | Ga0070666_10029242 | 3300005335 | Unclassified | 3620 |
| 30 | Ga0070680_100116515 | 3300005336 | Bacteria | 2227 |
| 31 | Ga0068868_100015432 | 3300005338 | Bacteria | 5649 |
| 32 | Ga0070660_100016195 | 3300005339 | Bacteria | 5406 |
| 33 | Ga0070661_100000443 | 3300005344 | Bacteria | 31823 |
| 34 | Ga0070661_100024200 | 3300005344 | Bacteria | 4355 |
| 35 | Ga0070669_100083954 | 3300005353 | Unclassified | 2376 |
| 36 | Ga0070669_100119546 | 3300005353 | Bacteria | 2008 |
| 37 | Ga0070671_100311497 | 3300005355 | Unclassified | 1341 |
| 38 | Ga0070674_100118095 | 3300005356 | Bacteria | 1959 |
| 39 | Ga0070673_100053537 | 3300005364 | Unclassified | 3170 |
| 40 | Ga0070659_100024073 | 3300005366 | Bacteria | 4665 |
| 41 | Ga0070667_100043716 | 3300005367 | Unclassified | 3761 |
| 42 | Ga0070678_100028760 | 3300005456 | Unclassified | 3796 |
| 43 | Ga0070662_100088937 | 3300005457 | Bacteria | 2316 |
| 44 | Ga0070662_100107917 | 3300005457 | Bacteria | 2117 |
| 45 | Ga0070681_10071658 | 3300005458 | Bacteria | 3430 |
| 46 | Ga0070698_100032388 | 3300005471 | Bacteria | 5415 |
| 47 | Ga0070679_100128266 | 3300005530 | Bacteria | 2518 |
| 48 | Ga0070679_100158482 | 3300005530 | Bacteria | 2237 |
| 49 | Ga0070684_100000659 | 3300005535 | Bacteria | 23833 |
| 50 | Ga0068853_100024606 | 3300005539 | Bacteria | 5051 |
| 51 | Ga0068853_100039239 | 3300005539 | Bacteria | 4038 |
| 52 | Ga0068853_100092986 | 3300005539 | Unclassified | 2654 |
| 53 | Ga0070686_100069671 | 3300005544 | Bacteria | 2298 |
| 54 | Ga0070693_100057656 | 3300005547 | Bacteria | 2246 |
| 55 | Ga0070665_100147618 | 3300005548 | Bacteria | 2354 |
| 56 | Ga0068855_100005466 | 3300005563 | Bacteria | 15501 |
| 57 | Ga0068855_100009045 | 3300005563 | Bacteria | 12036 |
| 58 | Ga0068855_100064068 | 3300005563 | Unclassified | 4287 |
| 59 | Ga0068855_100074269 | 3300005563 | Bacteria | 3949 |
| 60 | Ga0070664_100000126 | 3300005564 | Bacteria | 51280 |
| 61 | Ga0070664_100031608 | 3300005564 | Bacteria | 4424 |
| 62 | Ga0068857_100009963 | 3300005577 | Bacteria | 8251 |
| 63 | Ga0068857_100039736 | 3300005577 | Bacteria | 4169 |
| 64 | Ga0068857_100188931 | 3300005577 | Bacteria | 1876 |
| 65 | Ga0068856_100009293 | 3300005614 | Bacteria | 9549 |
| 66 | Ga0068856_100065342 | 3300005614 | Bacteria | 3595 |
| 67 | Ga0070702_100123586 | 3300005615 | Bacteria | 1624 |
| 68 | Ga0068852_100000290 | 3300005616 | Bacteria | 33743 |
| 69 | Ga0068852_100023510 | 3300005616 | Bacteria | 4962 |
| 70 | Ga0068852_100074349 | 3300005616 | Bacteria | 2993 |
| 71 | Ga0068852_100076578 | 3300005616 | Bacteria | 2954 |
| 72 | Ga0068852_100139750 | 3300005616 | Unclassified | 2240 |
| 73 | Ga0068866_10025880 | 3300005718 | Unclassified | 2765 |
| 74 | Ga0068851_10045640 | 3300005834 | Bacteria | 2215 |
| 75 | Ga0068863_100012636 | 3300005841 | Bacteria | 8146 |
| 76 | Ga0068858_100279469 | 3300005842 | Unclassified | 1590 |
| 77 | Ga0068860_100007086 | 3300005843 | Bacteria | 11215 |
| 78 | Ga0068860_100018822 | 3300005843 | Bacteria | 6709 |
| 79 | Ga0068862_100089732 | 3300005844 | Bacteria | 2675 |
| 80 | Ga0081539_10000223 | 3300005985 | Bacteria | 133106 |
| 81 | Ga0075366_10013912 | 3300006195 | Bacteria | 4587 |
| 82 | Ga0075366_10023332 | 3300006195 | Bacteria | 3604 |
| 83 | Ga0097621_100000459 | 3300006237 | Bacteria | 28552 |
| 84 | Ga0068871_100000069 | 3300006358 | Bacteria | 57310 |
| 85 | Ga0068871_100096364 | 3300006358 | Bacteria | 2471 |
| 86 | Ga0075429_100074075 | 3300006880 | Bacteria | 2966 |
| 87 | Ga0068865_100033593 | 3300006881 | Unclassified | 3435 |
| 88 | Ga0105240_10000445 | 3300009093 | Bacteria | 76036 |
| 89 | Ga0105240_10461222 | 3300009093 | Bacteria | 1420 |
| 90 | Ga0111539_10030005 | 3300009094 | Bacteria | 6615 |
| 91 | Ga0114129_10001760 | 3300009147 | Bacteria | 29505 |
| 92 | Ga0114129_10102445 | 3300009147 | Bacteria | 3959 |
| 93 | Ga0105241_10006101 | 3300009174 | Bacteria | 8883 |
| 94 | Ga0105241_10013478 | 3300009174 | Bacteria | 5992 |
| 95 | Ga0105242_10059072 | 3300009176 | Unclassified | 3146 |
| 96 | Ga0105242_10092203 | 3300009176 | Unclassified | 2552 |
| 97 | Ga0105237_10014679 | 3300009545 | Bacteria | 8180 |
| 98 | Ga0105238_10000449 | 3300009551 | Bacteria | 43175 |
| 99 | Ga0105249_10293224 | 3300009553 | Bacteria | 1629 |
| 100 | Ga0105239_10000746 | 3300010375 | Bacteria | 46202 |
| 101 | Ga0105239_10002476 | 3300010375 | Bacteria | 23542 |
| 102 | Ga0105239_10178487 | 3300010375 | Bacteria | 2376 |
| 103 | Ga0105246_10014680 | 3300011119 | Bacteria | 4930 |
| 104 | Ga0157373_10032434 | 3300013100 | Bacteria | 3760 |
| 105 | Ga0157371_10101093 | 3300013102 | Bacteria | 2045 |
| 106 | Ga0157371_10126891 | 3300013102 | Unclassified | 1815 |
| 107 | Ga0157370_10073081 | 3300013104 | Bacteria | 3235 |
| 108 | Ga0157369_10027792 | 3300013105 | Bacteria | 6266 |
| 109 | Ga0157374_10049702 | 3300013296 | Bacteria | 3896 |
| 110 | Ga0157374_10144351 | 3300013296 | Unclassified | 2312 |
| 111 | Ga0157378_10029159 | 3300013297 | Bacteria | 4871 |
| 112 | Ga0157378_10069533 | 3300013297 | Bacteria | 3159 |
| 113 | Ga0157378_10072950 | 3300013297 | Bacteria | 3085 |
| 114 | Ga0157378_10245566 | 3300013297 | Unclassified | 1712 |
| 115 | Ga0163162_10000170 | 3300013306 | Bacteria | 60233 |
| 116 | Ga0163162_10000350 | 3300013306 | Bacteria | 41929 |
| 117 | Ga0163162_10077625 | 3300013306 | Bacteria | 3385 |
| 118 | Ga0163162_10132977 | 3300013306 | Bacteria | 2597 |
| 119 | Ga0163162_10538424 | 3300013306 | Bacteria | 1296 |
| 120 | Ga0157372_10196013 | 3300013307 | Unclassified | 2340 |
| 121 | Ga0157372_10399568 | 3300013307 | Bacteria | 1601 |
| 122 | Ga0157375_10000517 | 3300013308 | Bacteria | 34801 |
| 123 | Ga0157375_10233751 | 3300013308 | Unclassified | 1997 |
| 124 | Ga0163163_10060855 | 3300014325 | Unclassified | 3740 |
| 125 | Ga0157380_10217018 | 3300014326 | Bacteria | 1709 |
| 126 | Ga0157377_10046308 | 3300014745 | Bacteria | 2432 |
| 127 | Ga0157377_10116239 | 3300014745 | Bacteria | 1615 |
| 128 | Ga0157377_10131873 | 3300014745 | Bacteria | 1527 |
| 129 | Ga0157379_10017632 | 3300014968 | Bacteria | 6287 |
| 130 | Ga0157376_10001292 | 3300014969 | Bacteria | 16487 |
| 131 | Ga0163161_10008885 | 3300017792 | Bacteria | 6946 |
| 132 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 133 | Ga0209026_1000097 | 3300025250 | Bacteria | 163212 |
| 134 | Ga0209050_1001839 | 3300025298 | Bacteria | 20589 |
| 135 | Ga0207426_1000220 | 3300025302 | Bacteria | 134979 |
| 136 | Ga0207680_10016627 | 3300025903 | Bacteria | 3868 |
| 137 | Ga0207680_10028193 | 3300025903 | Bacteria | 3138 |
| 138 | Ga0207680_10039240 | 3300025903 | Unclassified | 2746 |
| 139 | Ga0207645_10001454 | 3300025907 | Bacteria | 19356 |
| 140 | Ga0207707_10141517 | 3300025912 | Bacteria | 2103 |
| 141 | Ga0207695_10001116 | 3300025913 | Bacteria | 46659 |
| 142 | Ga0207695_10100074 | 3300025913 | Bacteria | 2895 |
| 143 | Ga0207671_10003307 | 3300025914 | Bacteria | 16203 |
| 144 | Ga0207662_10101907 | 3300025918 | Unclassified | 1780 |
| 145 | Ga0207657_10002187 | 3300025919 | Bacteria | 21179 |
| 146 | Ga0207649_10015613 | 3300025920 | Bacteria | 4265 |
| 147 | Ga0207649_10185161 | 3300025920 | Bacteria | 1460 |
| 148 | Ga0207681_10088759 | 3300025923 | Bacteria | 2203 |
| 149 | Ga0207681_10144839 | 3300025923 | Bacteria | 1774 |
| 150 | Ga0207694_10019375 | 3300025924 | Bacteria | 5144 |
| 151 | Ga0207650_10021037 | 3300025925 | Bacteria | 4609 |
| 152 | Ga0207659_10126180 | 3300025926 | Bacteria | 1968 |
| 153 | Ga0207690_10161791 | 3300025932 | Bacteria | 1669 |
| 154 | Ga0207686_10070387 | 3300025934 | Bacteria | 2248 |
| 155 | Ga0207670_10198246 | 3300025936 | Bacteria | 1524 |
| 156 | Ga0207669_10185994 | 3300025937 | Unclassified | 1494 |
| 157 | Ga0207704_10036475 | 3300025938 | Unclassified | 2830 |
| 158 | Ga0207691_10012392 | 3300025940 | Bacteria | 8172 |
| 159 | Ga0207689_10004733 | 3300025942 | Bacteria | 12271 |
| 160 | Ga0207689_10008375 | 3300025942 | Bacteria | 9005 |
| 161 | Ga0207661_10006567 | 3300025944 | Bacteria | 8226 |
| 162 | Ga0207679_10000251 | 3300025945 | Bacteria | 40884 |
| 163 | Ga0207667_10001182 | 3300025949 | Bacteria | 32810 |
| 164 | Ga0207667_10008930 | 3300025949 | Bacteria | 11857 |
| 165 | Ga0207667_10031549 | 3300025949 | Bacteria | 5719 |
| 166 | Ga0207651_10013761 | 3300025960 | Unclassified | 4644 |
| 167 | Ga0207668_10046197 | 3300025972 | Unclassified | 2974 |
| 168 | Ga0207640_10036772 | 3300025981 | Bacteria | 3077 |
| 169 | Ga0207640_10168015 | 3300025981 | Bacteria | 1631 |
| 170 | Ga0207658_10016681 | 3300025986 | Bacteria | 5055 |
| 171 | Ga0207658_10202614 | 3300025986 | Bacteria | 1658 |
| 172 | Ga0207703_10182010 | 3300026035 | Unclassified | 1855 |
| 173 | Ga0207639_10023119 | 3300026041 | Bacteria | 4485 |
| 174 | Ga0207639_10041238 | 3300026041 | Unclassified | 3452 |
| 175 | Ga0207639_10136893 | 3300026041 | Bacteria | 2035 |
| 176 | Ga0207678_10078296 | 3300026067 | Bacteria | 2831 |
| 177 | Ga0207702_10063039 | 3300026078 | Unclassified | 3169 |
| 178 | Ga0207702_10090079 | 3300026078 | Bacteria | 2684 |
| 179 | Ga0207641_10064351 | 3300026088 | Unclassified | 3134 |
| 180 | Ga0207648_10026557 | 3300026089 | Bacteria | 5144 |
| 181 | Ga0207676_10254422 | 3300026095 | Bacteria | 1583 |
| 182 | Ga0207674_10011920 | 3300026116 | Bacteria | 9747 |
| 183 | Ga0207674_10034994 | 3300026116 | Bacteria | 5244 |
| 184 | Ga0207674_10095286 | 3300026116 | Bacteria | 2962 |
| 185 | Ga0207674_10327138 | 3300026116 | Bacteria | 1482 |
| 186 | Ga0207683_10001445 | 3300026121 | Bacteria | 21485 |
| 187 | Ga0207698_10026513 | 3300026142 | Bacteria | 4101 |
| 188 | Ga0207698_10069088 | 3300026142 | Bacteria | 2792 |
| 189 | Ga0207698_10134015 | 3300026142 | Unclassified | 2122 |
| 190 | Ga0207698_10147043 | 3300026142 | Bacteria | 2040 |
| 191 | Ga0268264_10011914 | 3300028381 | Bacteria | 7162 |
| 192 | Ga0268264_10022665 | 3300028381 | Bacteria | 5125 |
| 193 | Ga0307515_10000071 | 3300028794 | Bacteria | 238152 |
| 194 | Ga0265327_10000048 | 3300031251 | Bacteria | 269173 |
| 195 | Ga0265327_10036065 | 3300031251 | Bacteria | 2723 |
| 196 | Ga0265316_10003180 | 3300031344 | Bacteria | 16707 |
| 197 | Ga0265316_10135608 | 3300031344 | Bacteria | 1852 |
| 198 | Ga0307513_10035609 | 3300031456 | Bacteria | 5566 |
| 199 | Ga0307513_10059296 | 3300031456 | Bacteria | 4063 |
| 200 | Ga0307513_10089284 | 3300031456 | Unclassified | 3147 |
| 201 | Ga0307509_10113997 | 3300031507 | Bacteria | 2699 |
| 202 | Ga0307509_10207032 | 3300031507 | Bacteria | 1791 |
| 203 | Ga0316576_10128768 | 3300031727 | Bacteria | 1904 |
| 204 | Ga0307516_10173763 | 3300031730 | Bacteria | 1893 |
| 205 | Ga0307416_100001118 | 3300032002 | Bacteria | 14418 |
| 206 | Ga0307415_100010971 | 3300032126 | Bacteria | 5159 |
| 207 | Ga0316585_10013626 | 3300032137 | Unclassified | 2422 |
| 208 | Ga0316584_0150867 | 3300036712 | Unclassified | 1730 |
| 209 | Ga0400483_136188 | 3300039062 | Bacteria | 3245 |
| 210 | Ga0439436_0001324 | 3300041404 | Bacteria | 7106 |
| 211 | Ga0451853_0772990 | 3300041512 | Bacteria | 2741 |
| 212 | Ga0451853_1331847 | 3300041512 | Bacteria | 2492 |
| 213 | Ga0451853_2149495 | 3300041512 | Bacteria | 2857 |
| 214 | Ga0439449_0041090 | 3300042007 | Bacteria | 1719 |
| 215 | Ga0439457_001189 | 3300042014 | Bacteria | 7833 |
| 216 | Ga0439457_004669 | 3300042014 | Bacteria | 3544 |
| 217 | Ga0451577_0000022 | 3300042876 | Bacteria | 437063 |
| 218 | Ga0451577_0013792 | 3300042876 | Bacteria | 7552 |
| 219 | Ga0451577_0034004 | 3300042876 | Bacteria | 4597 |
| 220 | Ga0451577_0118864 | 3300042876 | Bacteria | 2367 |
| 221 | Ga0451577_0121876 | 3300042876 | Bacteria | 2336 |
| 222 | Ga0451577_0132200 | 3300042876 | Bacteria | 2239 |
| 223 | Ga0466969_0000045 | 3300044656 | Bacteria | 64246 |
| 224 | Ga0466969_0005073 | 3300044656 | Bacteria | 7005 |
| 225 | Ga0466972_0000075 | 3300044658 | Bacteria | 94290 |
| 226 | Ga0466972_0011523 | 3300044658 | Bacteria | 4437 |
| 227 | Ga0466972_0095151 | 3300044658 | Bacteria | 1411 |
| 228 | Ga0453683_0000516 | 3300044673 | Bacteria | 43632 |
| 229 | Ga0453683_0000639 | 3300044673 | Bacteria | 37874 |
| 230 | Ga0453683_0099162 | 3300044673 | Unclassified | 1829 |
| 231 | Ga0466966_0000131 | 3300044684 | Bacteria | 48304 |
| 232 | Ga0466966_0000446 | 3300044684 | Bacteria | 26590 |
| 233 | Ga0453684_0000288 | 3300044712 | Bacteria | 216718 |
| 234 | Ga0453684_0000353 | 3300044712 | Bacteria | 191059 |
| 235 | Ga0453684_0000607 | 3300044712 | Bacteria | 131953 |
| 236 | Ga0453684_0000651 | 3300044712 | Bacteria | 125123 |
| 237 | Ga0453684_0001141 | 3300044712 | Bacteria | 82874 |
| 238 | Ga0453684_0026769 | 3300044712 | Bacteria | 8309 |
| 239 | Ga0453684_0037979 | 3300044712 | Bacteria | 6596 |
| 240 | Ga0453684_0046092 | 3300044712 | Bacteria | 5804 |
| 241 | Ga0453684_0107300 | 3300044712 | Bacteria | 3401 |
| 242 | Ga0453684_0142270 | 3300044712 | Bacteria | 2862 |
| 243 | Ga0453684_0143044 | 3300044712 | Bacteria | 2852 |
| 244 | Ga0453684_0166623 | 3300044712 | Bacteria | 2600 |
| 245 | Ga0453684_0272032 | 3300044712 | Bacteria | 1935 |
| 246 | Ga0466957_0000479 | 3300044842 | Bacteria | 19861 |
| 247 | Ga0466957_0025508 | 3300044842 | Bacteria | 3504 |
| 248 | Ga0466959_0000003 | 3300045049 | Bacteria | 285164 |
| 249 | Ga0466959_0000062 | 3300045049 | Bacteria | 75615 |
| 250 | Ga0451576_0000044 | 3300045051 | Bacteria | 334467 |
| 251 | Ga0451576_0000080 | 3300045051 | Bacteria | 242782 |
| 252 | Ga0451576_0000760 | 3300045051 | Bacteria | 63689 |
| 253 | Ga0451576_0006009 | 3300045051 | Bacteria | 15007 |
| 254 | Ga0451576_0011780 | 3300045051 | Bacteria | 9903 |
| 255 | Ga0451576_0026540 | 3300045051 | Bacteria | 6230 |
| 256 | Ga0451576_0215940 | 3300045051 | Bacteria | 2003 |
| 257 | Ga0451576_0249626 | 3300045051 | Bacteria | 1854 |
| 258 | Ga0466967_0088460 | 3300045976 | Unclassified | 2811 |
| 259 | Ga0495638_0000004 | 3300046460 | Bacteria | 700795 |
| 260 | Ga0495672_0070006 | 3300047320 | Bacteria | 1989 |
| 261 | Ga0496110_0186040 | 3300048913 | Bacteria | 1886 |
| 262 | Ga0496111_0213961 | 3300048914 | Bacteria | 1432 |
| 263 | Ga0496115_0170855 | 3300048918 | Bacteria | 1798 |
| 264 | Ga0501034_0100065 | 3300049571 | Bacteria | 2893 |
| 265 | Ga0501037_0171521 | 3300049573 | Bacteria | 1542 |
| 266 | Ga0501047_0032660 | 3300049581 | Bacteria | 5026 |
| 267 | Ga0501047_0057550 | 3300049581 | Bacteria | 3759 |
| 268 | Ga0501047_0100706 | 3300049581 | Bacteria | 2769 |
| 269 | Ga0501047_0152027 | 3300049581 | Bacteria | 2190 |
| 270 | Ga0501198_007402 | 3300049649 | Unclassified | 1580 |
| 271 | Ga0501202_000059 | 3300049652 | Bacteria | 11324 |
| 272 | Ga0501207_002958 | 3300049654 | Unclassified | 2223 |
| 273 | Ga0501217_007276 | 3300049661 | Unclassified | 2368 |
| 274 | Ga0501223_001295 | 3300049663 | Bacteria | 5802 |
| 275 | Ga0501223_002995 | 3300049663 | Bacteria | 3706 |
| 276 | Ga0501228_000418 | 3300049666 | Bacteria | 2697 |
| 277 | Ga0501235_012602 | 3300049669 | Unclassified | 1860 |
| 278 | Ga0501242_004216 | 3300049674 | Bacteria | 1591 |
| 279 | Ga0501246_001226 | 3300049676 | Bacteria | 1947 |
| 280 | Ga0501257_029828 | 3300049686 | Unclassified | 1311 |
| 281 | Ga0501259_000154 | 3300049688 | Bacteria | 10343 |
| 282 | Ga0501245_001912 | 3300049708 | Bacteria | 2745 |
| 283 | Ga0501044_0008746 | 3300049823 | Bacteria | 11078 |
| 284 | nmdc:mga0k408_60047_c1 | 3300050493 | Bacteria | 2209 |
| 285 | nmdc:mga05p37_17351_c1 | 3300050507 | Bacteria | 7492 |
| 286 | nmdc:mga05p37_1961_c1 | 3300050507 | Bacteria | 23994 |
| 287 | nmdc:mga09592_88128_c1 | 3300050508 | Bacteria | 2650 |
| 288 | Ga0500578_0000091 | 3300053086 | Bacteria | 102427 |
| 289 | Ga0500644_0028648 | 3300053088 | Bacteria | 1744 |
| 290 | Ga0500583_0000011 | 3300053092 | Bacteria | 160380 |
| 291 | Ga0500583_0000290 | 3300053092 | Bacteria | 17375 |
| 292 | Ga0500651_0175778 | 3300053093 | Bacteria | 1274 |
| 293 | Ga0500556_0016615 | 3300053104 | Bacteria | 2292 |
| 294 | Ga0500616_0000015 | 3300053153 | Bacteria | 633259 |
| 295 | Ga0500622_0003889 | 3300053156 | Bacteria | 9676 |
| 296 | Ga0500622_0006439 | 3300053156 | Bacteria | 6808 |
| 297 | Ga0500622_0021063 | 3300053156 | Bacteria | 3461 |
| 298 | Ga0500622_0039775 | 3300053156 | Bacteria | 2451 |
| 299 | 2522551675 | 2522125168 | Bacteria | 7376607 |
| 300 | 2738724844 | 2738541278 | Bacteria | 9755573 |
| 301 | 2896088990 | 2896085136 | Bacteria | 6129793 |
| 302 | 2896114927 | 2896109856 | Bacteria | 7140722 |
| 303 | 2929927374 | 2929921140 | Bacteria | 8649150 |
| 304 | 8003151250 | 8003151029 | Bacteria | 8187759 |
| 305 | Ga0501225_0022098 | |||
| 306 | SwRhRL2b_contig_2522128 | |||
| 307 | JGI24740J21852_10000108 | |||
| 308 | JGI25154J39366_1000004 | |||
| 309 | JGI25157J39369_1003619 | |||
| 310 | JGI25153J46596_10002060 | |||
| 311 | rootH1_10035121 | |||
| 312 | rootH1_10070971 | |||
| 313 | rootH1_10175372 | |||
| 314 | rootH2_10292954 | |||
| 315 | rootL2_10012549 | |||
| 316 | rootL2_10055799 | |||
| 317 | rootL2_10129508 | |||
| 318 | rootL2_10325471 | |||
| 319 | rootH1_10011869 | |||
| 320 | rootH1_10065858 | |||
| 321 | rootH1_10217057 | |||
| 322 | JGI25160J50197_1002908 | |||
| 323 | Ga0055530_10022727 | |||
| 324 | Ga0065165_1026255 | |||
| 325 | Ga0065704_10072542 | |||
| 326 | Ga0070658_10068374 | |||
| 327 | Ga0070683_100005960 | |||
| 328 | Ga0070683_100051391 | |||
| 329 | Ga0068869_100001858 | |||
| 330 | Ga0068869_100022746 | |||
| 331 | Ga0070666_10010511 | |||
| 332 | Ga0070666_10017296 | |||
| 333 | Ga0070666_10029242 | |||
| 334 | Ga0070680_100116515 | |||
| 335 | Ga0068868_100015432 | |||
| 336 | Ga0070660_100016195 | |||
| 337 | Ga0070661_100000443 | |||
| 338 | Ga0070661_100024200 | |||
| 339 | Ga0070669_100083954 | |||
| 340 | Ga0070669_100119546 | |||
| 341 | Ga0070671_100311497 | |||
| 342 | Ga0070674_100118095 | |||
| 343 | Ga0070673_100053537 | |||
| 344 | Ga0070659_100024073 | |||
| 345 | Ga0070667_100043716 | |||
| 346 | Ga0070678_100028760 | |||
| 347 | Ga0070662_100088937 | |||
| 348 | Ga0070662_100107917 | |||
| 349 | Ga0070681_10071658 | |||
| 350 | Ga0070698_100032388 | |||
| 351 | Ga0070679_100128266 | |||
| 352 | Ga0070679_100158482 | |||
| 353 | Ga0070684_100000659 | |||
| 354 | Ga0068853_100024606 | |||
| 355 | Ga0068853_100039239 | |||
| 356 | Ga0068853_100092986 | |||
| 357 | Ga0070686_100069671 | |||
| 358 | Ga0070693_100057656 | |||
| 359 | Ga0070665_100147618 | |||
| 360 | Ga0068855_100005466 | |||
| 361 | Ga0068855_100009045 | |||
| 362 | Ga0068855_100064068 | |||
| 363 | Ga0068855_100074269 | |||
| 364 | Ga0070664_100000126 | |||
| 365 | Ga0070664_100031608 | |||
| 366 | Ga0068857_100009963 | |||
| 367 | Ga0068857_100039736 | |||
| 368 | Ga0068857_100188931 | |||
| 369 | Ga0068856_100009293 | |||
| 370 | Ga0068856_100065342 | |||
| 371 | Ga0070702_100123586 | |||
| 372 | Ga0068852_100000290 | |||
| 373 | Ga0068852_100023510 | |||
| 374 | Ga0068852_100074349 | |||
| 375 | Ga0068852_100076578 | |||
| 376 | Ga0068852_100139750 | |||
| 377 | Ga0068866_10025880 | |||
| 378 | Ga0068851_10045640 | |||
| 379 | Ga0068863_100012636 | |||
| 380 | Ga0068858_100279469 | |||
| 381 | Ga0068860_100007086 | |||
| 382 | Ga0068860_100018822 | |||
| 383 | Ga0068862_100089732 | |||
| 384 | Ga0081539_10000223 | |||
| 385 | Ga0075366_10013912 | |||
| 386 | Ga0075366_10023332 | |||
| 387 | Ga0097621_100000459 | |||
| 388 | Ga0068871_100000069 | |||
| 389 | Ga0068871_100096364 | |||
| 390 | Ga0075429_100074075 | |||
| 391 | Ga0068865_100033593 | |||
| 392 | Ga0105240_10000445 | |||
| 393 | Ga0105240_10461222 | |||
| 394 | Ga0111539_10030005 | |||
| 395 | Ga0114129_10001760 | |||
| 396 | Ga0114129_10102445 | |||
| 397 | Ga0105241_10006101 | |||
| 398 | Ga0105241_10013478 | |||
| 399 | Ga0105242_10059072 | |||
| 400 | Ga0105242_10092203 | |||
| 401 | Ga0105237_10014679 | |||
| 402 | Ga0105238_10000449 | |||
| 403 | Ga0105249_10293224 | |||
| 404 | Ga0105239_10000746 | |||
| 405 | Ga0105239_10002476 | |||
| 406 | Ga0105239_10178487 | |||
| 407 | Ga0105246_10014680 | |||
| 408 | Ga0157373_10032434 | |||
| 409 | Ga0157371_10101093 | |||
| 410 | Ga0157371_10126891 | |||
| 411 | Ga0157370_10073081 | |||
| 412 | Ga0157369_10027792 | |||
| 413 | Ga0157374_10049702 | |||
| 414 | Ga0157374_10144351 | |||
| 415 | Ga0157378_10029159 | |||
| 416 | Ga0157378_10069533 | |||
| 417 | Ga0157378_10072950 | |||
| 418 | Ga0157378_10245566 | |||
| 419 | Ga0163162_10000170 | |||
| 420 | Ga0163162_10000350 | |||
| 421 | Ga0163162_10077625 | |||
| 422 | Ga0163162_10132977 | |||
| 423 | Ga0163162_10538424 | |||
| 424 | Ga0157372_10196013 | |||
| 425 | Ga0157372_10399568 | |||
| 426 | Ga0157375_10000517 | |||
| 427 | Ga0157375_10233751 | |||
| 428 | Ga0163163_10060855 | |||
| 429 | Ga0157380_10217018 | |||
| 430 | Ga0157377_10046308 | |||
| 431 | Ga0157377_10116239 | |||
| 432 | Ga0157377_10131873 | |||
| 433 | Ga0157379_10017632 | |||
| 434 | Ga0157376_10001292 | |||
| 435 | Ga0163161_10008885 | |||
| 436 | Ga0209646_1000025 | |||
| 437 | Ga0209026_1000097 | |||
| 438 | Ga0209050_1001839 | |||
| 439 | Ga0207426_1000220 | |||
| 440 | Ga0207680_10016627 | |||
| 441 | Ga0207680_10028193 | |||
| 442 | Ga0207680_10039240 | |||
| 443 | Ga0207645_10001454 | |||
| 444 | Ga0207707_10141517 | |||
| 445 | Ga0207695_10001116 | |||
| 446 | Ga0207695_10100074 | |||
| 447 | Ga0207671_10003307 | |||
| 448 | Ga0207662_10101907 | |||
| 449 | Ga0207657_10002187 | |||
| 450 | Ga0207649_10015613 | |||
| 451 | Ga0207649_10185161 | |||
| 452 | Ga0207681_10088759 | |||
| 453 | Ga0207681_10144839 | |||
| 454 | Ga0207694_10019375 | |||
| 455 | Ga0207650_10021037 | |||
| 456 | Ga0207659_10126180 | |||
| 457 | Ga0207690_10161791 | |||
| 458 | Ga0207686_10070387 | |||
| 459 | Ga0207670_10198246 | |||
| 460 | Ga0207669_10185994 | |||
| 461 | Ga0207704_10036475 | |||
| 462 | Ga0207691_10012392 | |||
| 463 | Ga0207689_10004733 | |||
| 464 | Ga0207689_10008375 | |||
| 465 | Ga0207661_10006567 | |||
| 466 | Ga0207679_10000251 | |||
| 467 | Ga0207667_10001182 | |||
| 468 | Ga0207667_10008930 | |||
| 469 | Ga0207667_10031549 | |||
| 470 | Ga0207651_10013761 | |||
| 471 | Ga0207668_10046197 | |||
| 472 | Ga0207640_10036772 | |||
| 473 | Ga0207640_10168015 | |||
| 474 | Ga0207658_10016681 | |||
| 475 | Ga0207658_10202614 | |||
| 476 | Ga0207703_10182010 | |||
| 477 | Ga0207639_10023119 | |||
| 478 | Ga0207639_10041238 | |||
| 479 | Ga0207639_10136893 | |||
| 480 | Ga0207678_10078296 | |||
| 481 | Ga0207702_10063039 | |||
| 482 | Ga0207702_10090079 | |||
| 483 | Ga0207641_10064351 | |||
| 484 | Ga0207648_10026557 | |||
| 485 | Ga0207676_10254422 | |||
| 486 | Ga0207674_10011920 | |||
| 487 | Ga0207674_10034994 | |||
| 488 | Ga0207674_10095286 | |||
| 489 | Ga0207674_10327138 | |||
| 490 | Ga0207683_10001445 | |||
| 491 | Ga0207698_10026513 | |||
| 492 | Ga0207698_10069088 | |||
| 493 | Ga0207698_10134015 | |||
| 494 | Ga0207698_10147043 | |||
| 495 | Ga0268264_10011914 | |||
| 496 | Ga0268264_10022665 | |||
| 497 | Ga0307515_10000071 | |||
| 498 | Ga0265327_10000048 | |||
| 499 | Ga0265327_10036065 | |||
| 500 | Ga0265316_10003180 | |||
| 501 | Ga0265316_10135608 | |||
| 502 | Ga0307513_10035609 | |||
| 503 | Ga0307513_10059296 | |||
| 504 | Ga0307513_10089284 | |||
| 505 | Ga0307509_10113997 | |||
| 506 | Ga0307509_10207032 | |||
| 507 | Ga0316576_10128768 | |||
| 508 | Ga0307516_10173763 | |||
| 509 | Ga0307416_100001118 | |||
| 510 | Ga0307415_100010971 | |||
| 511 | Ga0316585_10013626 | |||
| 512 | Ga0316584_0150867 | |||
| 513 | Ga0400483_136188 | |||
| 514 | Ga0439436_0001324 | |||
| 515 | Ga0451853_0772990 | |||
| 516 | Ga0451853_1331847 | |||
| 517 | Ga0451853_2149495 | |||
| 518 | Ga0439449_0041090 | |||
| 519 | Ga0439457_001189 | |||
| 520 | Ga0439457_004669 | |||
| 521 | Ga0451577_0000022 | |||
| 522 | Ga0451577_0013792 | |||
| 523 | Ga0451577_0034004 | |||
| 524 | Ga0451577_0118864 | |||
| 525 | Ga0451577_0121876 | |||
| 526 | Ga0451577_0132200 | |||
| 527 | Ga0466969_0000045 | |||
| 528 | Ga0466969_0005073 | |||
| 529 | Ga0466972_0000075 | |||
| 530 | Ga0466972_0011523 | |||
| 531 | Ga0466972_0095151 | |||
| 532 | Ga0453683_0000516 | |||
| 533 | Ga0453683_0000639 | |||
| 534 | Ga0453683_0099162 | |||
| 535 | Ga0466966_0000131 | |||
| 536 | Ga0466966_0000446 | |||
| 537 | Ga0453684_0000288 | |||
| 538 | Ga0453684_0000353 | |||
| 539 | Ga0453684_0000607 | |||
| 540 | Ga0453684_0000651 | |||
| 541 | Ga0453684_0001141 | |||
| 542 | Ga0453684_0026769 | |||
| 543 | Ga0453684_0037979 | |||
| 544 | Ga0453684_0046092 | |||
| 545 | Ga0453684_0107300 | |||
| 546 | Ga0453684_0142270 | |||
| 547 | Ga0453684_0143044 | |||
| 548 | Ga0453684_0166623 | |||
| 549 | Ga0453684_0272032 | |||
| 550 | Ga0466957_0000479 | |||
| 551 | Ga0466957_0025508 | |||
| 552 | Ga0466959_0000003 | |||
| 553 | Ga0466959_0000062 | |||
| 554 | Ga0451576_0000044 | |||
| 555 | Ga0451576_0000080 | |||
| 556 | Ga0451576_0000760 | |||
| 557 | Ga0451576_0006009 | |||
| 558 | Ga0451576_0011780 | |||
| 559 | Ga0451576_0026540 | |||
| 560 | Ga0451576_0215940 | |||
| 561 | Ga0451576_0249626 | |||
| 562 | Ga0466967_0088460 | |||
| 563 | Ga0495638_0000004 | |||
| 564 | Ga0495672_0070006 | |||
| 565 | Ga0496110_0186040 | |||
| 566 | Ga0496111_0213961 | |||
| 567 | Ga0496115_0170855 | |||
| 568 | Ga0501034_0100065 | |||
| 569 | Ga0501037_0171521 | |||
| 570 | Ga0501047_0032660 | |||
| 571 | Ga0501047_0057550 | |||
| 572 | Ga0501047_0100706 | |||
| 573 | Ga0501047_0152027 | |||
| 574 | Ga0501198_007402 | |||
| 575 | Ga0501202_000059 | |||
| 576 | Ga0501207_002958 | |||
| 577 | Ga0501217_007276 | |||
| 578 | Ga0501223_001295 | |||
| 579 | Ga0501223_002995 | |||
| 580 | Ga0501228_000418 | |||
| 581 | Ga0501235_012602 | |||
| 582 | Ga0501242_004216 | |||
| 583 | Ga0501246_001226 | |||
| 584 | Ga0501257_029828 | |||
| 585 | Ga0501259_000154 | |||
| 586 | Ga0501245_001912 | |||
| 587 | Ga0501044_0008746 | |||
| 588 | nmdc:mga0k408_60047_c1 | |||
| 589 | nmdc:mga05p37_17351_c1 | |||
| 590 | nmdc:mga05p37_1961_c1 | |||
| 591 | nmdc:mga09592_88128_c1 | |||
| 592 | Ga0500578_0000091 | |||
| 593 | Ga0500644_0028648 | |||
| 594 | Ga0500583_0000011 | |||
| 595 | Ga0500583_0000290 | |||
| 596 | Ga0500651_0175778 | |||
| 597 | Ga0500556_0016615 | |||
| 598 | Ga0500616_0000015 | |||
| 599 | Ga0500622_0003889 | |||
| 600 | Ga0500622_0006439 | |||
| 601 | Ga0500622_0021063 | |||
| 602 | Ga0500622_0039775 | |||
| 603 | 2522551675 | |||
| 604 | 2738724844 | |||
| 605 | 2896088990 | |||
| 606 | 2896114927 | |||
| 607 | 2929927374 | |||
| 608 | 8003151250 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3w0k-assembly2.cif.gz_B | crystal structure of a glycoside hydrolase | 0.9352 | 31 | 374 |
| 7ec9-assembly1.cif.gz_A | structure of the thermotoga maritima family 5 endo-glucanase in complex with 1-deoxynojiromycin | 0.9332 | 32 | 372 |
| 3w0k-assembly1.cif.gz_A | crystal structure of a glycoside hydrolase | 0.9332 | 31 | 374 |
| 3w0k-assembly2.cif.gz_B | crystal structure of a glycoside hydrolase | 0.9269 | 31 | 374 |
| 3w0k-assembly1.cif.gz_A | crystal structure of a glycoside hydrolase | 0.925 | 31 | 374 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3w0kB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9352 | 31 | 374 | 3.20.20.80 |
| af_Q58211_1_225_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9339 | 96 | 120 | 3.40.50.300 |
| 1vjzA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9335 | 29 | 372 | 3.20.20.80 |
| 1vjzA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9279 | 29 | 372 | 3.20.20.80 |
| 3w0kB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.9269 | 31 | 374 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9F9H5-F1-model_v4 | Glycosyl hydrolase family 5 | 1.004 | 300 | 372 |
GO:0016787
|
| AF-A0A2Z4G8J7-F1-model_v4 | Glycosyl hydrolase family 5 | 0.9934 | 26 | 372 |
GO:0005576
GO:0008422 GO:0009251 GO:0009986 |
| AF-A0A4Q3UHI6-F1-model_v4 | Glycosyl hydrolase family 5 | 0.9917 | 96 | 352 |
GO:0005576
GO:0008422 GO:0009251 GO:0009986 |
| AF-A0A661XWZ1-F1-model_v4 | Glycosyl hydrolase family 5 | 0.991 | 26 | 292 |
GO:0005576
GO:0008422 GO:0009251 GO:0009986 |
| AF-A0A7C3SGV4-F1-model_v4 | Glycoside hydrolase | 0.9874 | 288 | 372 |
GO:0016787
|