F397804

General Info

Members Datasets Scaffolds Average Seq Length
304 185 608 383

Family's Representative Sequence

Representative Sequence 3300049705|Ga0501225_0022098|Ga0501225_0022098_197_1576
Length 459
Sequence MGITRYEQTNPLMTGWQPTKSNALNLWSYPNPNKFWYVSCKKDFDSLLAENFSHFKKSLEQMKLKGLNRRTFLRNVGLATAAHVVGCTKVIPELAALTSSNTYANTVSNNPGKNKLPKWKGFNIPDYFQPDPWYVGAPTPEEYFKWVADWGFDFIRLPVAYPNYLNLTPHQKFITAEDVYKIDESRVTKIEQTIYLAQKYNLHVSLNLHRAPGYCVSNGYNEPYNLWNEKNAQDAFYYHWSFWAKRFKNVSTSKISFDLVNEPCYRENVNDTMSKTTAVPGSTYHKVAKAATGVIRKENPNFYVIAEGNLGDAAPELADLNIGQSCRGYYPYEISHYKAPWVYPDPAYQPKPLWPGNMGGKYYNREVMSAYYKPWIDLVNKGVGVHCGECGCWKQTPHDVFLAWFGDVLDILTTNGIGFALWELKGDFGILNSNRSDIQYEDWYGHKLDRKLLKLLQSK

Samples

Sample ID Description Type Environment
1 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
158 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
159 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
160 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
161 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
162 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
163 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
164 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
165 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
166 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
167 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
168 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
175 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
176 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
181 2738541278 Niastella sp. CF465 Isolate Unclassified
182 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
183 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
184 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
185 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.58
Nodule 0
Rhizoplane 0.99
Rhizosphere 82.57
Stem 0
Stem Tuber 0
Unclassified 14.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501225_0022098 3300049705 Bacteria 1756
2 SwRhRL2b_contig_2522128 2162886007 Bacteria 3297
3 JGI24740J21852_10000108 3300001979 Bacteria 29714
4 JGI25154J39366_1000004 3300002738 Bacteria 346460
5 JGI25157J39369_1003619 3300002741 Bacteria 3076
6 JGI25153J46596_10002060 3300003215 Bacteria 11850
7 rootH1_10035121 3300003316 Bacteria 9303
8 rootH1_10070971 3300003316 Bacteria 3560
9 rootH1_10175372 3300003316 Bacteria 1583
10 rootH2_10292954 3300003320 Bacteria 2015
11 rootL2_10012549 3300003322 Bacteria 2624
12 rootL2_10055799 3300003322 Bacteria 4770
13 rootL2_10129508 3300003322 Bacteria 3564
14 rootL2_10325471 3300003322 Bacteria 1976
15 rootH1_10011869 3300003323 Bacteria 39408
16 rootH1_10065858 3300003323 Bacteria 8881
17 rootH1_10217057 3300003323 Bacteria 3724
18 JGI25160J50197_1002908 3300003354 Bacteria 7841
19 Ga0055530_10022727 3300003791 Bacteria 1818
20 Ga0065165_1026255 3300005262 Bacteria 1919
21 Ga0065704_10072542 3300005289 Bacteria 8350
22 Ga0070658_10068374 3300005327 Bacteria 2904
23 Ga0070683_100005960 3300005329 Bacteria 10202
24 Ga0070683_100051391 3300005329 Bacteria 3816
25 Ga0068869_100001858 3300005334 Bacteria 12698
26 Ga0068869_100022746 3300005334 Unclassified 4323
27 Ga0070666_10010511 3300005335 Bacteria 5791
28 Ga0070666_10017296 3300005335 Unclassified 4621
29 Ga0070666_10029242 3300005335 Unclassified 3620
30 Ga0070680_100116515 3300005336 Bacteria 2227
31 Ga0068868_100015432 3300005338 Bacteria 5649
32 Ga0070660_100016195 3300005339 Bacteria 5406
33 Ga0070661_100000443 3300005344 Bacteria 31823
34 Ga0070661_100024200 3300005344 Bacteria 4355
35 Ga0070669_100083954 3300005353 Unclassified 2376
36 Ga0070669_100119546 3300005353 Bacteria 2008
37 Ga0070671_100311497 3300005355 Unclassified 1341
38 Ga0070674_100118095 3300005356 Bacteria 1959
39 Ga0070673_100053537 3300005364 Unclassified 3170
40 Ga0070659_100024073 3300005366 Bacteria 4665
41 Ga0070667_100043716 3300005367 Unclassified 3761
42 Ga0070678_100028760 3300005456 Unclassified 3796
43 Ga0070662_100088937 3300005457 Bacteria 2316
44 Ga0070662_100107917 3300005457 Bacteria 2117
45 Ga0070681_10071658 3300005458 Bacteria 3430
46 Ga0070698_100032388 3300005471 Bacteria 5415
47 Ga0070679_100128266 3300005530 Bacteria 2518
48 Ga0070679_100158482 3300005530 Bacteria 2237
49 Ga0070684_100000659 3300005535 Bacteria 23833
50 Ga0068853_100024606 3300005539 Bacteria 5051
51 Ga0068853_100039239 3300005539 Bacteria 4038
52 Ga0068853_100092986 3300005539 Unclassified 2654
53 Ga0070686_100069671 3300005544 Bacteria 2298
54 Ga0070693_100057656 3300005547 Bacteria 2246
55 Ga0070665_100147618 3300005548 Bacteria 2354
56 Ga0068855_100005466 3300005563 Bacteria 15501
57 Ga0068855_100009045 3300005563 Bacteria 12036
58 Ga0068855_100064068 3300005563 Unclassified 4287
59 Ga0068855_100074269 3300005563 Bacteria 3949
60 Ga0070664_100000126 3300005564 Bacteria 51280
61 Ga0070664_100031608 3300005564 Bacteria 4424
62 Ga0068857_100009963 3300005577 Bacteria 8251
63 Ga0068857_100039736 3300005577 Bacteria 4169
64 Ga0068857_100188931 3300005577 Bacteria 1876
65 Ga0068856_100009293 3300005614 Bacteria 9549
66 Ga0068856_100065342 3300005614 Bacteria 3595
67 Ga0070702_100123586 3300005615 Bacteria 1624
68 Ga0068852_100000290 3300005616 Bacteria 33743
69 Ga0068852_100023510 3300005616 Bacteria 4962
70 Ga0068852_100074349 3300005616 Bacteria 2993
71 Ga0068852_100076578 3300005616 Bacteria 2954
72 Ga0068852_100139750 3300005616 Unclassified 2240
73 Ga0068866_10025880 3300005718 Unclassified 2765
74 Ga0068851_10045640 3300005834 Bacteria 2215
75 Ga0068863_100012636 3300005841 Bacteria 8146
76 Ga0068858_100279469 3300005842 Unclassified 1590
77 Ga0068860_100007086 3300005843 Bacteria 11215
78 Ga0068860_100018822 3300005843 Bacteria 6709
79 Ga0068862_100089732 3300005844 Bacteria 2675
80 Ga0081539_10000223 3300005985 Bacteria 133106
81 Ga0075366_10013912 3300006195 Bacteria 4587
82 Ga0075366_10023332 3300006195 Bacteria 3604
83 Ga0097621_100000459 3300006237 Bacteria 28552
84 Ga0068871_100000069 3300006358 Bacteria 57310
85 Ga0068871_100096364 3300006358 Bacteria 2471
86 Ga0075429_100074075 3300006880 Bacteria 2966
87 Ga0068865_100033593 3300006881 Unclassified 3435
88 Ga0105240_10000445 3300009093 Bacteria 76036
89 Ga0105240_10461222 3300009093 Bacteria 1420
90 Ga0111539_10030005 3300009094 Bacteria 6615
91 Ga0114129_10001760 3300009147 Bacteria 29505
92 Ga0114129_10102445 3300009147 Bacteria 3959
93 Ga0105241_10006101 3300009174 Bacteria 8883
94 Ga0105241_10013478 3300009174 Bacteria 5992
95 Ga0105242_10059072 3300009176 Unclassified 3146
96 Ga0105242_10092203 3300009176 Unclassified 2552
97 Ga0105237_10014679 3300009545 Bacteria 8180
98 Ga0105238_10000449 3300009551 Bacteria 43175
99 Ga0105249_10293224 3300009553 Bacteria 1629
100 Ga0105239_10000746 3300010375 Bacteria 46202
101 Ga0105239_10002476 3300010375 Bacteria 23542
102 Ga0105239_10178487 3300010375 Bacteria 2376
103 Ga0105246_10014680 3300011119 Bacteria 4930
104 Ga0157373_10032434 3300013100 Bacteria 3760
105 Ga0157371_10101093 3300013102 Bacteria 2045
106 Ga0157371_10126891 3300013102 Unclassified 1815
107 Ga0157370_10073081 3300013104 Bacteria 3235
108 Ga0157369_10027792 3300013105 Bacteria 6266
109 Ga0157374_10049702 3300013296 Bacteria 3896
110 Ga0157374_10144351 3300013296 Unclassified 2312
111 Ga0157378_10029159 3300013297 Bacteria 4871
112 Ga0157378_10069533 3300013297 Bacteria 3159
113 Ga0157378_10072950 3300013297 Bacteria 3085
114 Ga0157378_10245566 3300013297 Unclassified 1712
115 Ga0163162_10000170 3300013306 Bacteria 60233
116 Ga0163162_10000350 3300013306 Bacteria 41929
117 Ga0163162_10077625 3300013306 Bacteria 3385
118 Ga0163162_10132977 3300013306 Bacteria 2597
119 Ga0163162_10538424 3300013306 Bacteria 1296
120 Ga0157372_10196013 3300013307 Unclassified 2340
121 Ga0157372_10399568 3300013307 Bacteria 1601
122 Ga0157375_10000517 3300013308 Bacteria 34801
123 Ga0157375_10233751 3300013308 Unclassified 1997
124 Ga0163163_10060855 3300014325 Unclassified 3740
125 Ga0157380_10217018 3300014326 Bacteria 1709
126 Ga0157377_10046308 3300014745 Bacteria 2432
127 Ga0157377_10116239 3300014745 Bacteria 1615
128 Ga0157377_10131873 3300014745 Bacteria 1527
129 Ga0157379_10017632 3300014968 Bacteria 6287
130 Ga0157376_10001292 3300014969 Bacteria 16487
131 Ga0163161_10008885 3300017792 Bacteria 6946
132 Ga0209646_1000025 3300025246 Bacteria 406493
133 Ga0209026_1000097 3300025250 Bacteria 163212
134 Ga0209050_1001839 3300025298 Bacteria 20589
135 Ga0207426_1000220 3300025302 Bacteria 134979
136 Ga0207680_10016627 3300025903 Bacteria 3868
137 Ga0207680_10028193 3300025903 Bacteria 3138
138 Ga0207680_10039240 3300025903 Unclassified 2746
139 Ga0207645_10001454 3300025907 Bacteria 19356
140 Ga0207707_10141517 3300025912 Bacteria 2103
141 Ga0207695_10001116 3300025913 Bacteria 46659
142 Ga0207695_10100074 3300025913 Bacteria 2895
143 Ga0207671_10003307 3300025914 Bacteria 16203
144 Ga0207662_10101907 3300025918 Unclassified 1780
145 Ga0207657_10002187 3300025919 Bacteria 21179
146 Ga0207649_10015613 3300025920 Bacteria 4265
147 Ga0207649_10185161 3300025920 Bacteria 1460
148 Ga0207681_10088759 3300025923 Bacteria 2203
149 Ga0207681_10144839 3300025923 Bacteria 1774
150 Ga0207694_10019375 3300025924 Bacteria 5144
151 Ga0207650_10021037 3300025925 Bacteria 4609
152 Ga0207659_10126180 3300025926 Bacteria 1968
153 Ga0207690_10161791 3300025932 Bacteria 1669
154 Ga0207686_10070387 3300025934 Bacteria 2248
155 Ga0207670_10198246 3300025936 Bacteria 1524
156 Ga0207669_10185994 3300025937 Unclassified 1494
157 Ga0207704_10036475 3300025938 Unclassified 2830
158 Ga0207691_10012392 3300025940 Bacteria 8172
159 Ga0207689_10004733 3300025942 Bacteria 12271
160 Ga0207689_10008375 3300025942 Bacteria 9005
161 Ga0207661_10006567 3300025944 Bacteria 8226
162 Ga0207679_10000251 3300025945 Bacteria 40884
163 Ga0207667_10001182 3300025949 Bacteria 32810
164 Ga0207667_10008930 3300025949 Bacteria 11857
165 Ga0207667_10031549 3300025949 Bacteria 5719
166 Ga0207651_10013761 3300025960 Unclassified 4644
167 Ga0207668_10046197 3300025972 Unclassified 2974
168 Ga0207640_10036772 3300025981 Bacteria 3077
169 Ga0207640_10168015 3300025981 Bacteria 1631
170 Ga0207658_10016681 3300025986 Bacteria 5055
171 Ga0207658_10202614 3300025986 Bacteria 1658
172 Ga0207703_10182010 3300026035 Unclassified 1855
173 Ga0207639_10023119 3300026041 Bacteria 4485
174 Ga0207639_10041238 3300026041 Unclassified 3452
175 Ga0207639_10136893 3300026041 Bacteria 2035
176 Ga0207678_10078296 3300026067 Bacteria 2831
177 Ga0207702_10063039 3300026078 Unclassified 3169
178 Ga0207702_10090079 3300026078 Bacteria 2684
179 Ga0207641_10064351 3300026088 Unclassified 3134
180 Ga0207648_10026557 3300026089 Bacteria 5144
181 Ga0207676_10254422 3300026095 Bacteria 1583
182 Ga0207674_10011920 3300026116 Bacteria 9747
183 Ga0207674_10034994 3300026116 Bacteria 5244
184 Ga0207674_10095286 3300026116 Bacteria 2962
185 Ga0207674_10327138 3300026116 Bacteria 1482
186 Ga0207683_10001445 3300026121 Bacteria 21485
187 Ga0207698_10026513 3300026142 Bacteria 4101
188 Ga0207698_10069088 3300026142 Bacteria 2792
189 Ga0207698_10134015 3300026142 Unclassified 2122
190 Ga0207698_10147043 3300026142 Bacteria 2040
191 Ga0268264_10011914 3300028381 Bacteria 7162
192 Ga0268264_10022665 3300028381 Bacteria 5125
193 Ga0307515_10000071 3300028794 Bacteria 238152
194 Ga0265327_10000048 3300031251 Bacteria 269173
195 Ga0265327_10036065 3300031251 Bacteria 2723
196 Ga0265316_10003180 3300031344 Bacteria 16707
197 Ga0265316_10135608 3300031344 Bacteria 1852
198 Ga0307513_10035609 3300031456 Bacteria 5566
199 Ga0307513_10059296 3300031456 Bacteria 4063
200 Ga0307513_10089284 3300031456 Unclassified 3147
201 Ga0307509_10113997 3300031507 Bacteria 2699
202 Ga0307509_10207032 3300031507 Bacteria 1791
203 Ga0316576_10128768 3300031727 Bacteria 1904
204 Ga0307516_10173763 3300031730 Bacteria 1893
205 Ga0307416_100001118 3300032002 Bacteria 14418
206 Ga0307415_100010971 3300032126 Bacteria 5159
207 Ga0316585_10013626 3300032137 Unclassified 2422
208 Ga0316584_0150867 3300036712 Unclassified 1730
209 Ga0400483_136188 3300039062 Bacteria 3245
210 Ga0439436_0001324 3300041404 Bacteria 7106
211 Ga0451853_0772990 3300041512 Bacteria 2741
212 Ga0451853_1331847 3300041512 Bacteria 2492
213 Ga0451853_2149495 3300041512 Bacteria 2857
214 Ga0439449_0041090 3300042007 Bacteria 1719
215 Ga0439457_001189 3300042014 Bacteria 7833
216 Ga0439457_004669 3300042014 Bacteria 3544
217 Ga0451577_0000022 3300042876 Bacteria 437063
218 Ga0451577_0013792 3300042876 Bacteria 7552
219 Ga0451577_0034004 3300042876 Bacteria 4597
220 Ga0451577_0118864 3300042876 Bacteria 2367
221 Ga0451577_0121876 3300042876 Bacteria 2336
222 Ga0451577_0132200 3300042876 Bacteria 2239
223 Ga0466969_0000045 3300044656 Bacteria 64246
224 Ga0466969_0005073 3300044656 Bacteria 7005
225 Ga0466972_0000075 3300044658 Bacteria 94290
226 Ga0466972_0011523 3300044658 Bacteria 4437
227 Ga0466972_0095151 3300044658 Bacteria 1411
228 Ga0453683_0000516 3300044673 Bacteria 43632
229 Ga0453683_0000639 3300044673 Bacteria 37874
230 Ga0453683_0099162 3300044673 Unclassified 1829
231 Ga0466966_0000131 3300044684 Bacteria 48304
232 Ga0466966_0000446 3300044684 Bacteria 26590
233 Ga0453684_0000288 3300044712 Bacteria 216718
234 Ga0453684_0000353 3300044712 Bacteria 191059
235 Ga0453684_0000607 3300044712 Bacteria 131953
236 Ga0453684_0000651 3300044712 Bacteria 125123
237 Ga0453684_0001141 3300044712 Bacteria 82874
238 Ga0453684_0026769 3300044712 Bacteria 8309
239 Ga0453684_0037979 3300044712 Bacteria 6596
240 Ga0453684_0046092 3300044712 Bacteria 5804
241 Ga0453684_0107300 3300044712 Bacteria 3401
242 Ga0453684_0142270 3300044712 Bacteria 2862
243 Ga0453684_0143044 3300044712 Bacteria 2852
244 Ga0453684_0166623 3300044712 Bacteria 2600
245 Ga0453684_0272032 3300044712 Bacteria 1935
246 Ga0466957_0000479 3300044842 Bacteria 19861
247 Ga0466957_0025508 3300044842 Bacteria 3504
248 Ga0466959_0000003 3300045049 Bacteria 285164
249 Ga0466959_0000062 3300045049 Bacteria 75615
250 Ga0451576_0000044 3300045051 Bacteria 334467
251 Ga0451576_0000080 3300045051 Bacteria 242782
252 Ga0451576_0000760 3300045051 Bacteria 63689
253 Ga0451576_0006009 3300045051 Bacteria 15007
254 Ga0451576_0011780 3300045051 Bacteria 9903
255 Ga0451576_0026540 3300045051 Bacteria 6230
256 Ga0451576_0215940 3300045051 Bacteria 2003
257 Ga0451576_0249626 3300045051 Bacteria 1854
258 Ga0466967_0088460 3300045976 Unclassified 2811
259 Ga0495638_0000004 3300046460 Bacteria 700795
260 Ga0495672_0070006 3300047320 Bacteria 1989
261 Ga0496110_0186040 3300048913 Bacteria 1886
262 Ga0496111_0213961 3300048914 Bacteria 1432
263 Ga0496115_0170855 3300048918 Bacteria 1798
264 Ga0501034_0100065 3300049571 Bacteria 2893
265 Ga0501037_0171521 3300049573 Bacteria 1542
266 Ga0501047_0032660 3300049581 Bacteria 5026
267 Ga0501047_0057550 3300049581 Bacteria 3759
268 Ga0501047_0100706 3300049581 Bacteria 2769
269 Ga0501047_0152027 3300049581 Bacteria 2190
270 Ga0501198_007402 3300049649 Unclassified 1580
271 Ga0501202_000059 3300049652 Bacteria 11324
272 Ga0501207_002958 3300049654 Unclassified 2223
273 Ga0501217_007276 3300049661 Unclassified 2368
274 Ga0501223_001295 3300049663 Bacteria 5802
275 Ga0501223_002995 3300049663 Bacteria 3706
276 Ga0501228_000418 3300049666 Bacteria 2697
277 Ga0501235_012602 3300049669 Unclassified 1860
278 Ga0501242_004216 3300049674 Bacteria 1591
279 Ga0501246_001226 3300049676 Bacteria 1947
280 Ga0501257_029828 3300049686 Unclassified 1311
281 Ga0501259_000154 3300049688 Bacteria 10343
282 Ga0501245_001912 3300049708 Bacteria 2745
283 Ga0501044_0008746 3300049823 Bacteria 11078
284 nmdc:mga0k408_60047_c1 3300050493 Bacteria 2209
285 nmdc:mga05p37_17351_c1 3300050507 Bacteria 7492
286 nmdc:mga05p37_1961_c1 3300050507 Bacteria 23994
287 nmdc:mga09592_88128_c1 3300050508 Bacteria 2650
288 Ga0500578_0000091 3300053086 Bacteria 102427
289 Ga0500644_0028648 3300053088 Bacteria 1744
290 Ga0500583_0000011 3300053092 Bacteria 160380
291 Ga0500583_0000290 3300053092 Bacteria 17375
292 Ga0500651_0175778 3300053093 Bacteria 1274
293 Ga0500556_0016615 3300053104 Bacteria 2292
294 Ga0500616_0000015 3300053153 Bacteria 633259
295 Ga0500622_0003889 3300053156 Bacteria 9676
296 Ga0500622_0006439 3300053156 Bacteria 6808
297 Ga0500622_0021063 3300053156 Bacteria 3461
298 Ga0500622_0039775 3300053156 Bacteria 2451
299 2522551675 2522125168 Bacteria 7376607
300 2738724844 2738541278 Bacteria 9755573
301 2896088990 2896085136 Bacteria 6129793
302 2896114927 2896109856 Bacteria 7140722
303 2929927374 2929921140 Bacteria 8649150
304 8003151250 8003151029 Bacteria 8187759
305 Ga0501225_0022098
306 SwRhRL2b_contig_2522128
307 JGI24740J21852_10000108
308 JGI25154J39366_1000004
309 JGI25157J39369_1003619
310 JGI25153J46596_10002060
311 rootH1_10035121
312 rootH1_10070971
313 rootH1_10175372
314 rootH2_10292954
315 rootL2_10012549
316 rootL2_10055799
317 rootL2_10129508
318 rootL2_10325471
319 rootH1_10011869
320 rootH1_10065858
321 rootH1_10217057
322 JGI25160J50197_1002908
323 Ga0055530_10022727
324 Ga0065165_1026255
325 Ga0065704_10072542
326 Ga0070658_10068374
327 Ga0070683_100005960
328 Ga0070683_100051391
329 Ga0068869_100001858
330 Ga0068869_100022746
331 Ga0070666_10010511
332 Ga0070666_10017296
333 Ga0070666_10029242
334 Ga0070680_100116515
335 Ga0068868_100015432
336 Ga0070660_100016195
337 Ga0070661_100000443
338 Ga0070661_100024200
339 Ga0070669_100083954
340 Ga0070669_100119546
341 Ga0070671_100311497
342 Ga0070674_100118095
343 Ga0070673_100053537
344 Ga0070659_100024073
345 Ga0070667_100043716
346 Ga0070678_100028760
347 Ga0070662_100088937
348 Ga0070662_100107917
349 Ga0070681_10071658
350 Ga0070698_100032388
351 Ga0070679_100128266
352 Ga0070679_100158482
353 Ga0070684_100000659
354 Ga0068853_100024606
355 Ga0068853_100039239
356 Ga0068853_100092986
357 Ga0070686_100069671
358 Ga0070693_100057656
359 Ga0070665_100147618
360 Ga0068855_100005466
361 Ga0068855_100009045
362 Ga0068855_100064068
363 Ga0068855_100074269
364 Ga0070664_100000126
365 Ga0070664_100031608
366 Ga0068857_100009963
367 Ga0068857_100039736
368 Ga0068857_100188931
369 Ga0068856_100009293
370 Ga0068856_100065342
371 Ga0070702_100123586
372 Ga0068852_100000290
373 Ga0068852_100023510
374 Ga0068852_100074349
375 Ga0068852_100076578
376 Ga0068852_100139750
377 Ga0068866_10025880
378 Ga0068851_10045640
379 Ga0068863_100012636
380 Ga0068858_100279469
381 Ga0068860_100007086
382 Ga0068860_100018822
383 Ga0068862_100089732
384 Ga0081539_10000223
385 Ga0075366_10013912
386 Ga0075366_10023332
387 Ga0097621_100000459
388 Ga0068871_100000069
389 Ga0068871_100096364
390 Ga0075429_100074075
391 Ga0068865_100033593
392 Ga0105240_10000445
393 Ga0105240_10461222
394 Ga0111539_10030005
395 Ga0114129_10001760
396 Ga0114129_10102445
397 Ga0105241_10006101
398 Ga0105241_10013478
399 Ga0105242_10059072
400 Ga0105242_10092203
401 Ga0105237_10014679
402 Ga0105238_10000449
403 Ga0105249_10293224
404 Ga0105239_10000746
405 Ga0105239_10002476
406 Ga0105239_10178487
407 Ga0105246_10014680
408 Ga0157373_10032434
409 Ga0157371_10101093
410 Ga0157371_10126891
411 Ga0157370_10073081
412 Ga0157369_10027792
413 Ga0157374_10049702
414 Ga0157374_10144351
415 Ga0157378_10029159
416 Ga0157378_10069533
417 Ga0157378_10072950
418 Ga0157378_10245566
419 Ga0163162_10000170
420 Ga0163162_10000350
421 Ga0163162_10077625
422 Ga0163162_10132977
423 Ga0163162_10538424
424 Ga0157372_10196013
425 Ga0157372_10399568
426 Ga0157375_10000517
427 Ga0157375_10233751
428 Ga0163163_10060855
429 Ga0157380_10217018
430 Ga0157377_10046308
431 Ga0157377_10116239
432 Ga0157377_10131873
433 Ga0157379_10017632
434 Ga0157376_10001292
435 Ga0163161_10008885
436 Ga0209646_1000025
437 Ga0209026_1000097
438 Ga0209050_1001839
439 Ga0207426_1000220
440 Ga0207680_10016627
441 Ga0207680_10028193
442 Ga0207680_10039240
443 Ga0207645_10001454
444 Ga0207707_10141517
445 Ga0207695_10001116
446 Ga0207695_10100074
447 Ga0207671_10003307
448 Ga0207662_10101907
449 Ga0207657_10002187
450 Ga0207649_10015613
451 Ga0207649_10185161
452 Ga0207681_10088759
453 Ga0207681_10144839
454 Ga0207694_10019375
455 Ga0207650_10021037
456 Ga0207659_10126180
457 Ga0207690_10161791
458 Ga0207686_10070387
459 Ga0207670_10198246
460 Ga0207669_10185994
461 Ga0207704_10036475
462 Ga0207691_10012392
463 Ga0207689_10004733
464 Ga0207689_10008375
465 Ga0207661_10006567
466 Ga0207679_10000251
467 Ga0207667_10001182
468 Ga0207667_10008930
469 Ga0207667_10031549
470 Ga0207651_10013761
471 Ga0207668_10046197
472 Ga0207640_10036772
473 Ga0207640_10168015
474 Ga0207658_10016681
475 Ga0207658_10202614
476 Ga0207703_10182010
477 Ga0207639_10023119
478 Ga0207639_10041238
479 Ga0207639_10136893
480 Ga0207678_10078296
481 Ga0207702_10063039
482 Ga0207702_10090079
483 Ga0207641_10064351
484 Ga0207648_10026557
485 Ga0207676_10254422
486 Ga0207674_10011920
487 Ga0207674_10034994
488 Ga0207674_10095286
489 Ga0207674_10327138
490 Ga0207683_10001445
491 Ga0207698_10026513
492 Ga0207698_10069088
493 Ga0207698_10134015
494 Ga0207698_10147043
495 Ga0268264_10011914
496 Ga0268264_10022665
497 Ga0307515_10000071
498 Ga0265327_10000048
499 Ga0265327_10036065
500 Ga0265316_10003180
501 Ga0265316_10135608
502 Ga0307513_10035609
503 Ga0307513_10059296
504 Ga0307513_10089284
505 Ga0307509_10113997
506 Ga0307509_10207032
507 Ga0316576_10128768
508 Ga0307516_10173763
509 Ga0307416_100001118
510 Ga0307415_100010971
511 Ga0316585_10013626
512 Ga0316584_0150867
513 Ga0400483_136188
514 Ga0439436_0001324
515 Ga0451853_0772990
516 Ga0451853_1331847
517 Ga0451853_2149495
518 Ga0439449_0041090
519 Ga0439457_001189
520 Ga0439457_004669
521 Ga0451577_0000022
522 Ga0451577_0013792
523 Ga0451577_0034004
524 Ga0451577_0118864
525 Ga0451577_0121876
526 Ga0451577_0132200
527 Ga0466969_0000045
528 Ga0466969_0005073
529 Ga0466972_0000075
530 Ga0466972_0011523
531 Ga0466972_0095151
532 Ga0453683_0000516
533 Ga0453683_0000639
534 Ga0453683_0099162
535 Ga0466966_0000131
536 Ga0466966_0000446
537 Ga0453684_0000288
538 Ga0453684_0000353
539 Ga0453684_0000607
540 Ga0453684_0000651
541 Ga0453684_0001141
542 Ga0453684_0026769
543 Ga0453684_0037979
544 Ga0453684_0046092
545 Ga0453684_0107300
546 Ga0453684_0142270
547 Ga0453684_0143044
548 Ga0453684_0166623
549 Ga0453684_0272032
550 Ga0466957_0000479
551 Ga0466957_0025508
552 Ga0466959_0000003
553 Ga0466959_0000062
554 Ga0451576_0000044
555 Ga0451576_0000080
556 Ga0451576_0000760
557 Ga0451576_0006009
558 Ga0451576_0011780
559 Ga0451576_0026540
560 Ga0451576_0215940
561 Ga0451576_0249626
562 Ga0466967_0088460
563 Ga0495638_0000004
564 Ga0495672_0070006
565 Ga0496110_0186040
566 Ga0496111_0213961
567 Ga0496115_0170855
568 Ga0501034_0100065
569 Ga0501037_0171521
570 Ga0501047_0032660
571 Ga0501047_0057550
572 Ga0501047_0100706
573 Ga0501047_0152027
574 Ga0501198_007402
575 Ga0501202_000059
576 Ga0501207_002958
577 Ga0501217_007276
578 Ga0501223_001295
579 Ga0501223_002995
580 Ga0501228_000418
581 Ga0501235_012602
582 Ga0501242_004216
583 Ga0501246_001226
584 Ga0501257_029828
585 Ga0501259_000154
586 Ga0501245_001912
587 Ga0501044_0008746
588 nmdc:mga0k408_60047_c1
589 nmdc:mga05p37_17351_c1
590 nmdc:mga05p37_1961_c1
591 nmdc:mga09592_88128_c1
592 Ga0500578_0000091
593 Ga0500644_0028648
594 Ga0500583_0000011
595 Ga0500583_0000290
596 Ga0500651_0175778
597 Ga0500556_0016615
598 Ga0500616_0000015
599 Ga0500622_0003889
600 Ga0500622_0006439
601 Ga0500622_0021063
602 Ga0500622_0039775
603 2522551675
604 2738724844
605 2896088990
606 2896114927
607 2929927374
608 8003151250

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00150

Cellulase

Cellulase (glycosyl hydrolase family 5)

108

427

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w0k-assembly2.cif.gz_B crystal structure of a glycoside hydrolase 0.9352 31 374
7ec9-assembly1.cif.gz_A structure of the thermotoga maritima family 5 endo-glucanase in complex with 1-deoxynojiromycin 0.9332 32 372
3w0k-assembly1.cif.gz_A crystal structure of a glycoside hydrolase 0.9332 31 374
3w0k-assembly2.cif.gz_B crystal structure of a glycoside hydrolase 0.9269 31 374
3w0k-assembly1.cif.gz_A crystal structure of a glycoside hydrolase 0.925 31 374
ID Description Score Start End Superfamily
3w0kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9352 31 374 3.20.20.80
af_Q58211_1_225_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9339 96 120 3.40.50.300
1vjzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9335 29 372 3.20.20.80
1vjzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9279 29 372 3.20.20.80
3w0kB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9269 31 374 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7X9F9H5-F1-model_v4 Glycosyl hydrolase family 5 1.004 300 372 GO:0016787
AF-A0A2Z4G8J7-F1-model_v4 Glycosyl hydrolase family 5 0.9934 26 372 GO:0005576
GO:0008422
GO:0009251
GO:0009986
AF-A0A4Q3UHI6-F1-model_v4 Glycosyl hydrolase family 5 0.9917 96 352 GO:0005576
GO:0008422
GO:0009251
GO:0009986
AF-A0A661XWZ1-F1-model_v4 Glycosyl hydrolase family 5 0.991 26 292 GO:0005576
GO:0008422
GO:0009251
GO:0009986
AF-A0A7C3SGV4-F1-model_v4 Glycoside hydrolase 0.9874 288 372 GO:0016787

Map